F448888

General Info

Members Datasets Scaffolds Average Seq Length
462 235 924 120

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_101530702|Ga0075434_1015307022
Length 111
Sequence MSKPPDLVQGTLDLLILKILALGPHHGWAISQRIKQASDDELQVSVGSLYPALHKLELAGLITAEWKTSELGRRAKFYSLSRSGRRHLGHEADHWRRVSSAIGRILQLKEV

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
114 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
179 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
180 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
181 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
182 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
183 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
184 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
185 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
186 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
187 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
188 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
189 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
190 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
191 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
193 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
194 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
195 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
196 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
197 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
198 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
199 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
200 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
201 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
202 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
203 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
204 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
205 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
206 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
213 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
216 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
217 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
218 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
219 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
220 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
221 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
222 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
223 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
224 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
225 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
226 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
235 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 1.52
Rhizosphere 97.19
Stem 0
Stem Tuber 0
Unclassified 30.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_101530702 3300006871 Unclassified 676
2 JGI24743J22301_10084846 3300001991 Unclassified 671
3 JGI24750J21931_1022160 3300002070 Bacteria 895
4 Ga0065715_10801277 3300005293 Unclassified 610
5 Ga0065707_10394356 3300005295 Bacteria 860
6 Ga0070658_11593302 3300005327 Bacteria 566
7 Ga0070676_10082987 3300005328 Bacteria 1948
8 Ga0070683_100003868 3300005329 Bacteria 12241
9 Ga0070683_100012306 3300005329 Bacteria 7432
10 Ga0070683_100083954 3300005329 Bacteria 2984
11 Ga0070683_100136914 3300005329 Bacteria 2319
12 Ga0070683_100157336 3300005329 Bacteria 2155
13 Ga0070690_100937908 3300005330 Bacteria 679
14 Ga0070670_100008106 3300005331 Bacteria 8937
15 Ga0070670_100615609 3300005331 Bacteria 972
16 Ga0070670_100997243 3300005331 Unclassified 761
17 Ga0070677_10093217 3300005333 Bacteria 1314
18 Ga0070677_10325253 3300005333 Unclassified 789
19 Ga0070677_10881328 3300005333 Unclassified 516
20 Ga0068869_100345046 3300005334 Unclassified 1212
21 Ga0070666_10496092 3300005335 Bacteria 885
22 Ga0070680_100026711 3300005336 Bacteria 4617
23 Ga0070680_100070235 3300005336 Bacteria 2877
24 Ga0070680_100071987 3300005336 Bacteria 2841
25 Ga0070680_100145895 3300005336 Bacteria 1985
26 Ga0070682_100187459 3300005337 Unclassified 1450
27 Ga0070682_100587869 3300005337 Bacteria 877
28 Ga0068868_100342547 3300005338 Bacteria 1278
29 Ga0068868_101852843 3300005338 Bacteria 571
30 Ga0070660_100141614 3300005339 Bacteria 1930
31 Ga0070689_100018020 3300005340 Bacteria 5194
32 Ga0070689_100210116 3300005340 Unclassified 1592
33 Ga0070687_100008003 3300005343 Bacteria 4449
34 Ga0070661_100004118 3300005344 Bacteria 10026
35 Ga0070661_100089271 3300005344 Bacteria 2282
36 Ga0070661_100966065 3300005344 Bacteria 705
37 Ga0070692_10071641 3300005345 Bacteria 1847
38 Ga0070668_100161287 3300005347 Bacteria 1819
39 Ga0070668_100260812 3300005347 Bacteria 1441
40 Ga0070669_101256567 3300005353 Bacteria 640
41 Ga0070675_100077642 3300005354 Bacteria 2764
42 Ga0070675_100151556 3300005354 Bacteria 1988
43 Ga0070675_100711991 3300005354 Bacteria 915
44 Ga0070671_100312356 3300005355 Bacteria 1339
45 Ga0070671_101390787 3300005355 Bacteria 620
46 Ga0070674_100332916 3300005356 Bacteria 1221
47 Ga0070673_100081011 3300005364 Unclassified 2631
48 Ga0070673_100125321 3300005364 Bacteria 2148
49 Ga0070673_100472046 3300005364 Unclassified 1131
50 Ga0070688_100184163 3300005365 Bacteria 1450
51 Ga0070659_100008985 3300005366 Bacteria 7327
52 Ga0070659_100019264 3300005366 Bacteria 5167
53 Ga0070659_100043214 3300005366 Bacteria 3524
54 Ga0070667_100230923 3300005367 Bacteria 1650
55 Ga0070667_101148315 3300005367 Unclassified 726
56 Ga0070703_10171166 3300005406 Bacteria 832
57 Ga0070709_10006172 3300005434 Bacteria 6524
58 Ga0070709_10031381 3300005434 Bacteria 3195
59 Ga0070709_10066840 3300005434 Unclassified 2307
60 Ga0070709_10407677 3300005434 Bacteria 1016
61 Ga0070714_100037682 3300005435 Bacteria 4064
62 Ga0070714_100799951 3300005435 Bacteria 913
63 Ga0070713_100000205 3300005436 Bacteria 39416
64 Ga0070713_100014902 3300005436 Bacteria 5787
65 Ga0070713_100527610 3300005436 Bacteria 1116
66 Ga0070710_10385137 3300005437 Bacteria 936
67 Ga0070701_10031500 3300005438 Bacteria 2632
68 Ga0070711_100468594 3300005439 Bacteria 1033
69 Ga0070711_100468836 3300005439 Unclassified 1033
70 Ga0070700_100043202 3300005441 Unclassified 2771
71 Ga0070700_100857068 3300005441 Unclassified 736
72 Ga0070694_100131144 3300005444 Bacteria 1811
73 Ga0070694_100317489 3300005444 Bacteria 1198
74 Ga0070663_100020605 3300005455 Bacteria 4366
75 Ga0070663_100078742 3300005455 Bacteria 2417
76 Ga0070663_100865023 3300005455 Unclassified 779
77 Ga0070678_101161393 3300005456 Bacteria 715
78 Ga0070662_100125632 3300005457 Bacteria 1971
79 Ga0070662_100792008 3300005457 Bacteria 806
80 Ga0070662_100792919 3300005457 Unclassified 805
81 Ga0070681_10001833 3300005458 Bacteria 19168
82 Ga0070681_10018160 3300005458 Bacteria 7031
83 Ga0070681_10183302 3300005458 Bacteria 2015
84 Ga0070681_10266220 3300005458 Bacteria 1625
85 Ga0070681_10426913 3300005458 Bacteria 1237
86 Ga0070681_11488055 3300005458 Bacteria 601
87 Ga0068867_100343991 3300005459 Archaea 1243
88 Ga0068867_100560966 3300005459 Unclassified 990
89 Ga0068867_100737553 3300005459 Unclassified 873
90 Ga0070685_10080963 3300005466 Unclassified 1946
91 Ga0070706_101445656 3300005467 Bacteria 629
92 Ga0070699_100019563 3300005518 Bacteria 5833
93 Ga0070699_100820751 3300005518 Bacteria 851
94 Ga0070679_100003639 3300005530 Bacteria 14101
95 Ga0070679_100011027 3300005530 Bacteria 8594
96 Ga0070679_100031564 3300005530 Bacteria 5235
97 Ga0070679_100044902 3300005530 Bacteria 4402
98 Ga0070679_100055314 3300005530 Unclassified 3952
99 Ga0070679_100055592 3300005530 Bacteria 3941
100 Ga0070679_101257487 3300005530 Bacteria 686
101 Ga0070684_100010529 3300005535 Bacteria 7330
102 Ga0070684_100205382 3300005535 Bacteria 1795
103 Ga0070684_100293828 3300005535 Bacteria 1490
104 Ga0070684_100305830 3300005535 Bacteria 1459
105 Ga0070684_100553996 3300005535 Unclassified 1067
106 Ga0070684_100587011 3300005535 Unclassified 1035
107 Ga0068853_100180010 3300005539 Unclassified 1917
108 Ga0068853_100330290 3300005539 Bacteria 1415
109 Ga0070672_100025899 3300005543 Unclassified 4356
110 Ga0070672_102018158 3300005543 Unclassified 519
111 Ga0070695_101282944 3300005545 Unclassified 605
112 Ga0070695_101333309 3300005545 Bacteria 594
113 Ga0070696_100097088 3300005546 Bacteria 2106
114 Ga0070693_100001758 3300005547 Bacteria 9878
115 Ga0070665_100040416 3300005548 Bacteria 4688
116 Ga0070665_100221720 3300005548 Bacteria 1891
117 Ga0070665_100222314 3300005548 Bacteria 1889
118 Ga0070704_101851791 3300005549 Unclassified 559
119 Ga0068855_100086019 3300005563 Bacteria 3636
120 Ga0068855_100274318 3300005563 Bacteria 1874
121 Ga0068855_101154971 3300005563 Bacteria 807
122 Ga0070664_100001560 3300005564 Bacteria 18306
123 Ga0070664_100128695 3300005564 Bacteria 2223
124 Ga0070664_100464630 3300005564 Bacteria 1163
125 Ga0070664_101902112 3300005564 Unclassified 564
126 Ga0068857_100002194 3300005577 Bacteria 15890
127 Ga0068857_102026442 3300005577 Unclassified 564
128 Ga0068854_100088245 3300005578 Bacteria 2303
129 Ga0068856_100355747 3300005614 Unclassified 1483
130 Ga0068856_100376923 3300005614 Bacteria 1438
131 Ga0068856_100831598 3300005614 Unclassified 943
132 Ga0068852_100020299 3300005616 Bacteria 5282
133 Ga0068859_100611649 3300005617 Bacteria 1182
134 Ga0068859_101701569 3300005617 Unclassified 697
135 Ga0068864_100044222 3300005618 Bacteria 3816
136 Ga0068866_10217092 3300005718 Bacteria 1152
137 Ga0068861_100006652 3300005719 Bacteria 7892
138 Ga0068861_101425772 3300005719 Unclassified 677
139 Ga0068851_10051225 3300005834 Bacteria 2098
140 Ga0068851_10126486 3300005834 Unclassified 1379
141 Ga0068870_10120341 3300005840 Bacteria 1512
142 Ga0068863_100077250 3300005841 Bacteria 3151
143 Ga0068863_101581562 3300005841 Unclassified 664
144 Ga0068858_100100013 3300005842 Bacteria 2704
145 Ga0068858_101039989 3300005842 Bacteria 803
146 Ga0068860_100060399 3300005843 Bacteria 3602
147 Ga0068860_100225050 3300005843 Unclassified 1822
148 Ga0068862_100421131 3300005844 Unclassified 1253
149 Ga0068862_101509040 3300005844 Unclassified 677
150 Ga0070717_10013901 3300006028 Bacteria 6182
151 Ga0070717_10228935 3300006028 Bacteria 1636
152 Ga0070717_10819030 3300006028 Bacteria 847
153 Ga0070717_11293078 3300006028 Bacteria 663
154 Ga0070716_100015772 3300006173 Bacteria 3889
155 Ga0070716_100207369 3300006173 Bacteria 1307
156 Ga0070716_101555132 3300006173 Bacteria 542
157 Ga0075366_10346683 3300006195 Bacteria 911
158 Ga0097621_100502272 3300006237 Bacteria 1099
159 Ga0075428_100051260 3300006844 Bacteria 4526
160 Ga0075431_100653498 3300006847 Bacteria 1032
161 Ga0075433_10031903 3300006852 Bacteria 4508
162 Ga0075433_10043196 3300006852 Bacteria 3912
163 Ga0075433_10522192 3300006852 Bacteria 1044
164 Ga0075434_100002221 3300006871 Bacteria 16944
165 Ga0075434_100362196 3300006871 Bacteria 1471
166 Ga0075429_100347150 3300006880 Bacteria 1299
167 Ga0068865_100313457 3300006881 Unclassified 1259
168 Ga0068865_100909723 3300006881 Unclassified 766
169 Ga0097620_100611674 3300006931 Bacteria 1182
170 Ga0097620_101701309 3300006931 Unclassified 697
171 Ga0105251_10497915 3300009011 Bacteria 569
172 Ga0105240_10004336 3300009093 Bacteria 21654
173 Ga0105240_10146676 3300009093 Bacteria 2815
174 Ga0105240_10457255 3300009093 Unclassified 1427
175 Ga0105240_10528411 3300009093 Bacteria 1308
176 Ga0111539_10049062 3300009094 Bacteria 5038
177 Ga0111539_10068022 3300009094 Bacteria 4205
178 Ga0111539_10141687 3300009094 Bacteria 2814
179 Ga0105245_10362703 3300009098 Unclassified 1438
180 Ga0105245_10949308 3300009098 Unclassified 903
181 Ga0105245_12084275 3300009098 Unclassified 621
182 Ga0114129_10013422 3300009147 Bacteria 11673
183 Ga0114129_10019213 3300009147 Bacteria 9735
184 Ga0114129_10179245 3300009147 Bacteria 2884
185 Ga0114129_10322795 3300009147 Unclassified 2052
186 Ga0105243_10761549 3300009148 Unclassified 950
187 Ga0105241_10195005 3300009174 Bacteria 1688
188 Ga0105241_10631874 3300009174 Bacteria 970
189 Ga0105241_10911216 3300009174 Bacteria 817
190 Ga0105241_12358496 3300009174 Unclassified 530
191 Ga0105242_10148432 3300009176 Bacteria 2042
192 Ga0105248_10137806 3300009177 Bacteria 2753
193 Ga0105248_10550164 3300009177 Bacteria 1302
194 Ga0105248_10564991 3300009177 Bacteria 1283
195 Ga0105248_10731107 3300009177 Bacteria 1117
196 Ga0105237_11272137 3300009545 Unclassified 742
197 Ga0105238_10314006 3300009551 Bacteria 1552
198 Ga0105238_10390758 3300009551 Unclassified 1383
199 Ga0105249_10101435 3300009553 Unclassified 2707
200 Ga0105249_10944494 3300009553 Bacteria 930
201 Ga0105239_10077958 3300010375 Bacteria 3646
202 Ga0105246_11168343 3300011119 Unclassified 707
203 Ga0157373_10035722 3300013100 Bacteria 3566
204 Ga0157373_10472292 3300013100 Bacteria 904
205 Ga0157373_11207100 3300013100 Unclassified 570
206 Ga0157371_10095400 3300013102 Bacteria 2108
207 Ga0157370_10006871 3300013104 Bacteria 12461
208 Ga0157370_10098143 3300013104 Bacteria 2748
209 Ga0157370_10838483 3300013104 Unclassified 836
210 Ga0157369_10035412 3300013105 Bacteria 5473
211 Ga0157369_10182819 3300013105 Bacteria 2205
212 Ga0157369_10504503 3300013105 Bacteria 1252
213 Ga0157374_10107725 3300013296 Bacteria 2678
214 Ga0157374_10476265 3300013296 Bacteria 1251
215 Ga0157378_10089837 3300013297 Bacteria 2791
216 Ga0157378_10599647 3300013297 Unclassified 1112
217 Ga0163162_10265241 3300013306 Unclassified 1849
218 Ga0163162_10315931 3300013306 Bacteria 1695
219 Ga0157372_10009256 3300013307 Bacteria 10474
220 Ga0157372_10076238 3300013307 Bacteria 3786
221 Ga0157372_10211255 3300013307 Bacteria 2249
222 Ga0157372_10394903 3300013307 Bacteria 1612
223 Ga0157372_10988713 3300013307 Bacteria 975
224 Ga0157375_10329540 3300013308 Unclassified 1691
225 Ga0157375_10806296 3300013308 Bacteria 1087
226 Ga0157375_11165099 3300013308 Unclassified 903
227 Ga0163163_10025574 3300014325 Bacteria 5628
228 Ga0157380_10377687 3300014326 Bacteria 1336
229 Ga0157377_10131085 3300014745 Unclassified 1531
230 Ga0157379_10252123 3300014968 Bacteria 1602
231 Ga0157376_11553400 3300014969 Unclassified 695
232 Ga0157376_12160898 3300014969 Bacteria 595
233 Ga0163161_10033531 3300017792 Bacteria 3669
234 Ga0163161_10104408 3300017792 Bacteria 2112
235 Ga0213876_10154012 3300021384 Bacteria 1222
236 Ga0213876_10322433 3300021384 Unclassified 821
237 Ga0224572_1013254 3300024225 Bacteria 1572
238 Ga0207673_1048810 3300025290 Unclassified 599
239 Ga0207697_10012994 3300025315 Unclassified 3479
240 Ga0207656_10220260 3300025321 Unclassified 922
241 Ga0207653_10235893 3300025885 Unclassified 698
242 Ga0207682_10020364 3300025893 Bacteria 2605
243 Ga0207682_10089250 3300025893 Bacteria 1334
244 Ga0207642_10380488 3300025899 Bacteria 840
245 Ga0207642_10588050 3300025899 Unclassified 691
246 Ga0207688_10457242 3300025901 Bacteria 796
247 Ga0207647_10312081 3300025904 Unclassified 894
248 Ga0207699_10108027 3300025906 Unclassified 1779
249 Ga0207699_10392875 3300025906 Bacteria 986
250 Ga0207645_10016807 3300025907 Bacteria 4838
251 Ga0207645_10234306 3300025907 Unclassified 1212
252 Ga0207643_10066646 3300025908 Unclassified 2065
253 Ga0207643_10124310 3300025908 Unclassified 1531
254 Ga0207705_10627316 3300025909 Bacteria 836
255 Ga0207654_11318449 3300025911 Unclassified 526
256 Ga0207707_10000784 3300025912 Bacteria 31134
257 Ga0207707_10002076 3300025912 Bacteria 18130
258 Ga0207707_10046589 3300025912 Bacteria 3776
259 Ga0207707_10108138 3300025912 Bacteria 2431
260 Ga0207707_10124612 3300025912 Bacteria 2253
261 Ga0207707_10184702 3300025912 Bacteria 1820
262 Ga0207695_10011653 3300025913 Bacteria 10625
263 Ga0207695_10014812 3300025913 Bacteria 9211
264 Ga0207695_10928962 3300025913 Bacteria 750
265 Ga0207660_10013038 3300025917 Bacteria 5443
266 Ga0207660_10027662 3300025917 Bacteria 3872
267 Ga0207660_10057082 3300025917 Bacteria 2796
268 Ga0207660_10248986 3300025917 Bacteria 1402
269 Ga0207660_10406789 3300025917 Bacteria 1096
270 Ga0207660_10762571 3300025917 Unclassified 790
271 Ga0207662_10013987 3300025918 Bacteria 4494
272 Ga0207657_10014566 3300025919 Bacteria 7663
273 Ga0207657_10103364 3300025919 Bacteria 2361
274 Ga0207649_10034820 3300025920 Bacteria 3020
275 Ga0207652_10001170 3300025921 Bacteria 23580
276 Ga0207652_10020528 3300025921 Bacteria 5442
277 Ga0207652_10022215 3300025921 Bacteria 5245
278 Ga0207652_10027729 3300025921 Bacteria 4722
279 Ga0207652_10083051 3300025921 Bacteria 2804
280 Ga0207652_10109391 3300025921 Unclassified 2450
281 Ga0207652_10184746 3300025921 Bacteria 1874
282 Ga0207681_10102381 3300025923 Unclassified 2068
283 Ga0207650_10017102 3300025925 Bacteria 5076
284 Ga0207659_10027784 3300025926 Bacteria 3835
285 Ga0207659_10171764 3300025926 Bacteria 1710
286 Ga0207659_10619075 3300025926 Bacteria 924
287 Ga0207687_10764274 3300025927 Unclassified 823
288 Ga0207687_10814814 3300025927 Unclassified 797
289 Ga0207687_11277000 3300025927 Unclassified 631
290 Ga0207700_10000186 3300025928 Bacteria 37331
291 Ga0207700_10471372 3300025928 Bacteria 1109
292 Ga0207700_10664130 3300025928 Bacteria 930
293 Ga0207664_10031395 3300025929 Bacteria 4064
294 Ga0207664_10164567 3300025929 Bacteria 1894
295 Ga0207664_10594553 3300025929 Bacteria 994
296 Ga0207644_10432388 3300025931 Bacteria 1080
297 Ga0207644_10705702 3300025931 Bacteria 841
298 Ga0207690_10012244 3300025932 Bacteria 5133
299 Ga0207690_10430386 3300025932 Unclassified 1057
300 Ga0207706_10001615 3300025933 Bacteria 22364
301 Ga0207706_10222954 3300025933 Bacteria 1650
302 Ga0207706_10291984 3300025933 Bacteria 1421
303 Ga0207686_10180038 3300025934 Bacteria 1498
304 Ga0207686_10261794 3300025934 Unclassified 1268
305 Ga0207709_10888914 3300025935 Unclassified 723
306 Ga0207670_10316318 3300025936 Bacteria 1227
307 Ga0207669_10448585 3300025937 Unclassified 1022
308 Ga0207669_10698086 3300025937 Unclassified 834
309 Ga0207704_10066220 3300025938 Unclassified 2266
310 Ga0207704_10253514 3300025938 Unclassified 1322
311 Ga0207665_10039888 3300025939 Bacteria 3131
312 Ga0207665_10508550 3300025939 Bacteria 931
313 Ga0207665_11398552 3300025939 Bacteria 557
314 Ga0207691_10003217 3300025940 Bacteria 15932
315 Ga0207691_10003707 3300025940 Bacteria 14819
316 Ga0207691_10745492 3300025940 Unclassified 825
317 Ga0207711_10275298 3300025941 Bacteria 1549
318 Ga0207711_10616353 3300025941 Bacteria 1013
319 Ga0207711_12066151 3300025941 Bacteria 512
320 Ga0207689_10014329 3300025942 Bacteria 6748
321 Ga0207661_10004915 3300025944 Bacteria 9369
322 Ga0207661_10021614 3300025944 Bacteria 4824
323 Ga0207661_10170350 3300025944 Bacteria 1895
324 Ga0207661_10361598 3300025944 Bacteria 1311
325 Ga0207661_10773272 3300025944 Unclassified 884
326 Ga0207661_11122616 3300025944 Bacteria 724
327 Ga0207679_10003506 3300025945 Bacteria 9706
328 Ga0207679_10052261 3300025945 Bacteria 2996
329 Ga0207679_10161898 3300025945 Bacteria 1833
330 Ga0207679_11082733 3300025945 Unclassified 735
331 Ga0207667_10425808 3300025949 Bacteria 1350
332 Ga0207667_10561907 3300025949 Bacteria 1153
333 Ga0207667_12016963 3300025949 Bacteria 537
334 Ga0207651_10084928 3300025960 Bacteria 2295
335 Ga0207651_10769144 3300025960 Unclassified 852
336 Ga0207712_10030006 3300025961 Bacteria 3654
337 Ga0207668_10028638 3300025972 Bacteria 3644
338 Ga0207640_10141742 3300025981 Bacteria 1753
339 Ga0207640_11523171 3300025981 Bacteria 601
340 Ga0207658_10190009 3300025986 Bacteria 1706
341 Ga0207677_10036267 3300026023 Bacteria 3212
342 Ga0207677_10487881 3300026023 Bacteria 1063
343 Ga0207677_11117387 3300026023 Bacteria 719
344 Ga0207703_10263266 3300026035 Bacteria 1559
345 Ga0207678_10013528 3300026067 Bacteria 7165
346 Ga0207678_10158551 3300026067 Bacteria 1933
347 Ga0207678_10518308 3300026067 Bacteria 1040
348 Ga0207708_10021870 3300026075 Bacteria 4826
349 Ga0207702_10190674 3300026078 Bacteria 1894
350 Ga0207702_11104317 3300026078 Bacteria 787
351 Ga0207702_11341874 3300026078 Unclassified 709
352 Ga0207641_10149199 3300026088 Bacteria 2116
353 Ga0207641_10901449 3300026088 Bacteria 878
354 Ga0207648_10109198 3300026089 Bacteria 2428
355 Ga0207648_10654133 3300026089 Bacteria 971
356 Ga0207648_10655309 3300026089 Unclassified 971
357 Ga0207676_10169666 3300026095 Unclassified 1900
358 Ga0207674_10000819 3300026116 Bacteria 40453
359 Ga0207674_10033672 3300026116 Bacteria 5363
360 Ga0207674_10041741 3300026116 Unclassified 4743
361 Ga0207675_100000174 3300026118 Bacteria 57684
362 Ga0207675_100019329 3300026118 Bacteria 6356
363 Ga0207683_10128866 3300026121 Bacteria 2275
364 Ga0207698_10260234 3300026142 Unclassified 1593
365 Ga0207428_10174635 3300027907 Bacteria 1626
366 Ga0207428_10216694 3300027907 Bacteria 1436
367 Ga0268266_10388043 3300028379 Unclassified 1318
368 Ga0268266_10593891 3300028379 Unclassified 1063
369 Ga0268265_10428846 3300028380 Bacteria 1229
370 Ga0268264_10270167 3300028381 Bacteria 1588
371 Ga0316182_1400959 3300030745 Bacteria 558
372 Ga0307408_100112708 3300031548 Bacteria 2092
373 Ga0307408_100813665 3300031548 Bacteria 849
374 Ga0307405_10758602 3300031731 Unclassified 809
375 Ga0307405_11278191 3300031731 Unclassified 638
376 Ga0307413_11786890 3300031824 Unclassified 550
377 Ga0307410_10662064 3300031852 Bacteria 877
378 Ga0307410_11240163 3300031852 Unclassified 651
379 Ga0307410_11361927 3300031852 Unclassified 622
380 Ga0307406_10001575 3300031901 Bacteria 12556
381 Ga0307412_10045403 3300031911 Bacteria 2872
382 Ga0307412_10759631 3300031911 Unclassified 838
383 Ga0307412_11894486 3300031911 Unclassified 550
384 Ga0307409_100117778 3300031995 Bacteria 2242
385 Ga0307409_100443822 3300031995 Unclassified 1251
386 Ga0307409_101033024 3300031995 Unclassified 841
387 Ga0307416_100733541 3300032002 Bacteria 1079
388 Ga0307416_101898601 3300032002 Unclassified 699
389 Ga0307416_103439675 3300032002 Unclassified 530
390 Ga0307414_10228804 3300032004 Unclassified 1532
391 Ga0307411_10691709 3300032005 Bacteria 887
392 Ga0307411_11107287 3300032005 Bacteria 714
393 Ga0307411_11706870 3300032005 Unclassified 583
394 Ga0307415_101146368 3300032126 Unclassified 730
395 Ga0307415_101194774 3300032126 Bacteria 716
396 Ga0373943_0301577 3300035170 Bacteria 910
397 Ga0373946_0128496 3300035171 Unclassified 1164
398 Ga0373955_0201265 3300035172 Bacteria 1186
399 Ga0373924_0453788 3300035410 Unclassified 575
400 Ga0373947_0421901 3300035725 Bacteria 902
401 Ga0395905_0278111 3300037471 Bacteria 1560
402 Ga0436365_0016134 3300039437 Bacteria 1912
403 Ga0436365_0071917 3300039437 Bacteria 930
404 Ga0451793_0859436 3300041452 Bacteria 520
405 Ga0439448_0239911 3300042005 Unclassified 639
406 Ga0439455_0094226 3300042012 Bacteria 823
407 Ga0451576_0295637 3300045051 Bacteria 1693
408 Ga0451576_0363790 3300045051 Bacteria 1515
409 Ga0451576_0427583 3300045051 Bacteria 1390
410 Ga0466967_0917313 3300045976 Unclassified 871
411 Ga0466967_1428150 3300045976 Unclassified 689
412 Ga0495580_0598280 3300046472 Bacteria 729
413 Ga0495663_0260233 3300046525 Unclassified 618
414 Ga0495633_0242429 3300046558 Unclassified 823
415 Ga0495647_0075388 3300046681 Bacteria 1358
416 Ga0495670_0095908 3300046691 Bacteria 1522
417 Ga0495636_0292937 3300047318 Unclassified 760
418 Ga0495684_0130744 3300047471 Bacteria 1886
419 Ga0496102_1563742 3300048905 Bacteria 578
420 Ga0496106_1148341 3300048909 Unclassified 607
421 Ga0496108_0471284 3300048911 Bacteria 1097
422 Ga0496109_0015460 3300048912 Bacteria 6652
423 Ga0496109_0808777 3300048912 Unclassified 875
424 Ga0496113_0697022 3300048916 Unclassified 811
425 Ga0501303_062850 3300049526 Unclassified 511
426 Ga0501040_1369853 3300049576 Bacteria 513
427 Ga0501042_1350479 3300049578 Unclassified 520
428 Ga0501068_0578820 3300049584 Unclassified 731
429 Ga0501072_0498926 3300049588 Bacteria 963
430 Ga0501075_0281926 3300049591 Bacteria 1266
431 Ga0501075_0361083 3300049591 Bacteria 1107
432 Ga0501077_0509149 3300049593 Unclassified 772
433 Ga0501233_202507 3300049668 Unclassified 578
434 Ga0501235_059730 3300049669 Unclassified 892
435 Ga0501235_195511 3300049669 Unclassified 545
436 Ga0501239_026228 3300049672 Bacteria 742
437 Ga0501249_078055 3300049679 Unclassified 777
438 Ga0501260_042206 3300049689 Unclassified 556
439 Ga0501081_0355633 3300049743 Unclassified 1080
440 Ga0501283_103754 3300049779 Bacteria 556
441 nmdc:mga0k408_329837_c1 3300050493 Bacteria 910
442 nmdc:mga05p37_2183831_c1 3300050507 Unclassified 515
443 nmdc:mga05p37_41078_c1 3300050507 Bacteria 5679
444 nmdc:mga05p37_460354_c1 3300050507 Bacteria 1470
445 nmdc:mga05p37_72485_c1 3300050507 Bacteria 4238
446 nmdc:mga09592_342473_c1 3300050508 Unclassified 1294
447 nmdc:mga09592_461942_c1 3300050508 Bacteria 1095
448 nmdc:mga09592_983251_c1 3300050508 Unclassified 706
449 nmdc:mga0qj67_14049_c1 3300050509 Bacteria 6047
450 nmdc:mga06r32_1111657_c1 3300050510 Unclassified 739
451 nmdc:mga06r32_16900_c1 3300050510 Bacteria 6655
452 nmdc:mga06r32_28090_c1 3300050510 Bacteria 5261
453 nmdc:mga08y16_153321_c1 3300050511 Unclassified 2395
454 nmdc:mga08y16_410634_c1 3300050511 Bacteria 1385
455 nmdc:mga08y16_88504_c1 3300050511 Unclassified 3227
456 nmdc:mga0n895_80381_c1 3300050512 Unclassified 3248
457 nmdc:mga0n895_9813_c1 3300050512 Bacteria 8412
458 nmdc:mga0a205_33086_c1 3300050515 Bacteria 4958
459 nmdc:mga0a205_53028_c1 3300050515 Bacteria 3914
460 Ga0590071_011293 3300059421 Bacteria 2090
461 Ga0590071_016578 3300059421 Unclassified 1728
462 Ga0466962_0230827 3300061719 Bacteria 907
463 Ga0075434_101530702
464 JGI24743J22301_10084846
465 JGI24750J21931_1022160
466 Ga0065715_10801277
467 Ga0065707_10394356
468 Ga0070658_11593302
469 Ga0070676_10082987
470 Ga0070683_100003868
471 Ga0070683_100012306
472 Ga0070683_100083954
473 Ga0070683_100136914
474 Ga0070683_100157336
475 Ga0070690_100937908
476 Ga0070670_100008106
477 Ga0070670_100615609
478 Ga0070670_100997243
479 Ga0070677_10093217
480 Ga0070677_10325253
481 Ga0070677_10881328
482 Ga0068869_100345046
483 Ga0070666_10496092
484 Ga0070680_100026711
485 Ga0070680_100070235
486 Ga0070680_100071987
487 Ga0070680_100145895
488 Ga0070682_100187459
489 Ga0070682_100587869
490 Ga0068868_100342547
491 Ga0068868_101852843
492 Ga0070660_100141614
493 Ga0070689_100018020
494 Ga0070689_100210116
495 Ga0070687_100008003
496 Ga0070661_100004118
497 Ga0070661_100089271
498 Ga0070661_100966065
499 Ga0070692_10071641
500 Ga0070668_100161287
501 Ga0070668_100260812
502 Ga0070669_101256567
503 Ga0070675_100077642
504 Ga0070675_100151556
505 Ga0070675_100711991
506 Ga0070671_100312356
507 Ga0070671_101390787
508 Ga0070674_100332916
509 Ga0070673_100081011
510 Ga0070673_100125321
511 Ga0070673_100472046
512 Ga0070688_100184163
513 Ga0070659_100008985
514 Ga0070659_100019264
515 Ga0070659_100043214
516 Ga0070667_100230923
517 Ga0070667_101148315
518 Ga0070703_10171166
519 Ga0070709_10006172
520 Ga0070709_10031381
521 Ga0070709_10066840
522 Ga0070709_10407677
523 Ga0070714_100037682
524 Ga0070714_100799951
525 Ga0070713_100000205
526 Ga0070713_100014902
527 Ga0070713_100527610
528 Ga0070710_10385137
529 Ga0070701_10031500
530 Ga0070711_100468594
531 Ga0070711_100468836
532 Ga0070700_100043202
533 Ga0070700_100857068
534 Ga0070694_100131144
535 Ga0070694_100317489
536 Ga0070663_100020605
537 Ga0070663_100078742
538 Ga0070663_100865023
539 Ga0070678_101161393
540 Ga0070662_100125632
541 Ga0070662_100792008
542 Ga0070662_100792919
543 Ga0070681_10001833
544 Ga0070681_10018160
545 Ga0070681_10183302
546 Ga0070681_10266220
547 Ga0070681_10426913
548 Ga0070681_11488055
549 Ga0068867_100343991
550 Ga0068867_100560966
551 Ga0068867_100737553
552 Ga0070685_10080963
553 Ga0070706_101445656
554 Ga0070699_100019563
555 Ga0070699_100820751
556 Ga0070679_100003639
557 Ga0070679_100011027
558 Ga0070679_100031564
559 Ga0070679_100044902
560 Ga0070679_100055314
561 Ga0070679_100055592
562 Ga0070679_101257487
563 Ga0070684_100010529
564 Ga0070684_100205382
565 Ga0070684_100293828
566 Ga0070684_100305830
567 Ga0070684_100553996
568 Ga0070684_100587011
569 Ga0068853_100180010
570 Ga0068853_100330290
571 Ga0070672_100025899
572 Ga0070672_102018158
573 Ga0070695_101282944
574 Ga0070695_101333309
575 Ga0070696_100097088
576 Ga0070693_100001758
577 Ga0070665_100040416
578 Ga0070665_100221720
579 Ga0070665_100222314
580 Ga0070704_101851791
581 Ga0068855_100086019
582 Ga0068855_100274318
583 Ga0068855_101154971
584 Ga0070664_100001560
585 Ga0070664_100128695
586 Ga0070664_100464630
587 Ga0070664_101902112
588 Ga0068857_100002194
589 Ga0068857_102026442
590 Ga0068854_100088245
591 Ga0068856_100355747
592 Ga0068856_100376923
593 Ga0068856_100831598
594 Ga0068852_100020299
595 Ga0068859_100611649
596 Ga0068859_101701569
597 Ga0068864_100044222
598 Ga0068866_10217092
599 Ga0068861_100006652
600 Ga0068861_101425772
601 Ga0068851_10051225
602 Ga0068851_10126486
603 Ga0068870_10120341
604 Ga0068863_100077250
605 Ga0068863_101581562
606 Ga0068858_100100013
607 Ga0068858_101039989
608 Ga0068860_100060399
609 Ga0068860_100225050
610 Ga0068862_100421131
611 Ga0068862_101509040
612 Ga0070717_10013901
613 Ga0070717_10228935
614 Ga0070717_10819030
615 Ga0070717_11293078
616 Ga0070716_100015772
617 Ga0070716_100207369
618 Ga0070716_101555132
619 Ga0075366_10346683
620 Ga0097621_100502272
621 Ga0075428_100051260
622 Ga0075431_100653498
623 Ga0075433_10031903
624 Ga0075433_10043196
625 Ga0075433_10522192
626 Ga0075434_100002221
627 Ga0075434_100362196
628 Ga0075429_100347150
629 Ga0068865_100313457
630 Ga0068865_100909723
631 Ga0097620_100611674
632 Ga0097620_101701309
633 Ga0105251_10497915
634 Ga0105240_10004336
635 Ga0105240_10146676
636 Ga0105240_10457255
637 Ga0105240_10528411
638 Ga0111539_10049062
639 Ga0111539_10068022
640 Ga0111539_10141687
641 Ga0105245_10362703
642 Ga0105245_10949308
643 Ga0105245_12084275
644 Ga0114129_10013422
645 Ga0114129_10019213
646 Ga0114129_10179245
647 Ga0114129_10322795
648 Ga0105243_10761549
649 Ga0105241_10195005
650 Ga0105241_10631874
651 Ga0105241_10911216
652 Ga0105241_12358496
653 Ga0105242_10148432
654 Ga0105248_10137806
655 Ga0105248_10550164
656 Ga0105248_10564991
657 Ga0105248_10731107
658 Ga0105237_11272137
659 Ga0105238_10314006
660 Ga0105238_10390758
661 Ga0105249_10101435
662 Ga0105249_10944494
663 Ga0105239_10077958
664 Ga0105246_11168343
665 Ga0157373_10035722
666 Ga0157373_10472292
667 Ga0157373_11207100
668 Ga0157371_10095400
669 Ga0157370_10006871
670 Ga0157370_10098143
671 Ga0157370_10838483
672 Ga0157369_10035412
673 Ga0157369_10182819
674 Ga0157369_10504503
675 Ga0157374_10107725
676 Ga0157374_10476265
677 Ga0157378_10089837
678 Ga0157378_10599647
679 Ga0163162_10265241
680 Ga0163162_10315931
681 Ga0157372_10009256
682 Ga0157372_10076238
683 Ga0157372_10211255
684 Ga0157372_10394903
685 Ga0157372_10988713
686 Ga0157375_10329540
687 Ga0157375_10806296
688 Ga0157375_11165099
689 Ga0163163_10025574
690 Ga0157380_10377687
691 Ga0157377_10131085
692 Ga0157379_10252123
693 Ga0157376_11553400
694 Ga0157376_12160898
695 Ga0163161_10033531
696 Ga0163161_10104408
697 Ga0213876_10154012
698 Ga0213876_10322433
699 Ga0224572_1013254
700 Ga0207673_1048810
701 Ga0207697_10012994
702 Ga0207656_10220260
703 Ga0207653_10235893
704 Ga0207682_10020364
705 Ga0207682_10089250
706 Ga0207642_10380488
707 Ga0207642_10588050
708 Ga0207688_10457242
709 Ga0207647_10312081
710 Ga0207699_10108027
711 Ga0207699_10392875
712 Ga0207645_10016807
713 Ga0207645_10234306
714 Ga0207643_10066646
715 Ga0207643_10124310
716 Ga0207705_10627316
717 Ga0207654_11318449
718 Ga0207707_10000784
719 Ga0207707_10002076
720 Ga0207707_10046589
721 Ga0207707_10108138
722 Ga0207707_10124612
723 Ga0207707_10184702
724 Ga0207695_10011653
725 Ga0207695_10014812
726 Ga0207695_10928962
727 Ga0207660_10013038
728 Ga0207660_10027662
729 Ga0207660_10057082
730 Ga0207660_10248986
731 Ga0207660_10406789
732 Ga0207660_10762571
733 Ga0207662_10013987
734 Ga0207657_10014566
735 Ga0207657_10103364
736 Ga0207649_10034820
737 Ga0207652_10001170
738 Ga0207652_10020528
739 Ga0207652_10022215
740 Ga0207652_10027729
741 Ga0207652_10083051
742 Ga0207652_10109391
743 Ga0207652_10184746
744 Ga0207681_10102381
745 Ga0207650_10017102
746 Ga0207659_10027784
747 Ga0207659_10171764
748 Ga0207659_10619075
749 Ga0207687_10764274
750 Ga0207687_10814814
751 Ga0207687_11277000
752 Ga0207700_10000186
753 Ga0207700_10471372
754 Ga0207700_10664130
755 Ga0207664_10031395
756 Ga0207664_10164567
757 Ga0207664_10594553
758 Ga0207644_10432388
759 Ga0207644_10705702
760 Ga0207690_10012244
761 Ga0207690_10430386
762 Ga0207706_10001615
763 Ga0207706_10222954
764 Ga0207706_10291984
765 Ga0207686_10180038
766 Ga0207686_10261794
767 Ga0207709_10888914
768 Ga0207670_10316318
769 Ga0207669_10448585
770 Ga0207669_10698086
771 Ga0207704_10066220
772 Ga0207704_10253514
773 Ga0207665_10039888
774 Ga0207665_10508550
775 Ga0207665_11398552
776 Ga0207691_10003217
777 Ga0207691_10003707
778 Ga0207691_10745492
779 Ga0207711_10275298
780 Ga0207711_10616353
781 Ga0207711_12066151
782 Ga0207689_10014329
783 Ga0207661_10004915
784 Ga0207661_10021614
785 Ga0207661_10170350
786 Ga0207661_10361598
787 Ga0207661_10773272
788 Ga0207661_11122616
789 Ga0207679_10003506
790 Ga0207679_10052261
791 Ga0207679_10161898
792 Ga0207679_11082733
793 Ga0207667_10425808
794 Ga0207667_10561907
795 Ga0207667_12016963
796 Ga0207651_10084928
797 Ga0207651_10769144
798 Ga0207712_10030006
799 Ga0207668_10028638
800 Ga0207640_10141742
801 Ga0207640_11523171
802 Ga0207658_10190009
803 Ga0207677_10036267
804 Ga0207677_10487881
805 Ga0207677_11117387
806 Ga0207703_10263266
807 Ga0207678_10013528
808 Ga0207678_10158551
809 Ga0207678_10518308
810 Ga0207708_10021870
811 Ga0207702_10190674
812 Ga0207702_11104317
813 Ga0207702_11341874
814 Ga0207641_10149199
815 Ga0207641_10901449
816 Ga0207648_10109198
817 Ga0207648_10654133
818 Ga0207648_10655309
819 Ga0207676_10169666
820 Ga0207674_10000819
821 Ga0207674_10033672
822 Ga0207674_10041741
823 Ga0207675_100000174
824 Ga0207675_100019329
825 Ga0207683_10128866
826 Ga0207698_10260234
827 Ga0207428_10174635
828 Ga0207428_10216694
829 Ga0268266_10388043
830 Ga0268266_10593891
831 Ga0268265_10428846
832 Ga0268264_10270167
833 Ga0316182_1400959
834 Ga0307408_100112708
835 Ga0307408_100813665
836 Ga0307405_10758602
837 Ga0307405_11278191
838 Ga0307413_11786890
839 Ga0307410_10662064
840 Ga0307410_11240163
841 Ga0307410_11361927
842 Ga0307406_10001575
843 Ga0307412_10045403
844 Ga0307412_10759631
845 Ga0307412_11894486
846 Ga0307409_100117778
847 Ga0307409_100443822
848 Ga0307409_101033024
849 Ga0307416_100733541
850 Ga0307416_101898601
851 Ga0307416_103439675
852 Ga0307414_10228804
853 Ga0307411_10691709
854 Ga0307411_11107287
855 Ga0307411_11706870
856 Ga0307415_101146368
857 Ga0307415_101194774
858 Ga0373943_0301577
859 Ga0373946_0128496
860 Ga0373955_0201265
861 Ga0373924_0453788
862 Ga0373947_0421901
863 Ga0395905_0278111
864 Ga0436365_0016134
865 Ga0436365_0071917
866 Ga0451793_0859436
867 Ga0439448_0239911
868 Ga0439455_0094226
869 Ga0451576_0295637
870 Ga0451576_0363790
871 Ga0451576_0427583
872 Ga0466967_0917313
873 Ga0466967_1428150
874 Ga0495580_0598280
875 Ga0495663_0260233
876 Ga0495633_0242429
877 Ga0495647_0075388
878 Ga0495670_0095908
879 Ga0495636_0292937
880 Ga0495684_0130744
881 Ga0496102_1563742
882 Ga0496106_1148341
883 Ga0496108_0471284
884 Ga0496109_0015460
885 Ga0496109_0808777
886 Ga0496113_0697022
887 Ga0501303_062850
888 Ga0501040_1369853
889 Ga0501042_1350479
890 Ga0501068_0578820
891 Ga0501072_0498926
892 Ga0501075_0281926
893 Ga0501075_0361083
894 Ga0501077_0509149
895 Ga0501233_202507
896 Ga0501235_059730
897 Ga0501235_195511
898 Ga0501239_026228
899 Ga0501249_078055
900 Ga0501260_042206
901 Ga0501081_0355633
902 Ga0501283_103754
903 nmdc:mga0k408_329837_c1
904 nmdc:mga05p37_2183831_c1
905 nmdc:mga05p37_41078_c1
906 nmdc:mga05p37_460354_c1
907 nmdc:mga05p37_72485_c1
908 nmdc:mga09592_342473_c1
909 nmdc:mga09592_461942_c1
910 nmdc:mga09592_983251_c1
911 nmdc:mga0qj67_14049_c1
912 nmdc:mga06r32_1111657_c1
913 nmdc:mga06r32_16900_c1
914 nmdc:mga06r32_28090_c1
915 nmdc:mga08y16_153321_c1
916 nmdc:mga08y16_410634_c1
917 nmdc:mga08y16_88504_c1
918 nmdc:mga0n895_80381_c1
919 nmdc:mga0n895_9813_c1
920 nmdc:mga0a205_33086_c1
921 nmdc:mga0a205_53028_c1
922 Ga0590071_011293
923 Ga0590071_016578
924 Ga0466962_0230827

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

16

90

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9277 15 110
6abq-assembly1.cif.gz_A crystal structure of transcription factor from listeria monocytogenes 0.9259 14 112
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9238 15 110
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9201 14 113
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9138 18 113
ID Description Score Start End Superfamily
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9238 15 110 1.10.10.10
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8975 15 113 1.10.10.10
3l7wA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8938 11 114 1.10.10.10
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8934 15 117 1.10.10.10
af_Q57682_5_95_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8829 22 87 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2V8EA09-F1-model_v4 PadR family transcriptional regulator 0.9912 15 93
AF-A0A843TB24-F1-model_v4 PadR family transcriptional regulator 0.9876 15 115
AF-A0A3N5LS61-F1-model_v4 PadR family transcriptional regulator 0.9833 15 113
AF-A0A537T4U9-F1-model_v4 PadR family transcriptional regulator 0.982 10 115
AF-A0A6J4LS10-F1-model_v4 Transcriptional regulator, PadR family 0.9811 15 115

Map