F448874

General Info

Members Datasets Scaffolds Average Seq Length
462 232 924 109

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_102457120|Ga0068860_1024571201
Length 130
Sequence MSMSVGGSGGPKADINMTPMIDGLLVLPKGLEALVPQPXXPNAKPNQSDQRTVVITIDANHNMAINSEGTDEARLGQRLEEIFKTRAERVVFVKADPGLDFQWVAKAIDIAHGAAIDKVGLMTAKVEAGQ

Samples

Sample ID Description Type Environment
1 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
2 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
70 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
77 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
78 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
107 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
108 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
109 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
110 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
111 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
112 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
113 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
114 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
115 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
116 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
117 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
118 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
119 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
120 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
122 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
123 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
124 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
125 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
126 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
127 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
128 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
129 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
131 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
132 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
139 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
140 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
141 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
142 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
147 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
150 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
151 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
152 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
153 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
156 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
157 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
158 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
159 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
160 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
161 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
162 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
163 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
164 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
165 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
166 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
167 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
168 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
169 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
170 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
171 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
180 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
187 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
188 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
195 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
196 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
197 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
198 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
199 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300060243 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
232 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 73.16
Metatranscriptomes 26.84
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.73
Rhizosphere 94.37
Stem 0
Stem Tuber 0
Unclassified 14.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068860_102457120 3300005843 Unclassified 541
2 Ga0007416J51690_1097881 3300003577 Bacteria 507
3 Ga0032354_1133009 3300003693 Unclassified 521
4 Ga0058863_10070768 3300004799 Bacteria 3511
5 Ga0058863_10170308 3300004799 Bacteria 3113
6 Ga0058863_11716491 3300004799 Bacteria 1674
7 Ga0058861_10181182 3300004800 Bacteria 1636
8 Ga0058861_11624449 3300004800 Bacteria 1707
9 Ga0058861_11808170 3300004800 Unclassified 562
10 Ga0058861_11902194 3300004800 Bacteria 2243
11 Ga0058861_12069793 3300004800 Bacteria 2848
12 Ga0058860_11559626 3300004801 Bacteria 1471
13 Ga0058862_10011399 3300004803 Bacteria 3316
14 Ga0058862_10047864 3300004803 Bacteria 1734
15 Ga0058862_10062228 3300004803 Bacteria 3936
16 Ga0058862_10193732 3300004803 Bacteria 2819
17 Ga0058862_12760615 3300004803 Bacteria 2583
18 Ga0070658_10123556 3300005327 Bacteria 2152
19 Ga0070658_10138773 3300005327 Bacteria 2030
20 Ga0070658_10362299 3300005327 Bacteria 1242
21 Ga0070683_100058361 3300005329 Bacteria 3586
22 Ga0070683_100470331 3300005329 Bacteria 1200
23 Ga0070683_100644875 3300005329 Bacteria 1014
24 Ga0070670_100613172 3300005331 Bacteria 974
25 Ga0070670_101220381 3300005331 Unclassified 687
26 Ga0068869_100736566 3300005334 Unclassified 843
27 Ga0070666_10316271 3300005335 Bacteria 1113
28 Ga0070680_100110190 3300005336 Bacteria 2291
29 Ga0070692_10180436 3300005345 Bacteria 1223
30 Ga0070675_100464122 3300005354 Bacteria 1137
31 Ga0070675_101382081 3300005354 Unclassified 649
32 Ga0070671_100440490 3300005355 Unclassified 1117
33 Ga0070688_100420921 3300005365 Bacteria 993
34 Ga0070667_100459148 3300005367 Bacteria 1164
35 Ga0070667_100823770 3300005367 Bacteria 862
36 Ga0070667_100865108 3300005367 Unclassified 841
37 Ga0070709_10026643 3300005434 Bacteria 3429
38 Ga0070709_10447744 3300005434 Bacteria 972
39 Ga0070714_100696864 3300005435 Bacteria 980
40 Ga0070714_102448266 3300005435 Bacteria 507
41 Ga0070713_100124459 3300005436 Bacteria 2266
42 Ga0070713_100248398 3300005436 Bacteria 1622
43 Ga0070713_100813280 3300005436 Unclassified 896
44 Ga0070681_10148780 3300005458 Bacteria 2269
45 Ga0070681_10153689 3300005458 Bacteria 2227
46 Ga0070685_10293657 3300005466 Bacteria 1093
47 Ga0070679_100008088 3300005530 Bacteria 9886
48 Ga0070679_100348017 3300005530 Bacteria 1430
49 Ga0070684_100000044 3300005535 Bacteria 84710
50 Ga0070684_100191041 3300005535 Bacteria 1863
51 Ga0070672_100348381 3300005543 Bacteria 1262
52 Ga0070686_100998227 3300005544 Bacteria 686
53 Ga0070665_100198303 3300005548 Bacteria 2008
54 Ga0070665_100219644 3300005548 Bacteria 1901
55 Ga0070665_100248269 3300005548 Bacteria 1780
56 Ga0070704_101535434 3300005549 Bacteria 613
57 Ga0068855_101593838 3300005563 Unclassified 668
58 Ga0068859_101350288 3300005617 Unclassified 786
59 Ga0068859_101874584 3300005617 Bacteria 662
60 Ga0068864_100539267 3300005618 Bacteria 1126
61 Ga0068864_102357837 3300005618 Unclassified 538
62 Ga0068863_100089761 3300005841 Bacteria 2914
63 Ga0068863_100100875 3300005841 Bacteria 2744
64 Ga0068863_100730878 3300005841 Bacteria 985
65 Ga0068863_101171720 3300005841 Bacteria 774
66 Ga0068863_101496268 3300005841 Bacteria 683
67 Ga0068860_100425226 3300005843 Bacteria 1317
68 Ga0068860_100685158 3300005843 Bacteria 1034
69 Ga0070717_10169649 3300006028 Bacteria 1897
70 Ga0070717_10338662 3300006028 Bacteria 1343
71 Ga0097621_100304400 3300006237 Bacteria 1409
72 Ga0068871_100302309 3300006358 Bacteria 1405
73 Ga0075430_100003612 3300006846 Bacteria 12974
74 Ga0075431_100041456 3300006847 Bacteria 4746
75 Ga0075434_100880342 3300006871 Bacteria 911
76 Ga0075429_100149322 3300006880 Bacteria 2046
77 Ga0068865_100025590 3300006881 Bacteria 3884
78 Ga0097620_101350525 3300006931 Unclassified 786
79 Ga0097620_101873899 3300006931 Bacteria 662
80 Ga0105240_10000159 3300009093 Bacteria 137832
81 Ga0105240_10023603 3300009093 Bacteria 8126
82 Ga0105240_10953445 3300009093 Unclassified 920
83 Ga0105240_11197765 3300009093 Bacteria 804
84 Ga0105240_11359008 3300009093 Bacteria 748
85 Ga0105245_11685350 3300009098 Bacteria 686
86 Ga0105247_10296113 3300009101 Bacteria 1121
87 Ga0114129_10571287 3300009147 Bacteria 1468
88 Ga0105242_10145141 3300009176 Unclassified 2064
89 Ga0105248_10579489 3300009177 Bacteria 1266
90 Ga0105248_10847050 3300009177 Unclassified 1032
91 Ga0105248_12835930 3300009177 Bacteria 553
92 Ga0105237_10027475 3300009545 Bacteria 5809
93 Ga0105238_11982338 3300009551 Unclassified 616
94 Ga0105249_10432468 3300009553 Bacteria 1352
95 Ga0105246_10387870 3300011119 Unclassified 1156
96 Ga0157373_10467716 3300013100 Bacteria 909
97 Ga0157371_10344236 3300013102 Bacteria 1085
98 Ga0157370_10011694 3300013104 Bacteria 9161
99 Ga0157370_10127111 3300013104 Bacteria 2379
100 Ga0157370_10288387 3300013104 Bacteria 1516
101 Ga0157370_10358551 3300013104 Bacteria 1344
102 Ga0157369_10119021 3300013105 Bacteria 2803
103 Ga0157369_10228624 3300013105 Bacteria 1945
104 Ga0157369_10274617 3300013105 Bacteria 1756
105 Ga0157369_10543211 3300013105 Bacteria 1201
106 Ga0157374_11797930 3300013296 Unclassified 638
107 Ga0157378_10215299 3300013297 Bacteria 1824
108 Ga0157378_11310366 3300013297 Bacteria 766
109 Ga0163162_10263736 3300013306 Bacteria 1854
110 Ga0163162_11154643 3300013306 Bacteria 878
111 Ga0163162_11958650 3300013306 Unclassified 671
112 Ga0157372_11644500 3300013307 Bacteria 739
113 Ga0157372_11836658 3300013307 Bacteria 697
114 Ga0157375_11089633 3300013308 Bacteria 935
115 Ga0157375_12597858 3300013308 Bacteria 605
116 Ga0163163_10244288 3300014325 Bacteria 1845
117 Ga0163163_13053523 3300014325 Bacteria 522
118 Ga0163163_13289421 3300014325 Unclassified 504
119 Ga0157377_11387922 3300014745 Bacteria 553
120 Ga0157379_10367175 3300014968 Bacteria 1319
121 Ga0157376_10307764 3300014969 Bacteria 1502
122 Ga0157376_10686794 3300014969 Bacteria 1027
123 Ga0157376_10838308 3300014969 Bacteria 934
124 Ga0157376_10882856 3300014969 Bacteria 911
125 Ga0197907_10828913 3300020069 Bacteria 4164
126 Ga0197907_11052390 3300020069 Bacteria 4095
127 Ga0197907_11127085 3300020069 Unclassified 540
128 Ga0197907_11313445 3300020069 Bacteria 2741
129 Ga0197907_11428737 3300020069 Bacteria 3375
130 Ga0206356_10015317 3300020070 Bacteria 5552
131 Ga0206356_10334766 3300020070 Unclassified 1934
132 Ga0206356_11467510 3300020070 Bacteria 2814
133 Ga0206349_1266249 3300020075 Unclassified 604
134 Ga0206349_1496839 3300020075 Bacteria 4053
135 Ga0206349_1692974 3300020075 Bacteria 1704
136 Ga0206355_1317190 3300020076 Bacteria 2324
137 Ga0206355_1622902 3300020076 Bacteria 1130
138 Ga0206351_10706739 3300020077 Bacteria 724
139 Ga0206351_10730906 3300020077 Bacteria 3074
140 Ga0206351_10835049 3300020077 Bacteria 4255
141 Ga0206352_10498263 3300020078 Bacteria 3903
142 Ga0206352_10714108 3300020078 Bacteria 2481
143 Ga0206352_11090830 3300020078 Bacteria 2218
144 Ga0206352_11123595 3300020078 Bacteria 907
145 Ga0206352_11176338 3300020078 Bacteria 1872
146 Ga0206350_10027439 3300020080 Bacteria 4429
147 Ga0206350_10540106 3300020080 Unclassified 963
148 Ga0206350_10659794 3300020080 Bacteria 1529
149 Ga0206350_10987085 3300020080 Bacteria 3384
150 Ga0206350_11101180 3300020080 Bacteria 2150
151 Ga0206354_10957299 3300020081 Bacteria 2101
152 Ga0206354_11107864 3300020081 Bacteria 1762
153 Ga0206354_11429600 3300020081 Bacteria 971
154 Ga0206353_11556275 3300020082 Bacteria 1927
155 Ga0206353_11569248 3300020082 Bacteria 1991
156 Ga0154015_1453793 3300020610 Bacteria 779
157 Ga0154015_1620555 3300020610 Bacteria 3906
158 Ga0213874_10257867 3300021377 Unclassified 645
159 Ga0213875_10000103 3300021388 Bacteria 96738
160 Ga0213875_10005362 3300021388 Bacteria 6893
161 Ga0213875_10094320 3300021388 Bacteria 1396
162 Ga0224712_10001767 3300022467 Bacteria 5151
163 Ga0224712_10002871 3300022467 Bacteria 4353
164 Ga0224712_10005910 3300022467 Bacteria 3450
165 Ga0224712_10008160 3300022467 Bacteria 3087
166 Ga0224712_10041517 3300022467 Bacteria 1738
167 Ga0224712_10044239 3300022467 Bacteria 1697
168 Ga0224712_10092752 3300022467 Bacteria 1268
169 Ga0207680_10731080 3300025903 Bacteria 709
170 Ga0207685_10211190 3300025905 Unclassified 918
171 Ga0207699_10393381 3300025906 Bacteria 986
172 Ga0207645_10285094 3300025907 Bacteria 1097
173 Ga0207705_10945816 3300025909 Bacteria 667
174 Ga0207654_10597988 3300025911 Bacteria 787
175 Ga0207707_10043818 3300025912 Bacteria 3901
176 Ga0207707_10548873 3300025912 Unclassified 982
177 Ga0207695_10003872 3300025913 Bacteria 20710
178 Ga0207695_10871731 3300025913 Bacteria 780
179 Ga0207671_10458908 3300025914 Unclassified 1015
180 Ga0207671_10820029 3300025914 Bacteria 737
181 Ga0207693_11120239 3300025915 Bacteria 597
182 Ga0207663_10088647 3300025916 Bacteria 2047
183 Ga0207663_10238691 3300025916 Bacteria 1332
184 Ga0207652_10903070 3300025921 Unclassified 780
185 Ga0207659_10687809 3300025926 Bacteria 875
186 Ga0207659_11281576 3300025926 Bacteria 629
187 Ga0207700_10083959 3300025928 Bacteria 2495
188 Ga0207700_10103050 3300025928 Bacteria 2281
189 Ga0207700_10488326 3300025928 Bacteria 1089
190 Ga0207700_10959554 3300025928 Unclassified 765
191 Ga0207704_10269363 3300025938 Bacteria 1289
192 Ga0207711_10347373 3300025941 Bacteria 1373
193 Ga0207711_10363774 3300025941 Bacteria 1341
194 Ga0207711_10755344 3300025941 Bacteria 906
195 Ga0207711_11199468 3300025941 Bacteria 700
196 Ga0207689_10541888 3300025942 Unclassified 977
197 Ga0207689_10767733 3300025942 Unclassified 814
198 Ga0207661_10000008 3300025944 Bacteria 451211
199 Ga0207661_10060000 3300025944 Bacteria 3067
200 Ga0207661_10151873 3300025944 Bacteria 2003
201 Ga0207661_10541452 3300025944 Bacteria 1066
202 Ga0207661_11950305 3300025944 Bacteria 533
203 Ga0207661_12164057 3300025944 Bacteria 502
204 Ga0207658_10607931 3300025986 Unclassified 983
205 Ga0207658_10648656 3300025986 Bacteria 951
206 Ga0207658_10730562 3300025986 Bacteria 896
207 Ga0207658_10811425 3300025986 Bacteria 850
208 Ga0207703_11110455 3300026035 Bacteria 760
209 Ga0207678_10736683 3300026067 Bacteria 869
210 Ga0207641_10039878 3300026088 Bacteria 3929
211 Ga0207641_11298763 3300026088 Bacteria 728
212 Ga0207676_10403685 3300026095 Bacteria 1278
213 Ga0207674_10567624 3300026116 Bacteria 1096
214 Ga0207683_10082307 3300026121 Bacteria 2859
215 Ga0207683_10309895 3300026121 Bacteria 1445
216 Ga0207698_11921080 3300026142 Unclassified 607
217 Ga0268266_10107500 3300028379 Bacteria 2467
218 Ga0268266_10143720 3300028379 Bacteria 2143
219 Ga0268266_11133144 3300028379 Unclassified 757
220 Ga0265323_10001898 3300028653 Bacteria 9860
221 Ga0265338_10015040 3300028800 Bacteria 8541
222 Ga0265324_10004667 3300029957 Bacteria 6103
223 Ga0265330_10039158 3300031235 Bacteria 2107
224 Ga0265330_10046713 3300031235 Bacteria 1907
225 Ga0265328_10033876 3300031239 Bacteria 1892
226 Ga0265320_10002898 3300031240 Bacteria 11763
227 Ga0265325_10022295 3300031241 Bacteria 3471
228 Ga0265325_10494847 3300031241 Unclassified 530
229 Ga0265339_10035884 3300031249 Bacteria 2778
230 Ga0265331_10014685 3300031250 Bacteria 4161
231 Ga0265316_10011585 3300031344 Bacteria 7943
232 Ga0265316_10018494 3300031344 Bacteria 5985
233 Ga0265316_10019559 3300031344 Bacteria 5785
234 Ga0265316_10062165 3300031344 Bacteria 2898
235 Ga0265316_10179723 3300031344 Bacteria 1575
236 Ga0265316_10474267 3300031344 Bacteria 896
237 Ga0265313_10036932 3300031595 Bacteria 2449
238 Ga0265314_10014452 3300031711 Bacteria 6316
239 Ga0265314_10097924 3300031711 Bacteria 1893
240 Ga0265342_10008733 3300031712 Bacteria 7227
241 Ga0265342_10458981 3300031712 Bacteria 653
242 Ga0373926_0121819 3300035083 Bacteria 984
243 Ga0373923_0058540 3300035111 Bacteria 1632
244 Ga0373936_0206392 3300035113 Bacteria 868
245 Ga0373945_0220973 3300035116 Bacteria 792
246 Ga0373953_0243105 3300035117 Bacteria 782
247 Ga0373953_0497567 3300035117 Unclassified 540
248 Ga0373954_0010977 3300035118 Bacteria 4007
249 Ga0373954_0291173 3300035118 Bacteria 805
250 Ga0373957_0130518 3300035120 Bacteria 1023
251 Ga0373943_0955507 3300035170 Bacteria 513
252 Ga0373946_0080373 3300035171 Bacteria 1426
253 Ga0373955_0441111 3300035172 Unclassified 793
254 Ga0373935_0186310 3300035692 Bacteria 1427
255 Ga0373935_0243544 3300035692 Bacteria 1256
256 Ga0373927_0017205 3300035695 Bacteria 4762
257 Ga0373927_0309562 3300035695 Bacteria 1040
258 Ga0373927_0401535 3300035695 Bacteria 904
259 Ga0373927_0590497 3300035695 Bacteria 734
260 Ga0373927_1055461 3300035695 Unclassified 536
261 Ga0373933_0134319 3300035724 Bacteria 1558
262 Ga0373933_0475681 3300035724 Bacteria 818
263 Ga0373947_0177232 3300035725 Bacteria 1386
264 Ga0373947_0280983 3300035725 Bacteria 1107
265 Ga0373937_0124004 3300036401 Bacteria 2409
266 Ga0373937_0405894 3300036401 Bacteria 1293
267 Ga0373937_0598775 3300036401 Bacteria 1046
268 Ga0373937_0605607 3300036401 Bacteria 1040
269 Ga0373925_0041042 3300037068 Bacteria 3428
270 Ga0373925_0230175 3300037068 Bacteria 1482
271 Ga0373925_0378172 3300037068 Bacteria 1153
272 Ga0373925_0772969 3300037068 Bacteria 792
273 Ga0373925_1520186 3300037068 Bacteria 548
274 Ga0395900_0276137 3300037418 Bacteria 1674
275 Ga0436364_0129406 3300037853 Bacteria 129389
276 Ga0436364_0478048 3300037853 Bacteria 1758
277 Ga0436364_0575157 3300037853 Bacteria 27092
278 Ga0436364_1289204 3300037853 Bacteria 791
279 Ga0436364_1525474 3300037853 Bacteria 730
280 Ga0436365_0201563 3300039437 Bacteria 1276
281 Ga0436365_1010495 3300039437 Bacteria 3235
282 Ga0436365_1455579 3300039437 Unclassified 1250
283 Ga0436363_0014203 3300039450 Unclassified 502
284 Ga0436363_0383534 3300039450 Bacteria 631
285 Ga0436363_1601087 3300039450 Bacteria 801
286 Ga0436363_1718270 3300039450 Unclassified 678
287 Ga0436362_1241198 3300039453 Bacteria 681
288 Ga0451577_1741130 3300042876 Bacteria 548
289 Ga0466959_0187205 3300045049 Bacteria 1446
290 Ga0451576_0703597 3300045051 Bacteria 1062
291 Ga0451576_0880055 3300045051 Bacteria 940
292 Ga0451576_1382801 3300045051 Bacteria 733
293 Ga0466967_0191532 3300045976 Bacteria 1933
294 Ga0495592_0044736 3300046454 Bacteria 3306
295 Ga0495629_0523723 3300046459 Bacteria 798
296 Ga0495651_0142519 3300046462 Bacteria 1736
297 Ga0495651_0327253 3300046462 Bacteria 1020
298 Ga0495651_0655302 3300046462 Bacteria 658
299 Ga0495653_0072021 3300046463 Bacteria 2582
300 Ga0495580_0003796 3300046472 Bacteria 12802
301 Ga0495580_0014295 3300046472 Bacteria 6023
302 Ga0495580_0144935 3300046472 Bacteria 1646
303 Ga0495580_0326104 3300046472 Bacteria 1043
304 Ga0495580_0452739 3300046472 Unclassified 861
305 Ga0495580_0880519 3300046472 Bacteria 576
306 Ga0495582_0161691 3300046473 Bacteria 1273
307 Ga0495639_0172540 3300046475 Bacteria 1050
308 Ga0495639_0230625 3300046475 Bacteria 912
309 Ga0495662_0140795 3300046476 Bacteria 1187
310 Ga0495662_0566334 3300046476 Unclassified 556
311 Ga0495664_0119547 3300046477 Bacteria 1594
312 Ga0495618_0197916 3300046514 Bacteria 1272
313 Ga0495618_0472963 3300046514 Bacteria 758
314 Ga0495628_0140767 3300046516 Bacteria 1841
315 Ga0495630_0004930 3300046517 Bacteria 9385
316 Ga0495630_0581862 3300046517 Bacteria 858
317 Ga0495652_0189026 3300046529 Bacteria 1573
318 Ga0495665_0045829 3300046531 Bacteria 2323
319 Ga0495640_0022994 3300046533 Bacteria 4551
320 Ga0495640_0283676 3300046533 Bacteria 1031
321 Ga0495640_0519241 3300046533 Unclassified 724
322 Ga0495645_0011351 3300046543 Bacteria 6266
323 Ga0495645_0237590 3300046543 Bacteria 1218
324 Ga0495667_0183623 3300046559 Bacteria 1341
325 Ga0495667_0291981 3300046559 Unclassified 1034
326 Ga0495667_0330232 3300046559 Bacteria 965
327 Ga0495667_0675530 3300046559 Bacteria 641
328 Ga0495634_0259491 3300046642 Bacteria 1061
329 Ga0495635_0087925 3300046663 Bacteria 2126
330 Ga0495635_0167808 3300046663 Bacteria 1493
331 Ga0495635_0700207 3300046663 Bacteria 657
332 Ga0495635_0711907 3300046663 Bacteria 650
333 Ga0495657_0465332 3300046675 Unclassified 739
334 Ga0495599_0445010 3300046678 Bacteria 768
335 Ga0495623_0366966 3300046679 Bacteria 781
336 Ga0495623_0420278 3300046679 Bacteria 716
337 Ga0495658_0276613 3300046683 Bacteria 1059
338 Ga0495669_0414703 3300046684 Bacteria 653
339 Ga0495581_0496866 3300047315 Bacteria 709
340 Ga0495604_0023682 3300047317 Bacteria 4900
341 Ga0495604_0301503 3300047317 Unclassified 1076
342 Ga0495674_0119448 3300047319 Bacteria 2228
343 Ga0495674_0133128 3300047319 Bacteria 2094
344 Ga0495674_0143633 3300047319 Bacteria 2004
345 Ga0495674_0219273 3300047319 Bacteria 1573
346 Ga0495674_1391593 3300047319 Unclassified 523
347 Ga0495680_0204301 3300047322 Bacteria 1416
348 Ga0495684_0002534 3300047471 Bacteria 14556
349 Ga0495684_0008660 3300047471 Bacteria 7869
350 Ga0495684_0155162 3300047471 Bacteria 1710
351 Ga0495602_0061099 3300048088 Bacteria 3279
352 Ga0495602_0115295 3300048088 Bacteria 2174
353 Ga0495602_1158985 3300048088 Bacteria 505
354 Ga0496104_0500186 3300048907 Bacteria 1127
355 Ga0496105_0995826 3300048908 Bacteria 627
356 Ga0496112_0510760 3300048915 Bacteria 1137
357 Ga0496112_0799358 3300048915 Bacteria 868
358 Ga0496112_1376121 3300048915 Unclassified 620
359 Ga0496114_0597031 3300048917 Bacteria 974
360 Ga0496115_0506852 3300048918 Bacteria 969
361 Ga0496115_0796971 3300048918 Unclassified 736
362 Ga0496126_0092513 3300048929 Bacteria 2657
363 Ga0501032_0167939 3300049569 Bacteria 1439
364 Ga0501033_0254728 3300049570 Bacteria 1243
365 Ga0501034_0133354 3300049571 Bacteria 2466
366 Ga0501034_0482994 3300049571 Bacteria 1154
367 Ga0501038_0438800 3300049574 Bacteria 1006
368 Ga0501046_0111345 3300049580 Unclassified 2091
369 Ga0501046_0825343 3300049580 Bacteria 649
370 Ga0501047_0015813 3300049581 Bacteria 7191
371 Ga0501047_0039615 3300049581 Unclassified 4557
372 Ga0501047_0096572 3300049581 Unclassified 2834
373 Ga0501070_0011002 3300049586 Bacteria 7638
374 Ga0501074_0312428 3300049590 Bacteria 1116
375 Ga0501075_0784844 3300049591 Bacteria 725
376 Ga0501080_0502032 3300049742 Bacteria 1084
377 Ga0501035_0044237 3300049822 Bacteria 4010
378 Ga0501035_0328259 3300049822 Bacteria 1284
379 Ga0501035_1475385 3300049822 Unclassified 519
380 Ga0501044_0001732 3300049823 Bacteria 25501
381 Ga0501044_0067324 3300049823 Bacteria 3649
382 Ga0501044_0414167 3300049823 Bacteria 1258
383 nmdc:mga09592_914879_c1 3300050508 Bacteria 737
384 nmdc:mga0qj67_14992_c1 3300050509 Bacteria 5864
385 nmdc:mga06r32_97273_c1 3300050510 Bacteria 2884
386 nmdc:mga0n895_270581_c1 3300050512 Bacteria 1723
387 nmdc:mga0n895_471174_c1 3300050512 Unclassified 1267
388 Ga0495601_0859660 3300053077 Bacteria 574
389 Ga0495612_0088323 3300053078 Bacteria 1309
390 Ga0495612_0426925 3300053078 Unclassified 604
391 Ga0495619_0066828 3300053085 Bacteria 2400
392 Ga0495619_1098549 3300053085 Unclassified 529
393 Ga0587084_029264 3300059477 Bacteria 877
394 Ga0587084_064362 3300059477 Bacteria 679
395 Ga0587084_077528 3300059477 Bacteria 638
396 Ga0587093_006641 3300059478 Bacteria 1268
397 Ga0587093_052290 3300059478 Bacteria 648
398 Ga0587070_000116 3300059491 Bacteria 4729
399 Ga0587070_028365 3300059491 Bacteria 998
400 Ga0587070_050862 3300059491 Bacteria 827
401 Ga0587070_146189 3300059491 Bacteria 589
402 Ga0587073_0004656 3300059492 Bacteria 1986
403 Ga0587073_0005428 3300059492 Bacteria 1899
404 Ga0587073_0048213 3300059492 Bacteria 956
405 Ga0587073_0132234 3300059492 Unclassified 686
406 Ga0587077_004497 3300059493 Bacteria 1838
407 Ga0587077_085077 3300059493 Bacteria 733
408 Ga0587080_002380 3300059503 Bacteria 2204
409 Ga0587082_007023 3300059504 Unclassified 1523
410 Ga0587082_012253 3300059504 Bacteria 1270
411 Ga0587083_0002088 3300059505 Bacteria 2417
412 Ga0587083_0007528 3300059505 Bacteria 1671
413 Ga0587083_0014286 3300059505 Unclassified 1365
414 Ga0587083_0022794 3300059505 Unclassified 1176
415 Ga0587083_0047804 3300059505 Bacteria 922
416 Ga0587085_009274 3300059506 Bacteria 1278
417 Ga0587086_000809 3300059507 Bacteria 2492
418 Ga0587086_004998 3300059507 Bacteria 1414
419 Ga0587088_156878 3300059508 Unclassified 555
420 Ga0587094_001012 3300059513 Bacteria 2506
421 Ga0587094_018465 3300059513 Bacteria 992
422 Ga0587094_033225 3300059513 Bacteria 810
423 Ga0587095_004788 3300059514 Bacteria 1003
424 Ga0587098_000043 3300059604 Bacteria 5280
425 Ga0587106_011034 3300059605 Bacteria 1183
426 Ga0587106_090553 3300059605 Bacteria 610
427 Ga0587099_023886 3300059622 Bacteria 708
428 Ga0587101_024097 3300059623 Bacteria 901
429 Ga0587109_171013 3300059624 Bacteria 550
430 Ga0587113_015993 3300059625 Bacteria 748
431 Ga0587128_001913 3300059630 Bacteria 2076
432 Ga0587128_022773 3300059630 Bacteria 977
433 Ga0587128_060109 3300059630 Unclassified 716
434 Ga0587067_002139 3300059640 Bacteria 2286
435 Ga0587067_072680 3300059640 Bacteria 746
436 Ga0587067_079871 3300059640 Unclassified 722
437 Ga0587069_068819 3300059642 Bacteria 668
438 Ga0587072_000302 3300059643 Bacteria 4625
439 Ga0587075_002858 3300059644 Bacteria 1873
440 Ga0587075_003144 3300059644 Bacteria 1813
441 Ga0587075_077103 3300059644 Bacteria 629
442 Ga0587078_014235 3300059646 Bacteria 949
443 Ga0587078_028559 3300059646 Bacteria 741
444 Ga0587079_000679 3300059647 Bacteria 3280
445 Ga0587079_002396 3300059647 Bacteria 2284
446 Ga0587079_005145 3300059647 Bacteria 1830
447 Ga0587079_011835 3300059647 Bacteria 1413
448 Ga0587107_001765 3300059652 Bacteria 1826
449 Ga0587107_009824 3300059652 Bacteria 1139
450 Ga0587110_002958 3300059654 Bacteria 1388
451 Ga0587114_002073 3300059655 Bacteria 1809
452 Ga0587114_025585 3300059655 Bacteria 867
453 Ga0587060_002601 3300060243 Bacteria 1283
454 Ga0587071_001604 3300060344 Bacteria 2878
455 Ga0587071_011707 3300060344 Bacteria 1484
456 Ga0587071_016923 3300060344 Bacteria 1295
457 Ga0587071_031437 3300060344 Bacteria 1024
458 Ga0587071_041627 3300060344 Unclassified 922
459 Ga0587111_0006545 3300060346 Bacteria 1853
460 Ga0587111_0202039 3300060346 Bacteria 564
461 Ga0501082_0728775 3300060353 Bacteria 868
462 Ga0466962_0172684 3300061719 Bacteria 1053
463 Ga0068860_102457120
464 Ga0007416J51690_1097881
465 Ga0032354_1133009
466 Ga0058863_10070768
467 Ga0058863_10170308
468 Ga0058863_11716491
469 Ga0058861_10181182
470 Ga0058861_11624449
471 Ga0058861_11808170
472 Ga0058861_11902194
473 Ga0058861_12069793
474 Ga0058860_11559626
475 Ga0058862_10011399
476 Ga0058862_10047864
477 Ga0058862_10062228
478 Ga0058862_10193732
479 Ga0058862_12760615
480 Ga0070658_10123556
481 Ga0070658_10138773
482 Ga0070658_10362299
483 Ga0070683_100058361
484 Ga0070683_100470331
485 Ga0070683_100644875
486 Ga0070670_100613172
487 Ga0070670_101220381
488 Ga0068869_100736566
489 Ga0070666_10316271
490 Ga0070680_100110190
491 Ga0070692_10180436
492 Ga0070675_100464122
493 Ga0070675_101382081
494 Ga0070671_100440490
495 Ga0070688_100420921
496 Ga0070667_100459148
497 Ga0070667_100823770
498 Ga0070667_100865108
499 Ga0070709_10026643
500 Ga0070709_10447744
501 Ga0070714_100696864
502 Ga0070714_102448266
503 Ga0070713_100124459
504 Ga0070713_100248398
505 Ga0070713_100813280
506 Ga0070681_10148780
507 Ga0070681_10153689
508 Ga0070685_10293657
509 Ga0070679_100008088
510 Ga0070679_100348017
511 Ga0070684_100000044
512 Ga0070684_100191041
513 Ga0070672_100348381
514 Ga0070686_100998227
515 Ga0070665_100198303
516 Ga0070665_100219644
517 Ga0070665_100248269
518 Ga0070704_101535434
519 Ga0068855_101593838
520 Ga0068859_101350288
521 Ga0068859_101874584
522 Ga0068864_100539267
523 Ga0068864_102357837
524 Ga0068863_100089761
525 Ga0068863_100100875
526 Ga0068863_100730878
527 Ga0068863_101171720
528 Ga0068863_101496268
529 Ga0068860_100425226
530 Ga0068860_100685158
531 Ga0070717_10169649
532 Ga0070717_10338662
533 Ga0097621_100304400
534 Ga0068871_100302309
535 Ga0075430_100003612
536 Ga0075431_100041456
537 Ga0075434_100880342
538 Ga0075429_100149322
539 Ga0068865_100025590
540 Ga0097620_101350525
541 Ga0097620_101873899
542 Ga0105240_10000159
543 Ga0105240_10023603
544 Ga0105240_10953445
545 Ga0105240_11197765
546 Ga0105240_11359008
547 Ga0105245_11685350
548 Ga0105247_10296113
549 Ga0114129_10571287
550 Ga0105242_10145141
551 Ga0105248_10579489
552 Ga0105248_10847050
553 Ga0105248_12835930
554 Ga0105237_10027475
555 Ga0105238_11982338
556 Ga0105249_10432468
557 Ga0105246_10387870
558 Ga0157373_10467716
559 Ga0157371_10344236
560 Ga0157370_10011694
561 Ga0157370_10127111
562 Ga0157370_10288387
563 Ga0157370_10358551
564 Ga0157369_10119021
565 Ga0157369_10228624
566 Ga0157369_10274617
567 Ga0157369_10543211
568 Ga0157374_11797930
569 Ga0157378_10215299
570 Ga0157378_11310366
571 Ga0163162_10263736
572 Ga0163162_11154643
573 Ga0163162_11958650
574 Ga0157372_11644500
575 Ga0157372_11836658
576 Ga0157375_11089633
577 Ga0157375_12597858
578 Ga0163163_10244288
579 Ga0163163_13053523
580 Ga0163163_13289421
581 Ga0157377_11387922
582 Ga0157379_10367175
583 Ga0157376_10307764
584 Ga0157376_10686794
585 Ga0157376_10838308
586 Ga0157376_10882856
587 Ga0197907_10828913
588 Ga0197907_11052390
589 Ga0197907_11127085
590 Ga0197907_11313445
591 Ga0197907_11428737
592 Ga0206356_10015317
593 Ga0206356_10334766
594 Ga0206356_11467510
595 Ga0206349_1266249
596 Ga0206349_1496839
597 Ga0206349_1692974
598 Ga0206355_1317190
599 Ga0206355_1622902
600 Ga0206351_10706739
601 Ga0206351_10730906
602 Ga0206351_10835049
603 Ga0206352_10498263
604 Ga0206352_10714108
605 Ga0206352_11090830
606 Ga0206352_11123595
607 Ga0206352_11176338
608 Ga0206350_10027439
609 Ga0206350_10540106
610 Ga0206350_10659794
611 Ga0206350_10987085
612 Ga0206350_11101180
613 Ga0206354_10957299
614 Ga0206354_11107864
615 Ga0206354_11429600
616 Ga0206353_11556275
617 Ga0206353_11569248
618 Ga0154015_1453793
619 Ga0154015_1620555
620 Ga0213874_10257867
621 Ga0213875_10000103
622 Ga0213875_10005362
623 Ga0213875_10094320
624 Ga0224712_10001767
625 Ga0224712_10002871
626 Ga0224712_10005910
627 Ga0224712_10008160
628 Ga0224712_10041517
629 Ga0224712_10044239
630 Ga0224712_10092752
631 Ga0207680_10731080
632 Ga0207685_10211190
633 Ga0207699_10393381
634 Ga0207645_10285094
635 Ga0207705_10945816
636 Ga0207654_10597988
637 Ga0207707_10043818
638 Ga0207707_10548873
639 Ga0207695_10003872
640 Ga0207695_10871731
641 Ga0207671_10458908
642 Ga0207671_10820029
643 Ga0207693_11120239
644 Ga0207663_10088647
645 Ga0207663_10238691
646 Ga0207652_10903070
647 Ga0207659_10687809
648 Ga0207659_11281576
649 Ga0207700_10083959
650 Ga0207700_10103050
651 Ga0207700_10488326
652 Ga0207700_10959554
653 Ga0207704_10269363
654 Ga0207711_10347373
655 Ga0207711_10363774
656 Ga0207711_10755344
657 Ga0207711_11199468
658 Ga0207689_10541888
659 Ga0207689_10767733
660 Ga0207661_10000008
661 Ga0207661_10060000
662 Ga0207661_10151873
663 Ga0207661_10541452
664 Ga0207661_11950305
665 Ga0207661_12164057
666 Ga0207658_10607931
667 Ga0207658_10648656
668 Ga0207658_10730562
669 Ga0207658_10811425
670 Ga0207703_11110455
671 Ga0207678_10736683
672 Ga0207641_10039878
673 Ga0207641_11298763
674 Ga0207676_10403685
675 Ga0207674_10567624
676 Ga0207683_10082307
677 Ga0207683_10309895
678 Ga0207698_11921080
679 Ga0268266_10107500
680 Ga0268266_10143720
681 Ga0268266_11133144
682 Ga0265323_10001898
683 Ga0265338_10015040
684 Ga0265324_10004667
685 Ga0265330_10039158
686 Ga0265330_10046713
687 Ga0265328_10033876
688 Ga0265320_10002898
689 Ga0265325_10022295
690 Ga0265325_10494847
691 Ga0265339_10035884
692 Ga0265331_10014685
693 Ga0265316_10011585
694 Ga0265316_10018494
695 Ga0265316_10019559
696 Ga0265316_10062165
697 Ga0265316_10179723
698 Ga0265316_10474267
699 Ga0265313_10036932
700 Ga0265314_10014452
701 Ga0265314_10097924
702 Ga0265342_10008733
703 Ga0265342_10458981
704 Ga0373926_0121819
705 Ga0373923_0058540
706 Ga0373936_0206392
707 Ga0373945_0220973
708 Ga0373953_0243105
709 Ga0373953_0497567
710 Ga0373954_0010977
711 Ga0373954_0291173
712 Ga0373957_0130518
713 Ga0373943_0955507
714 Ga0373946_0080373
715 Ga0373955_0441111
716 Ga0373935_0186310
717 Ga0373935_0243544
718 Ga0373927_0017205
719 Ga0373927_0309562
720 Ga0373927_0401535
721 Ga0373927_0590497
722 Ga0373927_1055461
723 Ga0373933_0134319
724 Ga0373933_0475681
725 Ga0373947_0177232
726 Ga0373947_0280983
727 Ga0373937_0124004
728 Ga0373937_0405894
729 Ga0373937_0598775
730 Ga0373937_0605607
731 Ga0373925_0041042
732 Ga0373925_0230175
733 Ga0373925_0378172
734 Ga0373925_0772969
735 Ga0373925_1520186
736 Ga0395900_0276137
737 Ga0436364_0129406
738 Ga0436364_0478048
739 Ga0436364_0575157
740 Ga0436364_1289204
741 Ga0436364_1525474
742 Ga0436365_0201563
743 Ga0436365_1010495
744 Ga0436365_1455579
745 Ga0436363_0014203
746 Ga0436363_0383534
747 Ga0436363_1601087
748 Ga0436363_1718270
749 Ga0436362_1241198
750 Ga0451577_1741130
751 Ga0466959_0187205
752 Ga0451576_0703597
753 Ga0451576_0880055
754 Ga0451576_1382801
755 Ga0466967_0191532
756 Ga0495592_0044736
757 Ga0495629_0523723
758 Ga0495651_0142519
759 Ga0495651_0327253
760 Ga0495651_0655302
761 Ga0495653_0072021
762 Ga0495580_0003796
763 Ga0495580_0014295
764 Ga0495580_0144935
765 Ga0495580_0326104
766 Ga0495580_0452739
767 Ga0495580_0880519
768 Ga0495582_0161691
769 Ga0495639_0172540
770 Ga0495639_0230625
771 Ga0495662_0140795
772 Ga0495662_0566334
773 Ga0495664_0119547
774 Ga0495618_0197916
775 Ga0495618_0472963
776 Ga0495628_0140767
777 Ga0495630_0004930
778 Ga0495630_0581862
779 Ga0495652_0189026
780 Ga0495665_0045829
781 Ga0495640_0022994
782 Ga0495640_0283676
783 Ga0495640_0519241
784 Ga0495645_0011351
785 Ga0495645_0237590
786 Ga0495667_0183623
787 Ga0495667_0291981
788 Ga0495667_0330232
789 Ga0495667_0675530
790 Ga0495634_0259491
791 Ga0495635_0087925
792 Ga0495635_0167808
793 Ga0495635_0700207
794 Ga0495635_0711907
795 Ga0495657_0465332
796 Ga0495599_0445010
797 Ga0495623_0366966
798 Ga0495623_0420278
799 Ga0495658_0276613
800 Ga0495669_0414703
801 Ga0495581_0496866
802 Ga0495604_0023682
803 Ga0495604_0301503
804 Ga0495674_0119448
805 Ga0495674_0133128
806 Ga0495674_0143633
807 Ga0495674_0219273
808 Ga0495674_1391593
809 Ga0495680_0204301
810 Ga0495684_0002534
811 Ga0495684_0008660
812 Ga0495684_0155162
813 Ga0495602_0061099
814 Ga0495602_0115295
815 Ga0495602_1158985
816 Ga0496104_0500186
817 Ga0496105_0995826
818 Ga0496112_0510760
819 Ga0496112_0799358
820 Ga0496112_1376121
821 Ga0496114_0597031
822 Ga0496115_0506852
823 Ga0496115_0796971
824 Ga0496126_0092513
825 Ga0501032_0167939
826 Ga0501033_0254728
827 Ga0501034_0133354
828 Ga0501034_0482994
829 Ga0501038_0438800
830 Ga0501046_0111345
831 Ga0501046_0825343
832 Ga0501047_0015813
833 Ga0501047_0039615
834 Ga0501047_0096572
835 Ga0501070_0011002
836 Ga0501074_0312428
837 Ga0501075_0784844
838 Ga0501080_0502032
839 Ga0501035_0044237
840 Ga0501035_0328259
841 Ga0501035_1475385
842 Ga0501044_0001732
843 Ga0501044_0067324
844 Ga0501044_0414167
845 nmdc:mga09592_914879_c1
846 nmdc:mga0qj67_14992_c1
847 nmdc:mga06r32_97273_c1
848 nmdc:mga0n895_270581_c1
849 nmdc:mga0n895_471174_c1
850 Ga0495601_0859660
851 Ga0495612_0088323
852 Ga0495612_0426925
853 Ga0495619_0066828
854 Ga0495619_1098549
855 Ga0587084_029264
856 Ga0587084_064362
857 Ga0587084_077528
858 Ga0587093_006641
859 Ga0587093_052290
860 Ga0587070_000116
861 Ga0587070_028365
862 Ga0587070_050862
863 Ga0587070_146189
864 Ga0587073_0004656
865 Ga0587073_0005428
866 Ga0587073_0048213
867 Ga0587073_0132234
868 Ga0587077_004497
869 Ga0587077_085077
870 Ga0587080_002380
871 Ga0587082_007023
872 Ga0587082_012253
873 Ga0587083_0002088
874 Ga0587083_0007528
875 Ga0587083_0014286
876 Ga0587083_0022794
877 Ga0587083_0047804
878 Ga0587085_009274
879 Ga0587086_000809
880 Ga0587086_004998
881 Ga0587088_156878
882 Ga0587094_001012
883 Ga0587094_018465
884 Ga0587094_033225
885 Ga0587095_004788
886 Ga0587098_000043
887 Ga0587106_011034
888 Ga0587106_090553
889 Ga0587099_023886
890 Ga0587101_024097
891 Ga0587109_171013
892 Ga0587113_015993
893 Ga0587128_001913
894 Ga0587128_022773
895 Ga0587128_060109
896 Ga0587067_002139
897 Ga0587067_072680
898 Ga0587067_079871
899 Ga0587069_068819
900 Ga0587072_000302
901 Ga0587075_002858
902 Ga0587075_003144
903 Ga0587075_077103
904 Ga0587078_014235
905 Ga0587078_028559
906 Ga0587079_000679
907 Ga0587079_002396
908 Ga0587079_005145
909 Ga0587079_011835
910 Ga0587107_001765
911 Ga0587107_009824
912 Ga0587110_002958
913 Ga0587114_002073
914 Ga0587114_025585
915 Ga0587060_002601
916 Ga0587071_001604
917 Ga0587071_011707
918 Ga0587071_016923
919 Ga0587071_031437
920 Ga0587071_041627
921 Ga0587111_0006545
922 Ga0587111_0202039
923 Ga0501082_0728775
924 Ga0466962_0172684

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

28

126

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.8618 30 100
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.8307 30 100
5by4-assembly1.cif.gz_A-2 structure and function of the escherichia coli tol-pal stator protein tolr 0.7898 31 101
3zzj-assembly1.cif.gz_A structure of an engineered aspartate aminotransferase 0.7833 50 101
1aic-assembly1.cif.gz_B structural basis for the catalytic activity of aspartate aminotransferase k258h lacking the pyridoxal-5'-phosphate binding lysine residue 0.7739 53 101
ID Description Score Start End Superfamily
af_P46846_104_226_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8253 66 102 3.40.50.2020
af_Q2G056_117_224_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8249 67 101 3.40.50.2020
5esxA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7687 68 101 3.40.50.2020
2pfuA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.7352 32 98 3.30.420.270
af_Q4DB76_342_532_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7343 65 99 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3A0D9V6-F1-model_v4 Biopolymer transporter ExbD 0.9695 30 101 GO:0005886
GO:0015031
GO:0022857
AF-A0A662DGE1-F1-model_v4 Biopolymer transporter ExbD 0.9683 30 101 GO:0005886
GO:0015031
GO:0022857
AF-A0A0S7ZZ77-F1-model_v4 Biopolymer transporter ExbD 0.9665 31 101 GO:0005886
GO:0015031
GO:0022857
AF-A0A1F5UDQ6-F1-model_v4 Biopolymer transporter ExbD 0.9665 31 101 GO:0005886
GO:0015031
GO:0022857
AF-A0A523T3H4-F1-model_v4 Biopolymer transporter ExbD 0.9641 30 101 GO:0005886
GO:0015031
GO:0022857

Map