F448867

General Info

Members Datasets Scaffolds Average Seq Length
462 228 924 224

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100209127|Ga0070698_1002091272
Length 272
Sequence MERRRRQERADPGLRGLNVRQRRWLDRTHPTDTRRVHSALPGIRYGVGAIEVNRINVIGSGRVGAAVADRLRERGIAVDTDEPELVLLCVPDSAIAGVARTIEPGPWVAHVSGGTPLAALDPHERRFSVHPLQTFTRARGAEQLDGAWAAVTGERPDALAEGMRLADVLGLRPFELADSARTIYHAGAVFASNYVVTLHRAASLLLETAGAPPEALEPLMRRTIENGFELTGPIARGDWSTVSAHRAAIQDSRPELDHLYETLAGATLALAT

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
112 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
113 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
114 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
115 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
116 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
117 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
118 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
119 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
120 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
121 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
122 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
123 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
124 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
125 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
126 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
127 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
128 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
129 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
130 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
133 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
134 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
146 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
154 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
155 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
156 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
157 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
158 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
159 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
160 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
164 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
165 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
166 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
167 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
168 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
169 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
170 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
171 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
204 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
205 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
206 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
207 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
208 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
209 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
210 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
211 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
215 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
219 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
226 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
227 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
228 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0
Rhizoplane 8.87
Rhizosphere 90.48
Stem 0
Stem Tuber 0
Unclassified 4.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100209127 3300005471 Bacteria 1886
2 JGI25406J46586_10028067 3300003203 Bacteria 2148
3 JGI25407J50210_10022322 3300003373 Bacteria 1645
4 Ga0070658_10006313 3300005327 Bacteria 9601
5 Ga0070658_10107675 3300005327 Bacteria 2307
6 Ga0070683_100001257 3300005329 Bacteria 19285
7 Ga0070683_100008763 3300005329 Bacteria 8601
8 Ga0070683_100273699 3300005329 Unclassified 1606
9 Ga0070683_100415604 3300005329 Bacteria 1283
10 Ga0070666_10420835 3300005335 Unclassified 962
11 Ga0070682_100332562 3300005337 Bacteria 1126
12 Ga0068868_100121245 3300005338 Bacteria 2133
13 Ga0068868_100128086 3300005338 Bacteria 2075
14 Ga0070660_100023544 3300005339 Bacteria 4562
15 Ga0070691_10058083 3300005341 Bacteria 1857
16 Ga0070687_100069957 3300005343 Bacteria 1881
17 Ga0070668_100013797 3300005347 Bacteria 6035
18 Ga0070668_100888234 3300005347 Bacteria 796
19 Ga0070669_100134441 3300005353 Bacteria 1901
20 Ga0070674_100494306 3300005356 Bacteria 1018
21 Ga0070667_100260039 3300005367 Bacteria 1554
22 Ga0070714_100006800 3300005435 Bacteria 8864
23 Ga0070714_100241481 3300005435 Bacteria 1667
24 Ga0070714_100627563 3300005435 Bacteria 1033
25 Ga0070714_100659741 3300005435 Bacteria 1007
26 Ga0070713_100230202 3300005436 Bacteria 1684
27 Ga0070701_10221889 3300005438 Bacteria 1127
28 Ga0070705_100015631 3300005440 Bacteria 3927
29 Ga0070700_100564875 3300005441 Bacteria 886
30 Ga0070678_100266544 3300005456 Bacteria 1443
31 Ga0070662_100126590 3300005457 Bacteria 1964
32 Ga0070662_100433532 3300005457 Bacteria 1089
33 Ga0070681_10000868 3300005458 Bacteria 25466
34 Ga0070681_10191834 3300005458 Bacteria 1963
35 Ga0070707_100043066 3300005468 Bacteria 4321
36 Ga0070707_100425077 3300005468 Bacteria 1289
37 Ga0070698_100062718 3300005471 Bacteria 3749
38 Ga0070698_100082866 3300005471 Bacteria 3198
39 Ga0070698_100373858 3300005471 Unclassified 1357
40 Ga0070679_100010108 3300005530 Bacteria 8943
41 Ga0070679_100048464 3300005530 Bacteria 4233
42 Ga0070679_100049157 3300005530 Bacteria 4201
43 Ga0070679_100262080 3300005530 Bacteria 1684
44 Ga0070679_100325438 3300005530 Bacteria 1486
45 Ga0070684_100003185 3300005535 Bacteria 12274
46 Ga0070684_100994798 3300005535 Bacteria 787
47 Ga0070686_100026789 3300005544 Bacteria 3482
48 Ga0070695_100009732 3300005545 Bacteria 5724
49 Ga0070695_100036382 3300005545 Bacteria 3098
50 Ga0070696_100074968 3300005546 Bacteria 2386
51 Ga0070693_100086407 3300005547 Bacteria 1882
52 Ga0070704_100138699 3300005549 Bacteria 1895
53 Ga0070704_100237379 3300005549 Bacteria 1490
54 Ga0070704_100448988 3300005549 Bacteria 1110
55 Ga0068855_100323637 3300005563 Bacteria 1703
56 Ga0068857_100376707 3300005577 Bacteria 1317
57 Ga0068854_100085168 3300005578 Bacteria 2340
58 Ga0068854_100379713 3300005578 Bacteria 1164
59 Ga0068856_100003590 3300005614 Bacteria 15606
60 Ga0068856_100015813 3300005614 Bacteria 7298
61 Ga0068856_100143105 3300005614 Bacteria 2399
62 Ga0068856_100160978 3300005614 Bacteria 2255
63 Ga0068856_100719254 3300005614 Bacteria 1019
64 Ga0070702_100229442 3300005615 Bacteria 1246
65 Ga0068852_100023614 3300005616 Bacteria 4952
66 Ga0068866_10020268 3300005718 Bacteria 3045
67 Ga0068866_10203329 3300005718 Bacteria 1185
68 Ga0068861_100010773 3300005719 Bacteria 6356
69 Ga0068861_100029854 3300005719 Bacteria 3991
70 Ga0068870_10046674 3300005840 Bacteria 2273
71 Ga0068858_100057519 3300005842 Bacteria 3594
72 Ga0068858_100247967 3300005842 Bacteria 1691
73 Ga0068862_100157449 3300005844 Bacteria 2026
74 Ga0068862_101007344 3300005844 Bacteria 824
75 Ga0081455_10003496 3300005937 Bacteria 18045
76 Ga0081455_10411076 3300005937 Bacteria 936
77 Ga0081538_10005152 3300005981 Bacteria 11846
78 Ga0081538_10007570 3300005981 Bacteria 9370
79 Ga0081538_10017458 3300005981 Bacteria 5446
80 Ga0081540_1004859 3300005983 Bacteria 10128
81 Ga0081539_10000030 3300005985 Bacteria 317236
82 Ga0081539_10002871 3300005985 Bacteria 22885
83 Ga0075364_10134648 3300006051 Bacteria 1660
84 Ga0075432_10036697 3300006058 Bacteria 1704
85 Ga0070712_100251800 3300006175 Bacteria 1412
86 Ga0070712_100668118 3300006175 Unclassified 884
87 Ga0075366_10340785 3300006195 Bacteria 919
88 Ga0068871_100203266 3300006358 Unclassified 1711
89 Ga0068871_100493502 3300006358 Bacteria 1103
90 Ga0075428_100000633 3300006844 Bacteria 36066
91 Ga0075428_100266583 3300006844 Bacteria 1843
92 Ga0075430_100344262 3300006846 Bacteria 1231
93 Ga0075431_100828322 3300006847 Bacteria 897
94 Ga0075434_100761310 3300006871 Bacteria 985
95 Ga0075429_100172105 3300006880 Bacteria 1897
96 Ga0075436_100118103 3300006914 Bacteria 1854
97 Ga0075436_100212169 3300006914 Bacteria 1372
98 Ga0075436_100441504 3300006914 Bacteria 947
99 Ga0105240_10119095 3300009093 Bacteria 3181
100 Ga0105240_10461588 3300009093 Bacteria 1419
101 Ga0111539_10074666 3300009094 Bacteria 3995
102 Ga0105245_10007106 3300009098 Bacteria 9823
103 Ga0105245_10035135 3300009098 Bacteria 4448
104 Ga0105245_10168990 3300009098 Bacteria 2081
105 Ga0105245_10288572 3300009098 Bacteria 1606
106 Ga0105245_10381528 3300009098 Bacteria 1404
107 Ga0114129_10011894 3300009147 Bacteria 12381
108 Ga0114129_10206150 3300009147 Bacteria 2660
109 Ga0105243_10036214 3300009148 Bacteria 3829
110 Ga0105243_10245213 3300009148 Bacteria 1596
111 Ga0105243_10567599 3300009148 Bacteria 1087
112 Ga0105243_10797387 3300009148 Bacteria 930
113 Ga0105242_10346067 3300009176 Bacteria 1371
114 Ga0105249_10021205 3300009553 Bacteria 5817
115 Ga0105249_10204421 3300009553 Bacteria 1934
116 Ga0105249_10492263 3300009553 Bacteria 1270
117 Ga0105249_10561886 3300009553 Unclassified 1193
118 Ga0105239_10027858 3300010375 Bacteria 6216
119 Ga0105246_10380356 3300011119 Bacteria 1166
120 Ga0157374_10098303 3300013296 Bacteria 2802
121 Ga0157378_10138798 3300013297 Bacteria 2256
122 Ga0157372_10036740 3300013307 Bacteria 5401
123 Ga0157375_10411471 3300013308 Bacteria 1519
124 Ga0157380_10087952 3300014326 Bacteria 2555
125 Ga0182008_10008108 3300014497 Bacteria 5751
126 Ga0157379_10464153 3300014968 Unclassified 1170
127 Ga0182006_1004987 3300015261 Bacteria 6396
128 Ga0163161_10062205 3300017792 Bacteria 2719
129 Ga0207643_10009509 3300025908 Bacteria 5220
130 Ga0207705_10082292 3300025909 Bacteria 2347
131 Ga0207707_10011507 3300025912 Bacteria 7705
132 Ga0207707_10175832 3300025912 Bacteria 1870
133 Ga0207695_10095025 3300025913 Bacteria 2986
134 Ga0207693_10021910 3300025915 Bacteria 5080
135 Ga0207693_10157223 3300025915 Bacteria 1788
136 Ga0207660_10349047 3300025917 Bacteria 1186
137 Ga0207660_10514342 3300025917 Bacteria 972
138 Ga0207660_10526007 3300025917 Bacteria 961
139 Ga0207657_10019814 3300025919 Bacteria 6376
140 Ga0207649_10286931 3300025920 Unclassified 1199
141 Ga0207652_10009819 3300025921 Bacteria 7704
142 Ga0207652_10062667 3300025921 Bacteria 3213
143 Ga0207652_10077855 3300025921 Bacteria 2894
144 Ga0207646_10047995 3300025922 Bacteria 3828
145 Ga0207646_10121362 3300025922 Bacteria 2348
146 Ga0207646_10737583 3300025922 Bacteria 879
147 Ga0207687_10002593 3300025927 Bacteria 12272
148 Ga0207687_10017760 3300025927 Bacteria 4690
149 Ga0207687_10112791 3300025927 Bacteria 2021
150 Ga0207687_10329235 3300025927 Bacteria 1239
151 Ga0207687_10379930 3300025927 Bacteria 1157
152 Ga0207700_10160422 3300025928 Bacteria 1867
153 Ga0207664_10032173 3300025929 Bacteria 4018
154 Ga0207664_10090023 3300025929 Bacteria 2514
155 Ga0207706_10002555 3300025933 Bacteria 17740
156 Ga0207706_10030305 3300025933 Bacteria 4826
157 Ga0207706_10065939 3300025933 Bacteria 3187
158 Ga0207686_10071287 3300025934 Bacteria 2235
159 Ga0207686_10174603 3300025934 Bacteria 1518
160 Ga0207669_10472098 3300025937 Bacteria 998
161 Ga0207704_10154829 3300025938 Unclassified 1623
162 Ga0207661_10000395 3300025944 Bacteria 28163
163 Ga0207661_10002904 3300025944 Bacteria 11845
164 Ga0207679_10005071 3300025945 Bacteria 8233
165 Ga0207679_10049680 3300025945 Bacteria 3062
166 Ga0207667_10106466 3300025949 Bacteria 2892
167 Ga0207667_10471642 3300025949 Bacteria 1274
168 Ga0207712_10046346 3300025961 Bacteria 3014
169 Ga0207712_10115998 3300025961 Bacteria 2017
170 Ga0207668_10058983 3300025972 Bacteria 2686
171 Ga0207668_10286802 3300025972 Bacteria 1353
172 Ga0207640_10115221 3300025981 Bacteria 1914
173 Ga0207640_10703769 3300025981 Bacteria 866
174 Ga0207677_10090419 3300026023 Bacteria 2225
175 Ga0207703_10287085 3300026035 Bacteria 1496
176 Ga0207639_10863746 3300026041 Bacteria 845
177 Ga0207678_10116970 3300026067 Bacteria 2275
178 Ga0207708_10003345 3300026075 Bacteria 11820
179 Ga0207708_10011706 3300026075 Bacteria 6538
180 Ga0207708_10343178 3300026075 Bacteria 1223
181 Ga0207708_10730371 3300026075 Bacteria 848
182 Ga0207702_10002935 3300026078 Bacteria 15951
183 Ga0207702_10005244 3300026078 Bacteria 11378
184 Ga0207648_10002590 3300026089 Bacteria 19364
185 Ga0207648_10038855 3300026089 Bacteria 4187
186 Ga0207648_10059666 3300026089 Bacteria 3327
187 Ga0207648_10279608 3300026089 Bacteria 1492
188 Ga0207674_10004968 3300026116 Bacteria 15895
189 Ga0207675_100005163 3300026118 Bacteria 12569
190 Ga0207675_100009268 3300026118 Bacteria 9231
191 Ga0207675_100068989 3300026118 Bacteria 3304
192 Ga0207675_100168892 3300026118 Unclassified 2090
193 Ga0207683_10007426 3300026121 Bacteria 9400
194 Ga0207683_10116448 3300026121 Bacteria 2396
195 Ga0207428_10001268 3300027907 Bacteria 26994
196 Ga0268264_10041413 3300028381 Bacteria 3810
197 Ga0265337_1036777 3300028556 Bacteria 1427
198 Ga0265326_10024892 3300028558 Bacteria 1707
199 Ga0265319_1002945 3300028563 Bacteria 9062
200 Ga0265334_10043568 3300028573 Bacteria 1746
201 Ga0265334_10091844 3300028573 Bacteria 1106
202 Ga0265318_10002950 3300028577 Bacteria 8818
203 Ga0265318_10020443 3300028577 Bacteria 2672
204 Ga0265318_10075932 3300028577 Bacteria 1243
205 Ga0265318_10136683 3300028577 Bacteria 900
206 Ga0265322_10060282 3300028654 Bacteria 1076
207 Ga0265336_10032479 3300028666 Bacteria 1619
208 Ga0265336_10041095 3300028666 Bacteria 1414
209 Ga0265338_10038159 3300028800 Bacteria 4556
210 Ga0265338_10045918 3300028800 Bacteria 4010
211 Ga0265338_10049402 3300028800 Bacteria 3813
212 Ga0265338_10167837 3300028800 Unclassified 1687
213 Ga0265338_10403242 3300028800 Unclassified 974
214 Ga0265324_10111755 3300029957 Bacteria 928
215 Ga0265330_10008298 3300031235 Bacteria 5004
216 Ga0265332_10014621 3300031238 Bacteria 3471
217 Ga0265332_10072994 3300031238 Bacteria 1460
218 Ga0265332_10124977 3300031238 Bacteria 1080
219 Ga0265328_10027132 3300031239 Bacteria 2148
220 Ga0265328_10099502 3300031239 Bacteria 1076
221 Ga0265320_10038107 3300031240 Bacteria 2414
222 Ga0265320_10038131 3300031240 Bacteria 2413
223 Ga0265320_10047371 3300031240 Bacteria 2102
224 Ga0265325_10000453 3300031241 Bacteria 29634
225 Ga0265325_10049691 3300031241 Bacteria 2163
226 Ga0265325_10066975 3300031241 Unclassified 1810
227 Ga0265325_10083150 3300031241 Bacteria 1588
228 Ga0265329_10004254 3300031242 Bacteria 6011
229 Ga0265329_10039516 3300031242 Unclassified 1516
230 Ga0265340_10045697 3300031247 Bacteria 2137
231 Ga0265339_10004237 3300031249 Bacteria 9829
232 Ga0265339_10005781 3300031249 Bacteria 8211
233 Ga0265339_10213357 3300031249 Bacteria 947
234 Ga0265331_10029095 3300031250 Bacteria 2759
235 Ga0265327_10012057 3300031251 Bacteria 5872
236 Ga0265327_10049441 3300031251 Unclassified 2205
237 Ga0265316_10008337 3300031344 Bacteria 9621
238 Ga0265316_10012401 3300031344 Bacteria 7646
239 Ga0265316_10034994 3300031344 Bacteria 4076
240 Ga0307408_100035773 3300031548 Bacteria 3487
241 Ga0265313_10027878 3300031595 Bacteria 2949
242 Ga0265313_10033916 3300031595 Bacteria 2587
243 Ga0265313_10049983 3300031595 Bacteria 2009
244 Ga0265314_10031692 3300031711 Bacteria 3898
245 Ga0265314_10060385 3300031711 Bacteria 2587
246 Ga0265342_10058113 3300031712 Bacteria 2286
247 Ga0307405_10128434 3300031731 Bacteria 1747
248 Ga0307405_10332323 3300031731 Bacteria 1165
249 Ga0307405_10373657 3300031731 Bacteria 1107
250 Ga0307405_10548372 3300031731 Unclassified 935
251 Ga0307413_10012472 3300031824 Bacteria 4233
252 Ga0307410_10009429 3300031852 Bacteria 5474
253 Ga0307410_10053181 3300031852 Bacteria 2739
254 Ga0307406_10060908 3300031901 Bacteria 2435
255 Ga0307407_10085697 3300031903 Bacteria 1917
256 Ga0307407_10134209 3300031903 Bacteria 1588
257 Ga0307412_10041996 3300031911 Bacteria 2968
258 Ga0307412_10388955 3300031911 Bacteria 1132
259 Ga0307416_100034343 3300032002 Bacteria 3858
260 Ga0307416_100037049 3300032002 Bacteria 3748
261 Ga0307414_10442027 3300032004 Bacteria 1139
262 Ga0307411_10067292 3300032005 Bacteria 2410
263 Ga0307411_10325861 3300032005 Bacteria 1242
264 Ga0307415_100000143 3300032126 Bacteria 31696
265 Ga0307415_100038018 3300032126 Bacteria 3168
266 Ga0316583_10050387 3300032133 Bacteria 1466
267 Ga0373957_0079974 3300035120 Bacteria 1289
268 Ga0373955_0379206 3300035172 Bacteria 858
269 Ga0395899_0001867 3300037312 Bacteria 17398
270 Ga0395899_0006095 3300037312 Bacteria 9348
271 Ga0395899_0017448 3300037312 Bacteria 5469
272 Ga0395899_0023480 3300037312 Bacteria 4670
273 Ga0395900_0031067 3300037418 Bacteria 5486
274 Ga0395900_0128008 3300037418 Bacteria 2603
275 Ga0395900_0182091 3300037418 Bacteria 2134
276 Ga0395898_0003844 3300037466 Bacteria 16633
277 Ga0395898_0007166 3300037466 Bacteria 11839
278 Ga0395898_0012547 3300037466 Bacteria 8764
279 Ga0395898_0343584 3300037466 Bacteria 1423
280 Ga0395898_0414013 3300037466 Bacteria 1285
281 Ga0395905_0002387 3300037471 Bacteria 20908
282 Ga0395905_0014867 3300037471 Bacteria 7425
283 Ga0395905_0021469 3300037471 Bacteria 6104
284 Ga0395905_0115506 3300037471 Bacteria 2522
285 Ga0395905_0240021 3300037471 Bacteria 1693
286 Ga0395905_0740442 3300037471 Bacteria 885
287 Ga0395901_0003964 3300038443 Bacteria 14887
288 Ga0395901_0023026 3300038443 Bacteria 6384
289 Ga0395901_0038402 3300038443 Bacteria 4952
290 Ga0395901_0068581 3300038443 Bacteria 3694
291 Ga0395901_0104945 3300038443 Bacteria 2966
292 Ga0395901_0164595 3300038443 Bacteria 2329
293 Ga0395901_0404280 3300038443 Bacteria 1403
294 Ga0395901_0656768 3300038443 Bacteria 1051
295 Ga0395901_0687186 3300038443 Bacteria 1022
296 Ga0439441_004533 3300042001 Bacteria 2113
297 Ga0439448_0003955 3300042005 Bacteria 4159
298 Ga0439448_0098145 3300042005 Bacteria 994
299 Ga0466961_0153713 3300044693 Bacteria 1436
300 Ga0466963_0229022 3300044694 Bacteria 1302
301 Ga0466963_0459875 3300044694 Bacteria 898
302 Ga0466971_0073598 3300044719 Bacteria 1553
303 Ga0466971_0204847 3300044719 Bacteria 932
304 Ga0466968_0032058 3300044735 Bacteria 2184
305 Ga0466957_0025996 3300044842 Bacteria 3472
306 Ga0466957_0131915 3300044842 Bacteria 1601
307 Ga0466958_0165570 3300045836 Bacteria 1399
308 Ga0466967_0004479 3300045976 Bacteria 9431
309 Ga0466967_0039270 3300045976 Bacteria 4068
310 Ga0466967_0039805 3300045976 Bacteria 4044
311 Ga0466967_0050996 3300045976 Bacteria 3625
312 Ga0466967_0154032 3300045976 Bacteria 2151
313 Ga0466967_0266650 3300045976 Bacteria 1639
314 Ga0466967_0815779 3300045976 Bacteria 926
315 Ga0495629_0093863 3300046459 Bacteria 2094
316 Ga0495651_0213054 3300046462 Bacteria 1343
317 Ga0495653_0020511 3300046463 Bacteria 5358
318 Ga0495653_0082442 3300046463 Bacteria 2374
319 Ga0495664_0182727 3300046477 Bacteria 1271
320 Ga0495596_0136202 3300046500 Unclassified 953
321 Ga0495628_0189570 3300046516 Bacteria 1553
322 Ga0495644_0211574 3300046523 Bacteria 749
323 Ga0495667_0319144 3300046559 Bacteria 983
324 Ga0495634_0101747 3300046642 Bacteria 1856
325 Ga0495657_0080222 3300046675 Bacteria 2112
326 Ga0495613_0072963 3300046689 Bacteria 2502
327 Ga0495684_0120095 3300047471 Bacteria 1980
328 Ga0496100_0077598 3300048903 Bacteria 2233
329 Ga0496101_0010064 3300048904 Bacteria 6234
330 Ga0496102_0008476 3300048905 Bacteria 8813
331 Ga0496102_0173803 3300048905 Bacteria 2028
332 Ga0496102_0753680 3300048905 Unclassified 896
333 Ga0496103_0028695 3300048906 Bacteria 3379
334 Ga0496103_0284922 3300048906 Bacteria 1063
335 Ga0496104_0001067 3300048907 Bacteria 23400
336 Ga0496104_0006046 3300048907 Bacteria 10619
337 Ga0496104_0216273 3300048907 Bacteria 1828
338 Ga0496104_0537964 3300048907 Unclassified 1079
339 Ga0496105_0004823 3300048908 Bacteria 10189
340 Ga0496105_0005859 3300048908 Bacteria 9374
341 Ga0496105_0110930 3300048908 Bacteria 2264
342 Ga0496105_0173683 3300048908 Bacteria 1766
343 Ga0496107_0028447 3300048910 Bacteria 3972
344 Ga0496107_0229845 3300048910 Bacteria 1380
345 Ga0496108_0014773 3300048911 Bacteria 6373
346 Ga0496108_0791510 3300048911 Bacteria 818
347 Ga0496109_0003756 3300048912 Bacteria 12687
348 Ga0496110_0002578 3300048913 Bacteria 13628
349 Ga0496110_0016203 3300048913 Bacteria 6217
350 Ga0496110_0750575 3300048913 Bacteria 879
351 Ga0496111_0003690 3300048914 Bacteria 9519
352 Ga0496111_0680188 3300048914 Bacteria 749
353 Ga0496112_0043045 3300048915 Bacteria 4420
354 Ga0496112_0048905 3300048915 Bacteria 4143
355 Ga0496112_0054472 3300048915 Bacteria 3930
356 Ga0496112_0102271 3300048915 Bacteria 2835
357 Ga0496112_0260673 3300048915 Bacteria 1683
358 Ga0496113_0135627 3300048916 Bacteria 1934
359 Ga0496113_0560468 3300048916 Bacteria 916
360 Ga0496114_0000833 3300048917 Bacteria 23103
361 Ga0496114_0066017 3300048917 Bacteria 3033
362 Ga0496114_0077361 3300048917 Unclassified 2805
363 Ga0496114_0082510 3300048917 Bacteria 2718
364 Ga0496114_0090204 3300048917 Bacteria 2602
365 Ga0496114_0562637 3300048917 Unclassified 1007
366 Ga0496114_0738002 3300048917 Bacteria 862
367 Ga0496115_0031969 3300048918 Bacteria 4150
368 Ga0496115_0230332 3300048918 Unclassified 1528
369 Ga0501031_0016084 3300049568 Bacteria 4858
370 Ga0501031_0116550 3300049568 Bacteria 1745
371 Ga0501032_0049912 3300049569 Bacteria 2822
372 Ga0501032_0067665 3300049569 Bacteria 2385
373 Ga0501032_0077412 3300049569 Bacteria 2214
374 Ga0501033_0003281 3300049570 Bacteria 13386
375 Ga0501033_0006916 3300049570 Bacteria 8858
376 Ga0501033_0015966 3300049570 Bacteria 5689
377 Ga0501034_0004154 3300049571 Bacteria 16214
378 Ga0501034_0095773 3300049571 Bacteria 2964
379 Ga0501034_0337505 3300049571 Bacteria 1437
380 Ga0501036_0003304 3300049572 Bacteria 12872
381 Ga0501036_0016447 3300049572 Bacteria 6177
382 Ga0501036_0021517 3300049572 Bacteria 5422
383 Ga0501037_0004536 3300049573 Bacteria 10097
384 Ga0501037_0016576 3300049573 Bacteria 5422
385 Ga0501037_0026162 3300049573 Bacteria 4312
386 Ga0501038_0012884 3300049574 Bacteria 7630
387 Ga0501038_0013182 3300049574 Bacteria 7540
388 Ga0501038_0038943 3300049574 Bacteria 4160
389 Ga0501039_0003242 3300049575 Bacteria 12168
390 Ga0501040_0036361 3300049576 Bacteria 3342
391 Ga0501042_0050017 3300049578 Bacteria 2981
392 Ga0501042_0094480 3300049578 Bacteria 2147
393 Ga0501043_0137830 3300049579 Bacteria 1911
394 Ga0501046_0004728 3300049580 Bacteria 12283
395 Ga0501046_0005858 3300049580 Bacteria 10955
396 Ga0501046_0065441 3300049580 Bacteria 2835
397 Ga0501047_0016754 3300049581 Bacteria 7001
398 Ga0501047_0082367 3300049581 Bacteria 3092
399 Ga0501047_0248017 3300049581 Bacteria 1629
400 Ga0501048_0010547 3300049582 Bacteria 6895
401 Ga0501067_0001856 3300049583 Bacteria 11620
402 Ga0501067_0016782 3300049583 Bacteria 4046
403 Ga0501067_0024182 3300049583 Bacteria 3368
404 Ga0501067_0027184 3300049583 Bacteria 3170
405 Ga0501067_0043061 3300049583 Bacteria 2507
406 Ga0501067_0044516 3300049583 Bacteria 2465
407 Ga0501068_0062597 3300049584 Bacteria 2262
408 Ga0501068_0063957 3300049584 Bacteria 2238
409 Ga0501068_0068173 3300049584 Bacteria 2168
410 Ga0501069_0001141 3300049585 Bacteria 12836
411 Ga0501069_0002209 3300049585 Bacteria 9805
412 Ga0501069_0064740 3300049585 Bacteria 2043
413 Ga0501069_0268341 3300049585 Bacteria 997
414 Ga0501069_0282508 3300049585 Bacteria 971
415 Ga0501070_0006835 3300049586 Bacteria 9707
416 Ga0501070_0011724 3300049586 Bacteria 7404
417 Ga0501070_0014070 3300049586 Bacteria 6736
418 Ga0501071_0001920 3300049587 Bacteria 12379
419 Ga0501071_0234840 3300049587 Bacteria 1382
420 Ga0501072_0037750 3300049588 Bacteria 3789
421 Ga0501072_0059964 3300049588 Bacteria 3001
422 Ga0501073_0000821 3300049589 Bacteria 22078
423 Ga0501073_0041945 3300049589 Bacteria 3231
424 Ga0501073_0053842 3300049589 Bacteria 2817
425 Ga0501073_0057985 3300049589 Bacteria 2707
426 Ga0501074_0010895 3300049590 Bacteria 6600
427 Ga0501074_0029597 3300049590 Bacteria 3966
428 Ga0501076_0081143 3300049592 Bacteria 2604
429 Ga0501076_0082572 3300049592 Bacteria 2579
430 Ga0501079_0000922 3300049741 Bacteria 20193
431 Ga0501079_0009685 3300049741 Bacteria 7304
432 Ga0501079_0137806 3300049741 Bacteria 1900
433 Ga0501080_0002096 3300049742 Bacteria 17315
434 Ga0501080_0033710 3300049742 Bacteria 4780
435 Ga0501080_0118102 3300049742 Bacteria 2458
436 Ga0501080_0260652 3300049742 Bacteria 1579
437 Ga0501081_0217855 3300049743 Bacteria 1388
438 Ga0501083_0016606 3300049744 Bacteria 5148
439 Ga0501083_0074888 3300049744 Bacteria 2248
440 Ga0501035_0091045 3300049822 Bacteria 2684
441 Ga0501035_0155154 3300049822 Bacteria 1984
442 Ga0501044_0094970 3300049823 Bacteria 3005
443 Ga0501045_0003003 3300049824 Bacteria 11553
444 Ga0501045_0010682 3300049824 Bacteria 6436
445 nmdc:mga0yw44_140319_c1 3300050492 Bacteria 1570
446 nmdc:mga05p37_217285_c1 3300050507 Bacteria 2308
447 nmdc:mga05p37_5262_c1 3300050507 Bacteria 15187
448 nmdc:mga05p37_890647_c1 3300050507 Bacteria 961
449 nmdc:mga06r32_840034_c1 3300050510 Bacteria 877
450 nmdc:mga0n895_165876_c1 3300050512 Bacteria 2240
451 nmdc:mga0n895_710860_c1 3300050512 Bacteria 1000
452 nmdc:mga08x19_139775_c1 3300050514 Bacteria 1635
453 nmdc:mga08x19_77903_c1 3300050514 Bacteria 2171
454 nmdc:mga0a205_308075_c1 3300050515 Bacteria 1456
455 nmdc:mga0a205_331826_c1 3300050515 Bacteria 1391
456 Ga0495619_0005826 3300053085 Bacteria 7810
457 Ga0501084_0017768 3300054114 Bacteria 5918
458 Ga0501084_0109450 3300054114 Bacteria 2321
459 Ga0501084_0194324 3300054114 Bacteria 1712
460 Ga0501082_0011454 3300060353 Bacteria 7633
461 Ga0530510_0101798 3300061734 Bacteria 2101
462 Ga0530510_0144090 3300061734 Bacteria 1757
463 Ga0070698_100209127
464 JGI25406J46586_10028067
465 JGI25407J50210_10022322
466 Ga0070658_10006313
467 Ga0070658_10107675
468 Ga0070683_100001257
469 Ga0070683_100008763
470 Ga0070683_100273699
471 Ga0070683_100415604
472 Ga0070666_10420835
473 Ga0070682_100332562
474 Ga0068868_100121245
475 Ga0068868_100128086
476 Ga0070660_100023544
477 Ga0070691_10058083
478 Ga0070687_100069957
479 Ga0070668_100013797
480 Ga0070668_100888234
481 Ga0070669_100134441
482 Ga0070674_100494306
483 Ga0070667_100260039
484 Ga0070714_100006800
485 Ga0070714_100241481
486 Ga0070714_100627563
487 Ga0070714_100659741
488 Ga0070713_100230202
489 Ga0070701_10221889
490 Ga0070705_100015631
491 Ga0070700_100564875
492 Ga0070678_100266544
493 Ga0070662_100126590
494 Ga0070662_100433532
495 Ga0070681_10000868
496 Ga0070681_10191834
497 Ga0070707_100043066
498 Ga0070707_100425077
499 Ga0070698_100062718
500 Ga0070698_100082866
501 Ga0070698_100373858
502 Ga0070679_100010108
503 Ga0070679_100048464
504 Ga0070679_100049157
505 Ga0070679_100262080
506 Ga0070679_100325438
507 Ga0070684_100003185
508 Ga0070684_100994798
509 Ga0070686_100026789
510 Ga0070695_100009732
511 Ga0070695_100036382
512 Ga0070696_100074968
513 Ga0070693_100086407
514 Ga0070704_100138699
515 Ga0070704_100237379
516 Ga0070704_100448988
517 Ga0068855_100323637
518 Ga0068857_100376707
519 Ga0068854_100085168
520 Ga0068854_100379713
521 Ga0068856_100003590
522 Ga0068856_100015813
523 Ga0068856_100143105
524 Ga0068856_100160978
525 Ga0068856_100719254
526 Ga0070702_100229442
527 Ga0068852_100023614
528 Ga0068866_10020268
529 Ga0068866_10203329
530 Ga0068861_100010773
531 Ga0068861_100029854
532 Ga0068870_10046674
533 Ga0068858_100057519
534 Ga0068858_100247967
535 Ga0068862_100157449
536 Ga0068862_101007344
537 Ga0081455_10003496
538 Ga0081455_10411076
539 Ga0081538_10005152
540 Ga0081538_10007570
541 Ga0081538_10017458
542 Ga0081540_1004859
543 Ga0081539_10000030
544 Ga0081539_10002871
545 Ga0075364_10134648
546 Ga0075432_10036697
547 Ga0070712_100251800
548 Ga0070712_100668118
549 Ga0075366_10340785
550 Ga0068871_100203266
551 Ga0068871_100493502
552 Ga0075428_100000633
553 Ga0075428_100266583
554 Ga0075430_100344262
555 Ga0075431_100828322
556 Ga0075434_100761310
557 Ga0075429_100172105
558 Ga0075436_100118103
559 Ga0075436_100212169
560 Ga0075436_100441504
561 Ga0105240_10119095
562 Ga0105240_10461588
563 Ga0111539_10074666
564 Ga0105245_10007106
565 Ga0105245_10035135
566 Ga0105245_10168990
567 Ga0105245_10288572
568 Ga0105245_10381528
569 Ga0114129_10011894
570 Ga0114129_10206150
571 Ga0105243_10036214
572 Ga0105243_10245213
573 Ga0105243_10567599
574 Ga0105243_10797387
575 Ga0105242_10346067
576 Ga0105249_10021205
577 Ga0105249_10204421
578 Ga0105249_10492263
579 Ga0105249_10561886
580 Ga0105239_10027858
581 Ga0105246_10380356
582 Ga0157374_10098303
583 Ga0157378_10138798
584 Ga0157372_10036740
585 Ga0157375_10411471
586 Ga0157380_10087952
587 Ga0182008_10008108
588 Ga0157379_10464153
589 Ga0182006_1004987
590 Ga0163161_10062205
591 Ga0207643_10009509
592 Ga0207705_10082292
593 Ga0207707_10011507
594 Ga0207707_10175832
595 Ga0207695_10095025
596 Ga0207693_10021910
597 Ga0207693_10157223
598 Ga0207660_10349047
599 Ga0207660_10514342
600 Ga0207660_10526007
601 Ga0207657_10019814
602 Ga0207649_10286931
603 Ga0207652_10009819
604 Ga0207652_10062667
605 Ga0207652_10077855
606 Ga0207646_10047995
607 Ga0207646_10121362
608 Ga0207646_10737583
609 Ga0207687_10002593
610 Ga0207687_10017760
611 Ga0207687_10112791
612 Ga0207687_10329235
613 Ga0207687_10379930
614 Ga0207700_10160422
615 Ga0207664_10032173
616 Ga0207664_10090023
617 Ga0207706_10002555
618 Ga0207706_10030305
619 Ga0207706_10065939
620 Ga0207686_10071287
621 Ga0207686_10174603
622 Ga0207669_10472098
623 Ga0207704_10154829
624 Ga0207661_10000395
625 Ga0207661_10002904
626 Ga0207679_10005071
627 Ga0207679_10049680
628 Ga0207667_10106466
629 Ga0207667_10471642
630 Ga0207712_10046346
631 Ga0207712_10115998
632 Ga0207668_10058983
633 Ga0207668_10286802
634 Ga0207640_10115221
635 Ga0207640_10703769
636 Ga0207677_10090419
637 Ga0207703_10287085
638 Ga0207639_10863746
639 Ga0207678_10116970
640 Ga0207708_10003345
641 Ga0207708_10011706
642 Ga0207708_10343178
643 Ga0207708_10730371
644 Ga0207702_10002935
645 Ga0207702_10005244
646 Ga0207648_10002590
647 Ga0207648_10038855
648 Ga0207648_10059666
649 Ga0207648_10279608
650 Ga0207674_10004968
651 Ga0207675_100005163
652 Ga0207675_100009268
653 Ga0207675_100068989
654 Ga0207675_100168892
655 Ga0207683_10007426
656 Ga0207683_10116448
657 Ga0207428_10001268
658 Ga0268264_10041413
659 Ga0265337_1036777
660 Ga0265326_10024892
661 Ga0265319_1002945
662 Ga0265334_10043568
663 Ga0265334_10091844
664 Ga0265318_10002950
665 Ga0265318_10020443
666 Ga0265318_10075932
667 Ga0265318_10136683
668 Ga0265322_10060282
669 Ga0265336_10032479
670 Ga0265336_10041095
671 Ga0265338_10038159
672 Ga0265338_10045918
673 Ga0265338_10049402
674 Ga0265338_10167837
675 Ga0265338_10403242
676 Ga0265324_10111755
677 Ga0265330_10008298
678 Ga0265332_10014621
679 Ga0265332_10072994
680 Ga0265332_10124977
681 Ga0265328_10027132
682 Ga0265328_10099502
683 Ga0265320_10038107
684 Ga0265320_10038131
685 Ga0265320_10047371
686 Ga0265325_10000453
687 Ga0265325_10049691
688 Ga0265325_10066975
689 Ga0265325_10083150
690 Ga0265329_10004254
691 Ga0265329_10039516
692 Ga0265340_10045697
693 Ga0265339_10004237
694 Ga0265339_10005781
695 Ga0265339_10213357
696 Ga0265331_10029095
697 Ga0265327_10012057
698 Ga0265327_10049441
699 Ga0265316_10008337
700 Ga0265316_10012401
701 Ga0265316_10034994
702 Ga0307408_100035773
703 Ga0265313_10027878
704 Ga0265313_10033916
705 Ga0265313_10049983
706 Ga0265314_10031692
707 Ga0265314_10060385
708 Ga0265342_10058113
709 Ga0307405_10128434
710 Ga0307405_10332323
711 Ga0307405_10373657
712 Ga0307405_10548372
713 Ga0307413_10012472
714 Ga0307410_10009429
715 Ga0307410_10053181
716 Ga0307406_10060908
717 Ga0307407_10085697
718 Ga0307407_10134209
719 Ga0307412_10041996
720 Ga0307412_10388955
721 Ga0307416_100034343
722 Ga0307416_100037049
723 Ga0307414_10442027
724 Ga0307411_10067292
725 Ga0307411_10325861
726 Ga0307415_100000143
727 Ga0307415_100038018
728 Ga0316583_10050387
729 Ga0373957_0079974
730 Ga0373955_0379206
731 Ga0395899_0001867
732 Ga0395899_0006095
733 Ga0395899_0017448
734 Ga0395899_0023480
735 Ga0395900_0031067
736 Ga0395900_0128008
737 Ga0395900_0182091
738 Ga0395898_0003844
739 Ga0395898_0007166
740 Ga0395898_0012547
741 Ga0395898_0343584
742 Ga0395898_0414013
743 Ga0395905_0002387
744 Ga0395905_0014867
745 Ga0395905_0021469
746 Ga0395905_0115506
747 Ga0395905_0240021
748 Ga0395905_0740442
749 Ga0395901_0003964
750 Ga0395901_0023026
751 Ga0395901_0038402
752 Ga0395901_0068581
753 Ga0395901_0104945
754 Ga0395901_0164595
755 Ga0395901_0404280
756 Ga0395901_0656768
757 Ga0395901_0687186
758 Ga0439441_004533
759 Ga0439448_0003955
760 Ga0439448_0098145
761 Ga0466961_0153713
762 Ga0466963_0229022
763 Ga0466963_0459875
764 Ga0466971_0073598
765 Ga0466971_0204847
766 Ga0466968_0032058
767 Ga0466957_0025996
768 Ga0466957_0131915
769 Ga0466958_0165570
770 Ga0466967_0004479
771 Ga0466967_0039270
772 Ga0466967_0039805
773 Ga0466967_0050996
774 Ga0466967_0154032
775 Ga0466967_0266650
776 Ga0466967_0815779
777 Ga0495629_0093863
778 Ga0495651_0213054
779 Ga0495653_0020511
780 Ga0495653_0082442
781 Ga0495664_0182727
782 Ga0495596_0136202
783 Ga0495628_0189570
784 Ga0495644_0211574
785 Ga0495667_0319144
786 Ga0495634_0101747
787 Ga0495657_0080222
788 Ga0495613_0072963
789 Ga0495684_0120095
790 Ga0496100_0077598
791 Ga0496101_0010064
792 Ga0496102_0008476
793 Ga0496102_0173803
794 Ga0496102_0753680
795 Ga0496103_0028695
796 Ga0496103_0284922
797 Ga0496104_0001067
798 Ga0496104_0006046
799 Ga0496104_0216273
800 Ga0496104_0537964
801 Ga0496105_0004823
802 Ga0496105_0005859
803 Ga0496105_0110930
804 Ga0496105_0173683
805 Ga0496107_0028447
806 Ga0496107_0229845
807 Ga0496108_0014773
808 Ga0496108_0791510
809 Ga0496109_0003756
810 Ga0496110_0002578
811 Ga0496110_0016203
812 Ga0496110_0750575
813 Ga0496111_0003690
814 Ga0496111_0680188
815 Ga0496112_0043045
816 Ga0496112_0048905
817 Ga0496112_0054472
818 Ga0496112_0102271
819 Ga0496112_0260673
820 Ga0496113_0135627
821 Ga0496113_0560468
822 Ga0496114_0000833
823 Ga0496114_0066017
824 Ga0496114_0077361
825 Ga0496114_0082510
826 Ga0496114_0090204
827 Ga0496114_0562637
828 Ga0496114_0738002
829 Ga0496115_0031969
830 Ga0496115_0230332
831 Ga0501031_0016084
832 Ga0501031_0116550
833 Ga0501032_0049912
834 Ga0501032_0067665
835 Ga0501032_0077412
836 Ga0501033_0003281
837 Ga0501033_0006916
838 Ga0501033_0015966
839 Ga0501034_0004154
840 Ga0501034_0095773
841 Ga0501034_0337505
842 Ga0501036_0003304
843 Ga0501036_0016447
844 Ga0501036_0021517
845 Ga0501037_0004536
846 Ga0501037_0016576
847 Ga0501037_0026162
848 Ga0501038_0012884
849 Ga0501038_0013182
850 Ga0501038_0038943
851 Ga0501039_0003242
852 Ga0501040_0036361
853 Ga0501042_0050017
854 Ga0501042_0094480
855 Ga0501043_0137830
856 Ga0501046_0004728
857 Ga0501046_0005858
858 Ga0501046_0065441
859 Ga0501047_0016754
860 Ga0501047_0082367
861 Ga0501047_0248017
862 Ga0501048_0010547
863 Ga0501067_0001856
864 Ga0501067_0016782
865 Ga0501067_0024182
866 Ga0501067_0027184
867 Ga0501067_0043061
868 Ga0501067_0044516
869 Ga0501068_0062597
870 Ga0501068_0063957
871 Ga0501068_0068173
872 Ga0501069_0001141
873 Ga0501069_0002209
874 Ga0501069_0064740
875 Ga0501069_0268341
876 Ga0501069_0282508
877 Ga0501070_0006835
878 Ga0501070_0011724
879 Ga0501070_0014070
880 Ga0501071_0001920
881 Ga0501071_0234840
882 Ga0501072_0037750
883 Ga0501072_0059964
884 Ga0501073_0000821
885 Ga0501073_0041945
886 Ga0501073_0053842
887 Ga0501073_0057985
888 Ga0501074_0010895
889 Ga0501074_0029597
890 Ga0501076_0081143
891 Ga0501076_0082572
892 Ga0501079_0000922
893 Ga0501079_0009685
894 Ga0501079_0137806
895 Ga0501080_0002096
896 Ga0501080_0033710
897 Ga0501080_0118102
898 Ga0501080_0260652
899 Ga0501081_0217855
900 Ga0501083_0016606
901 Ga0501083_0074888
902 Ga0501035_0091045
903 Ga0501035_0155154
904 Ga0501044_0094970
905 Ga0501045_0003003
906 Ga0501045_0010682
907 nmdc:mga0yw44_140319_c1
908 nmdc:mga05p37_217285_c1
909 nmdc:mga05p37_5262_c1
910 nmdc:mga05p37_890647_c1
911 nmdc:mga06r32_840034_c1
912 nmdc:mga0n895_165876_c1
913 nmdc:mga0n895_710860_c1
914 nmdc:mga08x19_139775_c1
915 nmdc:mga08x19_77903_c1
916 nmdc:mga0a205_308075_c1
917 nmdc:mga0a205_331826_c1
918 Ga0495619_0005826
919 Ga0501084_0017768
920 Ga0501084_0109450
921 Ga0501084_0194324
922 Ga0501082_0011454
923 Ga0530510_0101798
924 Ga0530510_0144090

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10728

DUF2520

Domain of unknown function (DUF2520)

147

267

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5nmw-assembly1.cif.gz_A-2 crystal structure of the pyrrolizidine alkaloid n-oxygenase from zonocerus variegatus in complex with fad 0.8813 3 29
5nmw-assembly2.cif.gz_D crystal structure of the pyrrolizidine alkaloid n-oxygenase from zonocerus variegatus in complex with fad 0.8754 3 29
6c87-assembly1.cif.gz_A crystal structure of rab gdp dissociation inhibitor alpha from naegleria fowleri 0.8659 3 32
2ivd-assembly1.cif.gz_A structure of protoporphyrinogen oxidase from myxococcus xanthus with acifluorfen 0.8645 3 29
5tuk-assembly2.cif.gz_B crystal structure of tetracycline destructase tet(51) 0.8502 1 32
ID Description Score Start End Superfamily
1qo8A03 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.858 3 34 3.50.50.60
2f1kD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8437 3 132 3.40.50.720
af_O06279_7_172_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.831 2 130 3.40.50.720
af_O69721_5_180_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8108 3 136 3.40.50.720
3bioA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7908 1 67 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A538ITJ0-F1-model_v4 DUF2520 domain-containing protein 0.9705 86 224
AF-A0A538EIS6-F1-model_v4 DUF2520 domain-containing protein 0.9603 1 224
AF-A0A538JYS5-F1-model_v4 DUF2520 domain-containing protein 0.9598 2 228
AF-A0A7W0SK36-F1-model_v4 DUF2520 domain-containing protein 0.9595 34 229
AF-A0A538CGL5-F1-model_v4 DUF2520 domain-containing protein 0.9568 1 224

Map