F448833
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 461 | 291 | 422 | 288 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2751185782|2753271976 |
| Length | 287 |
| Sequence | ITGGTGLVGSAVVAELLGHGHSVLALARSESSAQAAAKAGAEPIRGGLADLDVLRAGCARADGVVHLAFGNDFSGPEALARCVAEEGAALATLGSELAGSDRPLVTVSGTPWVAGRPSTEADPAPTDGPVGGRGRSVTAVLGLAGVRGSAVRLPRTVHNDGAGGFAGLLTGIARRSGVSGYPGDGTQRWPAVHALDAAVLFRLALERAPAGTCWHAVADEGDRVRDIAAVIGRRLGLPVEPVPAETFGPLGPIFATDQPSSSAHTRQVLGWAPKHPSLLADLENIRP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 2 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 3 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 4 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 5 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 6 | 2643221632 | Leifsonia sp. Root112D2 | Isolate | Unclassified |
| 7 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 8 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 9 | 2758568522 | Promicromonospora thailandica SAI-039 | Isolate | Unclassified |
| 10 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 11 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 12 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 13 | 2844852863 | Herbiconiux flava DSM 26474 | Isolate | Rhizosphere |
| 14 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 15 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 16 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 17 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 18 | 2883821847 | Microlunatus elymi KUDC0627 | Isolate | Rhizosphere |
| 19 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 20 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 21 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 22 | 2904430863 | Curtobacterium oceanosedimentum 1519 | Isolate | Rhizosphere |
| 23 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 24 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 25 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 26 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 27 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 28 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 29 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 30 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 31 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 32 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 33 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 34 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 35 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 38 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 42 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 80 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 81 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 83 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 84 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 85 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 87 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 88 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 116 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 117 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 153 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 154 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 155 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 156 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 157 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 158 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 159 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 160 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 161 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 162 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 163 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 164 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 165 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 166 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 167 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 168 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 169 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 170 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 171 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 172 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 173 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 174 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 175 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 176 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 177 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 178 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 179 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 180 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 181 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 182 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 183 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 184 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 185 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 225 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 226 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 227 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 228 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 229 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 232 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 233 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 234 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 235 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 236 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 237 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 238 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 239 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 240 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 241 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 242 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 243 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 271 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 272 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 273 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 274 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 275 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 276 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 278 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 280 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 281 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 282 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 283 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 284 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 285 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 287 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 288 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 289 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 290 | 8056037122 | Herbiconiux gentiana CPCC 205716 | Isolate | Rhizosphere |
| 291 | 8057345674 | Herbiconiux aconitum CPCC 205763 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.11 |
| Metatranscriptomes | 0.43 |
| Isolates | 8.46 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.94 |
| Nodule | 0 |
| Rhizoplane | 2.82 |
| Rhizosphere | 80.91 |
| Stem | 0 |
| Stem Tuber | 0.22 |
| Unclassified | 9.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055540_1000435 | 3300003792 | Bacteria | 33153 |
| 2 | Ga0055540_1003095 | 3300003792 | Bacteria | 8265 |
| 3 | Ga0070658_10097396 | 3300005327 | Bacteria | 2429 |
| 4 | Ga0070683_100036644 | 3300005329 | Bacteria | 4489 |
| 5 | Ga0068869_100299699 | 3300005334 | Bacteria | 1297 |
| 6 | Ga0068869_100469986 | 3300005334 | Bacteria | 1045 |
| 7 | Ga0070666_10061494 | 3300005335 | Bacteria | 2543 |
| 8 | Ga0070680_100478268 | 3300005336 | Bacteria | 1065 |
| 9 | Ga0070682_100204259 | 3300005337 | Bacteria | 1396 |
| 10 | Ga0068868_100046983 | 3300005338 | Bacteria | 3380 |
| 11 | Ga0070660_100112573 | 3300005339 | Bacteria | 2166 |
| 12 | Ga0070689_100022131 | 3300005340 | Bacteria | 4744 |
| 13 | Ga0070668_100145240 | 3300005347 | Bacteria | 1914 |
| 14 | Ga0070675_100074541 | 3300005354 | Bacteria | 2819 |
| 15 | Ga0070671_100082030 | 3300005355 | Bacteria | 2696 |
| 16 | Ga0070673_100137699 | 3300005364 | Bacteria | 2057 |
| 17 | Ga0070688_100251680 | 3300005365 | Bacteria | 1258 |
| 18 | Ga0070667_100242815 | 3300005367 | Bacteria | 1609 |
| 19 | Ga0070667_100360952 | 3300005367 | Bacteria | 1317 |
| 20 | Ga0070703_10052181 | 3300005406 | Bacteria | 1311 |
| 21 | Ga0070713_100035763 | 3300005436 | Bacteria | 4002 |
| 22 | Ga0070713_100091072 | 3300005436 | Bacteria | 2623 |
| 23 | Ga0070713_100195880 | 3300005436 | Bacteria | 1822 |
| 24 | Ga0070713_100251935 | 3300005436 | Bacteria | 1611 |
| 25 | Ga0070708_100049924 | 3300005445 | Bacteria | 3703 |
| 26 | Ga0070663_100106951 | 3300005455 | Bacteria | 2096 |
| 27 | Ga0070678_100033207 | 3300005456 | Bacteria | 3580 |
| 28 | Ga0070681_10176949 | 3300005458 | Bacteria | 2056 |
| 29 | Ga0070706_100010530 | 3300005467 | Bacteria | 8584 |
| 30 | Ga0070707_100009737 | 3300005468 | Bacteria | 8933 |
| 31 | Ga0070699_100005493 | 3300005518 | Bacteria | 11115 |
| 32 | Ga0070679_100057296 | 3300005530 | Bacteria | 3884 |
| 33 | Ga0070684_100246815 | 3300005535 | Bacteria | 1631 |
| 34 | Ga0070697_100001576 | 3300005536 | Bacteria | 17387 |
| 35 | Ga0068853_100100724 | 3300005539 | Bacteria | 2554 |
| 36 | Ga0070686_100034838 | 3300005544 | Bacteria | 3105 |
| 37 | Ga0070695_100071965 | 3300005545 | Bacteria | 2265 |
| 38 | Ga0070704_100240391 | 3300005549 | Bacteria | 1481 |
| 39 | Ga0068855_100003376 | 3300005563 | Bacteria | 19559 |
| 40 | Ga0068855_100025362 | 3300005563 | Bacteria | 7094 |
| 41 | Ga0068855_100099058 | 3300005563 | Bacteria | 3357 |
| 42 | Ga0068855_100409243 | 3300005563 | Bacteria | 1485 |
| 43 | Ga0068857_100324440 | 3300005577 | Bacteria | 1422 |
| 44 | Ga0068854_100047610 | 3300005578 | Bacteria | 3056 |
| 45 | Ga0068856_100045695 | 3300005614 | Bacteria | 4313 |
| 46 | Ga0070702_100148533 | 3300005615 | Bacteria | 1501 |
| 47 | Ga0068852_100032655 | 3300005616 | Bacteria | 4312 |
| 48 | Ga0068859_100303622 | 3300005617 | Bacteria | 1690 |
| 49 | Ga0068864_100053423 | 3300005618 | Bacteria | 3485 |
| 50 | Ga0068851_10170971 | 3300005834 | Bacteria | 1199 |
| 51 | Ga0068863_100073415 | 3300005841 | Bacteria | 3236 |
| 52 | Ga0068858_100032185 | 3300005842 | Bacteria | 4871 |
| 53 | Ga0068860_100343671 | 3300005843 | Bacteria | 1467 |
| 54 | Ga0068860_100837466 | 3300005843 | Bacteria | 934 |
| 55 | Ga0068862_100298352 | 3300005844 | Bacteria | 1482 |
| 56 | Ga0081455_10080171 | 3300005937 | Bacteria | 2677 |
| 57 | Ga0081540_1000790 | 3300005983 | Bacteria | 29061 |
| 58 | Ga0081540_1003466 | 3300005983 | Bacteria | 12452 |
| 59 | Ga0070717_10161747 | 3300006028 | Bacteria | 1942 |
| 60 | Ga0070717_10171564 | 3300006028 | Bacteria | 1887 |
| 61 | Ga0075365_10002423 | 3300006038 | Bacteria | 9143 |
| 62 | Ga0075365_10224930 | 3300006038 | Bacteria | 1317 |
| 63 | Ga0075368_10017945 | 3300006042 | Bacteria | 2654 |
| 64 | Ga0075364_10125988 | 3300006051 | Bacteria | 1717 |
| 65 | Ga0070715_10013470 | 3300006163 | Bacteria | 3005 |
| 66 | Ga0075362_10061131 | 3300006177 | Bacteria | 1704 |
| 67 | Ga0075367_10011264 | 3300006178 | Bacteria | 4724 |
| 68 | Ga0075369_10017486 | 3300006186 | Bacteria | 2907 |
| 69 | Ga0097621_100015778 | 3300006237 | Bacteria | 5694 |
| 70 | Ga0075370_10015200 | 3300006353 | Bacteria | 4116 |
| 71 | Ga0097620_100303600 | 3300006931 | Bacteria | 1690 |
| 72 | Ga0105251_10057916 | 3300009011 | Bacteria | 1830 |
| 73 | Ga0105244_10083774 | 3300009036 | Bacteria | 1575 |
| 74 | Ga0105250_10024368 | 3300009092 | Bacteria | 2438 |
| 75 | Ga0105240_10235488 | 3300009093 | Bacteria | 2125 |
| 76 | Ga0105245_10288440 | 3300009098 | Bacteria | 1607 |
| 77 | Ga0105247_10091138 | 3300009101 | Bacteria | 1935 |
| 78 | Ga0105243_10033043 | 3300009148 | Bacteria | 3999 |
| 79 | Ga0105241_10039310 | 3300009174 | Bacteria | 3568 |
| 80 | Ga0105241_10373710 | 3300009174 | Bacteria | 1243 |
| 81 | Ga0105242_10237943 | 3300009176 | Bacteria | 1635 |
| 82 | Ga0105248_10297482 | 3300009177 | Bacteria | 1817 |
| 83 | Ga0105237_10172147 | 3300009545 | Bacteria | 2165 |
| 84 | Ga0105238_10041980 | 3300009551 | Bacteria | 4632 |
| 85 | Ga0105249_10170553 | 3300009553 | Bacteria | 2109 |
| 86 | Ga0105246_10040418 | 3300011119 | Bacteria | 3147 |
| 87 | Ga0105246_10100767 | 3300011119 | Bacteria | 2102 |
| 88 | Ga0157373_10064245 | 3300013100 | Bacteria | 2598 |
| 89 | Ga0157369_10043158 | 3300013105 | Bacteria | 4916 |
| 90 | Ga0157374_10011788 | 3300013296 | Bacteria | 7585 |
| 91 | Ga0157378_10032184 | 3300013297 | Bacteria | 4633 |
| 92 | Ga0163162_10450674 | 3300013306 | Bacteria | 1419 |
| 93 | Ga0157372_10083083 | 3300013307 | Bacteria | 3628 |
| 94 | Ga0163163_10366436 | 3300014325 | Bacteria | 1498 |
| 95 | Ga0157377_10038037 | 3300014745 | Bacteria | 2655 |
| 96 | Ga0157379_10190659 | 3300014968 | Bacteria | 1852 |
| 97 | Ga0183367_1014 | 3300015688 | Bacteria | 330534 |
| 98 | Ga0213875_10100744 | 3300021388 | Bacteria | 1348 |
| 99 | Ga0224712_10082843 | 3300022467 | Bacteria | 1328 |
| 100 | Ga0209563_100519 | 3300025230 | Bacteria | 13078 |
| 101 | Ga0207427_101265 | 3300025231 | Bacteria | 9681 |
| 102 | Ga0209233_1000658 | 3300025261 | Bacteria | 16772 |
| 103 | Ga0209673_1011811 | 3300025273 | Bacteria | 3572 |
| 104 | Ga0209758_1006582 | 3300025297 | Bacteria | 8247 |
| 105 | Ga0209051_1000421 | 3300025303 | Bacteria | 58306 |
| 106 | Ga0209051_1001622 | 3300025303 | Bacteria | 18338 |
| 107 | Ga0207692_10059027 | 3300025898 | Bacteria | 1979 |
| 108 | Ga0207680_10141885 | 3300025903 | Bacteria | 1593 |
| 109 | Ga0207699_10011395 | 3300025906 | Bacteria | 4489 |
| 110 | Ga0207699_10119370 | 3300025906 | Bacteria | 1703 |
| 111 | Ga0207643_10019236 | 3300025908 | Bacteria | 3742 |
| 112 | Ga0207707_10163229 | 3300025912 | Bacteria | 1947 |
| 113 | Ga0207695_10354065 | 3300025913 | Bacteria | 1355 |
| 114 | Ga0207671_10336541 | 3300025914 | Bacteria | 1196 |
| 115 | Ga0207662_10252303 | 3300025918 | Bacteria | 1158 |
| 116 | Ga0207649_10188626 | 3300025920 | Bacteria | 1448 |
| 117 | Ga0207646_10004151 | 3300025922 | Bacteria | 15891 |
| 118 | Ga0207687_10100043 | 3300025927 | Bacteria | 2132 |
| 119 | Ga0207700_10015055 | 3300025928 | Bacteria | 5088 |
| 120 | Ga0207700_10319508 | 3300025928 | Bacteria | 1345 |
| 121 | Ga0207700_10477978 | 3300025928 | Bacteria | 1101 |
| 122 | Ga0207664_10163337 | 3300025929 | Bacteria | 1901 |
| 123 | Ga0207664_10201756 | 3300025929 | Bacteria | 1717 |
| 124 | Ga0207686_10169384 | 3300025934 | Bacteria | 1539 |
| 125 | Ga0207689_10025785 | 3300025942 | Bacteria | 4926 |
| 126 | Ga0207667_10001432 | 3300025949 | Bacteria | 29907 |
| 127 | Ga0207667_10060399 | 3300025949 | Bacteria | 3968 |
| 128 | Ga0207651_10281284 | 3300025960 | Bacteria | 1375 |
| 129 | Ga0207640_10198591 | 3300025981 | Bacteria | 1518 |
| 130 | Ga0207658_10273475 | 3300025986 | Bacteria | 1445 |
| 131 | Ga0207678_10013005 | 3300026067 | Bacteria | 7303 |
| 132 | Ga0207678_10279312 | 3300026067 | Bacteria | 1433 |
| 133 | Ga0207702_10032985 | 3300026078 | Bacteria | 4323 |
| 134 | Ga0207702_10073161 | 3300026078 | Bacteria | 2955 |
| 135 | Ga0207641_10406929 | 3300026088 | Bacteria | 1307 |
| 136 | Ga0207676_10436518 | 3300026095 | Bacteria | 1231 |
| 137 | Ga0207674_10476440 | 3300026116 | Bacteria | 1206 |
| 138 | Ga0207675_100016519 | 3300026118 | Bacteria | 6892 |
| 139 | Ga0207683_10076992 | 3300026121 | Bacteria | 2954 |
| 140 | Ga0209371_1007100 | 3300027312 | Bacteria | 3979 |
| 141 | Ga0268264_10106162 | 3300028381 | Bacteria | 2451 |
| 142 | Ga0268264_10112101 | 3300028381 | Bacteria | 2391 |
| 143 | Ga0268256_1009322 | 3300030500 | Bacteria | 3276 |
| 144 | Ga0307512_10008400 | 3300030522 | Bacteria | 10071 |
| 145 | Ga0265340_10008815 | 3300031247 | Bacteria | 5436 |
| 146 | Ga0307513_10149627 | 3300031456 | Bacteria | 2246 |
| 147 | Ga0307516_10000196 | 3300031730 | Bacteria | 78480 |
| 148 | Ga0307516_10001511 | 3300031730 | Bacteria | 32004 |
| 149 | Ga0307518_10001212 | 3300031838 | Bacteria | 19320 |
| 150 | Ga0307415_100454956 | 3300032126 | Bacteria | 1108 |
| 151 | Ga0373960_0044876 | 3300035121 | Bacteria | 1292 |
| 152 | Ga0372808_004443 | 3300036459 | Bacteria | 1791 |
| 153 | Ga0373925_0000009 | 3300037068 | Bacteria | 243099 |
| 154 | Ga0373925_0003432 | 3300037068 | Bacteria | 12268 |
| 155 | Ga0373925_0037435 | 3300037068 | Bacteria | 3582 |
| 156 | Ga0395899_0108460 | 3300037312 | Bacteria | 1998 |
| 157 | Ga0395898_0021115 | 3300037466 | Bacteria | 6605 |
| 158 | Ga0395898_0132061 | 3300037466 | Bacteria | 2391 |
| 159 | Ga0436364_0344289 | 3300037853 | Bacteria | 1931 |
| 160 | Ga0436364_1150670 | 3300037853 | Bacteria | 4032 |
| 161 | Ga0436364_1388430 | 3300037853 | Bacteria | 3262 |
| 162 | Ga0395901_0020545 | 3300038443 | Bacteria | 6759 |
| 163 | Ga0395901_0272097 | 3300038443 | Bacteria | 1761 |
| 164 | Ga0436365_0674342 | 3300039437 | Bacteria | 3629 |
| 165 | Ga0451851_1126265 | 3300041507 | Bacteria | 991 |
| 166 | Ga0451853_0405826 | 3300041512 | Bacteria | 2479 |
| 167 | Ga0450903_014030 | 3300042138 | Bacteria | 1270 |
| 168 | Ga0466969_0013883 | 3300044656 | Bacteria | 4239 |
| 169 | Ga0466969_0046494 | 3300044656 | Bacteria | 2152 |
| 170 | Ga0466972_0012320 | 3300044658 | Bacteria | 4297 |
| 171 | Ga0466972_0047127 | 3300044658 | Bacteria | 2085 |
| 172 | Ga0466972_0054583 | 3300044658 | Bacteria | 1922 |
| 173 | Ga0466965_0000003 | 3300044683 | Bacteria | 265985 |
| 174 | Ga0466966_0001900 | 3300044684 | Bacteria | 13568 |
| 175 | Ga0466966_0009848 | 3300044684 | Bacteria | 6334 |
| 176 | Ga0466966_0013957 | 3300044684 | Bacteria | 5318 |
| 177 | Ga0466966_0082716 | 3300044684 | Bacteria | 1998 |
| 178 | Ga0466966_0195224 | 3300044684 | Bacteria | 1226 |
| 179 | Ga0466966_0224010 | 3300044684 | Bacteria | 1135 |
| 180 | Ga0466961_0003641 | 3300044693 | Bacteria | 9603 |
| 181 | Ga0466961_0009075 | 3300044693 | Bacteria | 6341 |
| 182 | Ga0466961_0062207 | 3300044693 | Bacteria | 2372 |
| 183 | Ga0466963_0000223 | 3300044694 | Bacteria | 24157 |
| 184 | Ga0466963_0035035 | 3300044694 | Bacteria | 3269 |
| 185 | Ga0466963_0151612 | 3300044694 | Bacteria | 1610 |
| 186 | Ga0466964_0008164 | 3300044706 | Bacteria | 3930 |
| 187 | Ga0466971_0000703 | 3300044719 | Bacteria | 13361 |
| 188 | Ga0466968_0013764 | 3300044735 | Bacteria | 3184 |
| 189 | Ga0466970_0000009 | 3300044765 | Bacteria | 99007 |
| 190 | Ga0466970_0007064 | 3300044765 | Bacteria | 5617 |
| 191 | Ga0466970_0011352 | 3300044765 | Bacteria | 4541 |
| 192 | Ga0466970_0146100 | 3300044765 | Bacteria | 1304 |
| 193 | Ga0466957_0002013 | 3300044842 | Bacteria | 10829 |
| 194 | Ga0466957_0039989 | 3300044842 | Bacteria | 2831 |
| 195 | Ga0466957_0084616 | 3300044842 | Bacteria | 1980 |
| 196 | Ga0466957_0099157 | 3300044842 | Bacteria | 1834 |
| 197 | Ga0466957_0227326 | 3300044842 | Bacteria | 1234 |
| 198 | Ga0466957_0279187 | 3300044842 | Bacteria | 1118 |
| 199 | Ga0466960_0038183 | 3300044901 | Bacteria | 2256 |
| 200 | Ga0466960_0045544 | 3300044901 | Bacteria | 2096 |
| 201 | Ga0466959_0010395 | 3300045049 | Bacteria | 6650 |
| 202 | Ga0466959_0129009 | 3300045049 | Bacteria | 1793 |
| 203 | Ga0466958_0003012 | 3300045836 | Bacteria | 8628 |
| 204 | Ga0466958_0037927 | 3300045836 | Bacteria | 2889 |
| 205 | Ga0466958_0168473 | 3300045836 | Bacteria | 1386 |
| 206 | Ga0466967_0000668 | 3300045976 | Bacteria | 17336 |
| 207 | Ga0466967_0008301 | 3300045976 | Bacteria | 7593 |
| 208 | Ga0466967_0157373 | 3300045976 | Bacteria | 2130 |
| 209 | Ga0495592_0031358 | 3300046454 | Bacteria | 4017 |
| 210 | Ga0495638_0098814 | 3300046460 | Bacteria | 1748 |
| 211 | Ga0495651_0013140 | 3300046462 | Bacteria | 6401 |
| 212 | Ga0495653_0018615 | 3300046463 | Bacteria | 5637 |
| 213 | Ga0495653_0041299 | 3300046463 | Bacteria | 3601 |
| 214 | Ga0495662_0000138 | 3300046476 | Bacteria | 28025 |
| 215 | Ga0495607_0021753 | 3300046501 | Bacteria | 4033 |
| 216 | Ga0495608_0003041 | 3300046511 | Bacteria | 11979 |
| 217 | Ga0495608_0017154 | 3300046511 | Bacteria | 5012 |
| 218 | Ga0495618_0029775 | 3300046514 | Bacteria | 3406 |
| 219 | Ga0495618_0123203 | 3300046514 | Bacteria | 1660 |
| 220 | Ga0495620_0013679 | 3300046515 | Bacteria | 4148 |
| 221 | Ga0495628_0010911 | 3300046516 | Bacteria | 7693 |
| 222 | Ga0495628_0015680 | 3300046516 | Bacteria | 6326 |
| 223 | Ga0495628_0086329 | 3300046516 | Bacteria | 2433 |
| 224 | Ga0495630_0009122 | 3300046517 | Bacteria | 7133 |
| 225 | Ga0495630_0112414 | 3300046517 | Bacteria | 2063 |
| 226 | Ga0495643_0023665 | 3300046522 | Bacteria | 3489 |
| 227 | Ga0495648_0127908 | 3300046524 | Bacteria | 1355 |
| 228 | Ga0495666_0001201 | 3300046526 | Bacteria | 12505 |
| 229 | Ga0495652_0006115 | 3300046529 | Bacteria | 11252 |
| 230 | Ga0495665_0005254 | 3300046531 | Bacteria | 6979 |
| 231 | Ga0495587_0035577 | 3300046536 | Bacteria | 2999 |
| 232 | Ga0495645_0092642 | 3300046543 | Bacteria | 2158 |
| 233 | Ga0495645_0232096 | 3300046543 | Bacteria | 1236 |
| 234 | Ga0495667_0002865 | 3300046559 | Bacteria | 11547 |
| 235 | Ga0495667_0103000 | 3300046559 | Bacteria | 1846 |
| 236 | Ga0495668_0042456 | 3300046616 | Bacteria | 2532 |
| 237 | Ga0495634_0026169 | 3300046642 | Bacteria | 4073 |
| 238 | Ga0495634_0072450 | 3300046642 | Bacteria | 2266 |
| 239 | Ga0495657_0000530 | 3300046675 | Bacteria | 35507 |
| 240 | Ga0495657_0006238 | 3300046675 | Bacteria | 9346 |
| 241 | Ga0495613_0002177 | 3300046689 | Bacteria | 14834 |
| 242 | Ga0495613_0005407 | 3300046689 | Bacteria | 9595 |
| 243 | Ga0495649_0139278 | 3300046694 | Bacteria | 1278 |
| 244 | Ga0495589_0075287 | 3300046794 | Bacteria | 1646 |
| 245 | Ga0495600_0001586 | 3300046809 | Bacteria | 12637 |
| 246 | Ga0495581_0009106 | 3300047315 | Bacteria | 5743 |
| 247 | Ga0495604_0001662 | 3300047317 | Bacteria | 18301 |
| 248 | Ga0495604_0008353 | 3300047317 | Bacteria | 8187 |
| 249 | Ga0495604_0143388 | 3300047317 | Bacteria | 1704 |
| 250 | Ga0495674_0043678 | 3300047319 | Bacteria | 3988 |
| 251 | Ga0495672_0221689 | 3300047320 | Bacteria | 933 |
| 252 | Ga0495680_0078541 | 3300047322 | Bacteria | 2498 |
| 253 | Ga0495683_0035675 | 3300047323 | Bacteria | 2527 |
| 254 | Ga0495687_014284 | 3300047443 | Bacteria | 4094 |
| 255 | Ga0495675_0030115 | 3300047444 | Bacteria | 3463 |
| 256 | Ga0495685_011272 | 3300047447 | Bacteria | 3012 |
| 257 | Ga0495684_0058153 | 3300047471 | Bacteria | 2945 |
| 258 | Ga0495684_0059431 | 3300047471 | Bacteria | 2911 |
| 259 | Ga0495602_0246093 | 3300048088 | Bacteria | 1335 |
| 260 | Ga0495614_0026488 | 3300048089 | Bacteria | 2499 |
| 261 | Ga0496101_0112222 | 3300048904 | Bacteria | 2053 |
| 262 | Ga0496102_0323988 | 3300048905 | Bacteria | 1451 |
| 263 | Ga0496104_0458426 | 3300048907 | Bacteria | 1186 |
| 264 | Ga0496105_0030047 | 3300048908 | Bacteria | 4451 |
| 265 | Ga0496105_0164830 | 3300048908 | Bacteria | 1818 |
| 266 | Ga0496106_0031753 | 3300048909 | Bacteria | 3935 |
| 267 | Ga0496107_0034271 | 3300048910 | Bacteria | 3636 |
| 268 | Ga0496108_0000677 | 3300048911 | Bacteria | 26362 |
| 269 | Ga0496109_0001466 | 3300048912 | Bacteria | 19576 |
| 270 | Ga0496111_0060797 | 3300048914 | Bacteria | 2738 |
| 271 | Ga0496113_0295892 | 3300048916 | Bacteria | 1296 |
| 272 | Ga0496114_0000292 | 3300048917 | Bacteria | 36655 |
| 273 | Ga0496114_0163463 | 3300048917 | Bacteria | 1937 |
| 274 | Ga0496117_0002488 | 3300048920 | Bacteria | 23114 |
| 275 | Ga0496119_0000053 | 3300048922 | Bacteria | 182875 |
| 276 | Ga0496120_0003005 | 3300048923 | Bacteria | 15993 |
| 277 | Ga0496121_0110546 | 3300048924 | Bacteria | 2097 |
| 278 | Ga0496122_0008671 | 3300048925 | Bacteria | 10904 |
| 279 | Ga0496123_0023329 | 3300048926 | Bacteria | 4737 |
| 280 | Ga0496124_0005861 | 3300048927 | Bacteria | 13621 |
| 281 | Ga0496124_0238086 | 3300048927 | Bacteria | 1355 |
| 282 | Ga0496125_0095735 | 3300048928 | Bacteria | 2207 |
| 283 | Ga0496126_0000013 | 3300048929 | Bacteria | 690046 |
| 284 | Ga0496126_0224753 | 3300048929 | Bacteria | 1575 |
| 285 | Ga0501031_0000683 | 3300049568 | Bacteria | 20253 |
| 286 | Ga0501031_0021627 | 3300049568 | Bacteria | 4193 |
| 287 | Ga0501031_0025326 | 3300049568 | Bacteria | 3871 |
| 288 | Ga0501031_0170514 | 3300049568 | Bacteria | 1422 |
| 289 | Ga0501032_0000291 | 3300049569 | Bacteria | 42013 |
| 290 | Ga0501032_0003455 | 3300049569 | Bacteria | 12108 |
| 291 | Ga0501032_0003744 | 3300049569 | Bacteria | 11532 |
| 292 | Ga0501032_0016546 | 3300049569 | Bacteria | 5186 |
| 293 | Ga0501032_0033598 | 3300049569 | Bacteria | 3513 |
| 294 | Ga0501033_0003237 | 3300049570 | Bacteria | 13474 |
| 295 | Ga0501033_0004216 | 3300049570 | Bacteria | 11568 |
| 296 | Ga0501033_0041878 | 3300049570 | Bacteria | 3415 |
| 297 | Ga0501033_0066796 | 3300049570 | Bacteria | 2644 |
| 298 | Ga0501033_0073254 | 3300049570 | Bacteria | 2514 |
| 299 | Ga0501033_0092820 | 3300049570 | Bacteria | 2207 |
| 300 | Ga0501033_0116916 | 3300049570 | Bacteria | 1937 |
| 301 | Ga0501033_0135001 | 3300049570 | Bacteria | 1785 |
| 302 | Ga0501033_0138414 | 3300049570 | Bacteria | 1761 |
| 303 | Ga0501033_0333476 | 3300049570 | Bacteria | 1064 |
| 304 | Ga0501033_0372291 | 3300049570 | Bacteria | 998 |
| 305 | Ga0501034_0002462 | 3300049571 | Bacteria | 22323 |
| 306 | Ga0501034_0003908 | 3300049571 | Bacteria | 16740 |
| 307 | Ga0501034_0012947 | 3300049571 | Bacteria | 8598 |
| 308 | Ga0501034_0013399 | 3300049571 | Bacteria | 8440 |
| 309 | Ga0501034_0030218 | 3300049571 | Bacteria | 5506 |
| 310 | Ga0501034_0064386 | 3300049571 | Bacteria | 3680 |
| 311 | Ga0501034_0156592 | 3300049571 | Bacteria | 2251 |
| 312 | Ga0501036_0001130 | 3300049572 | Bacteria | 20310 |
| 313 | Ga0501036_0005006 | 3300049572 | Bacteria | 10723 |
| 314 | Ga0501036_0011980 | 3300049572 | Bacteria | 7188 |
| 315 | Ga0501036_0050628 | 3300049572 | Bacteria | 3517 |
| 316 | Ga0501036_0080666 | 3300049572 | Bacteria | 2750 |
| 317 | Ga0501036_0202050 | 3300049572 | Bacteria | 1671 |
| 318 | Ga0501036_0470597 | 3300049572 | Bacteria | 1046 |
| 319 | Ga0501037_0000280 | 3300049573 | Bacteria | 43512 |
| 320 | Ga0501037_0003181 | 3300049573 | Bacteria | 11918 |
| 321 | Ga0501037_0035691 | 3300049573 | Bacteria | 3665 |
| 322 | Ga0501037_0086665 | 3300049573 | Bacteria | 2266 |
| 323 | Ga0501037_0091824 | 3300049573 | Bacteria | 2196 |
| 324 | Ga0501038_0000883 | 3300049574 | Bacteria | 26567 |
| 325 | Ga0501038_0001682 | 3300049574 | Bacteria | 20489 |
| 326 | Ga0501038_0007461 | 3300049574 | Bacteria | 10090 |
| 327 | Ga0501038_0008514 | 3300049574 | Bacteria | 9424 |
| 328 | Ga0501038_0030996 | 3300049574 | Bacteria | 4727 |
| 329 | Ga0501038_0038095 | 3300049574 | Bacteria | 4211 |
| 330 | Ga0501038_0139693 | 3300049574 | Bacteria | 1983 |
| 331 | Ga0501039_0000382 | 3300049575 | Bacteria | 31795 |
| 332 | Ga0501039_0038913 | 3300049575 | Bacteria | 3673 |
| 333 | Ga0501039_0039913 | 3300049575 | Bacteria | 3624 |
| 334 | Ga0501039_0105769 | 3300049575 | Bacteria | 2197 |
| 335 | Ga0501039_0495422 | 3300049575 | Bacteria | 959 |
| 336 | Ga0501040_0048745 | 3300049576 | Bacteria | 2895 |
| 337 | Ga0501042_0063520 | 3300049578 | Bacteria | 2639 |
| 338 | Ga0501042_0266628 | 3300049578 | Bacteria | 1236 |
| 339 | Ga0501043_0001643 | 3300049579 | Bacteria | 19416 |
| 340 | Ga0501043_0003778 | 3300049579 | Bacteria | 12443 |
| 341 | Ga0501043_0040703 | 3300049579 | Bacteria | 3652 |
| 342 | Ga0501043_0203770 | 3300049579 | Bacteria | 1534 |
| 343 | Ga0501043_0281649 | 3300049579 | Bacteria | 1274 |
| 344 | Ga0501046_0000442 | 3300049580 | Bacteria | 41660 |
| 345 | Ga0501046_0002177 | 3300049580 | Bacteria | 18499 |
| 346 | Ga0501046_0005101 | 3300049580 | Bacteria | 11782 |
| 347 | Ga0501046_0082515 | 3300049580 | Bacteria | 2482 |
| 348 | Ga0501046_0202752 | 3300049580 | Bacteria | 1475 |
| 349 | Ga0501047_0000324 | 3300049581 | Bacteria | 55265 |
| 350 | Ga0501047_0002814 | 3300049581 | Bacteria | 16515 |
| 351 | Ga0501047_0006102 | 3300049581 | Bacteria | 11324 |
| 352 | Ga0501047_0046993 | 3300049581 | Bacteria | 4171 |
| 353 | Ga0501047_0064122 | 3300049581 | Bacteria | 3543 |
| 354 | Ga0501047_0068160 | 3300049581 | Bacteria | 3427 |
| 355 | Ga0501047_0140512 | 3300049581 | Bacteria | 2293 |
| 356 | Ga0501047_0169337 | 3300049581 | Bacteria | 2053 |
| 357 | Ga0501047_0228936 | 3300049581 | Bacteria | 1713 |
| 358 | Ga0501047_0398150 | 3300049581 | Bacteria | 1210 |
| 359 | Ga0501048_0001572 | 3300049582 | Bacteria | 17352 |
| 360 | Ga0501048_0002950 | 3300049582 | Bacteria | 13002 |
| 361 | Ga0501048_0032408 | 3300049582 | Bacteria | 3776 |
| 362 | Ga0501048_0034114 | 3300049582 | Bacteria | 3674 |
| 363 | Ga0501067_0001971 | 3300049583 | Bacteria | 11307 |
| 364 | Ga0501068_0006710 | 3300049584 | Bacteria | 6360 |
| 365 | Ga0501068_0050789 | 3300049584 | Bacteria | 2507 |
| 366 | Ga0501069_0000958 | 3300049585 | Bacteria | 13759 |
| 367 | Ga0501070_0001779 | 3300049586 | Bacteria | 19037 |
| 368 | Ga0501070_0003700 | 3300049586 | Bacteria | 13210 |
| 369 | Ga0501070_0051009 | 3300049586 | Bacteria | 3434 |
| 370 | Ga0501070_0095456 | 3300049586 | Bacteria | 2460 |
| 371 | Ga0501070_0125632 | 3300049586 | Bacteria | 2120 |
| 372 | Ga0501071_0013346 | 3300049587 | Bacteria | 5597 |
| 373 | Ga0501073_0001462 | 3300049589 | Bacteria | 17490 |
| 374 | Ga0501073_0040042 | 3300049589 | Bacteria | 3319 |
| 375 | Ga0501073_0061789 | 3300049589 | Bacteria | 2613 |
| 376 | Ga0501074_0000718 | 3300049590 | Bacteria | 20753 |
| 377 | Ga0501074_0025457 | 3300049590 | Bacteria | 4298 |
| 378 | Ga0501074_0035948 | 3300049590 | Bacteria | 3589 |
| 379 | Ga0501074_0091745 | 3300049590 | Bacteria | 2175 |
| 380 | Ga0501080_0001004 | 3300049742 | Bacteria | 23167 |
| 381 | Ga0501080_0105326 | 3300049742 | Bacteria | 2615 |
| 382 | Ga0501081_0068201 | 3300049743 | Bacteria | 2476 |
| 383 | Ga0501083_0133624 | 3300049744 | Bacteria | 1626 |
| 384 | Ga0501035_0000587 | 3300049822 | Bacteria | 40047 |
| 385 | Ga0501035_0002957 | 3300049822 | Bacteria | 16341 |
| 386 | Ga0501035_0003938 | 3300049822 | Bacteria | 14157 |
| 387 | Ga0501035_0044646 | 3300049822 | Bacteria | 3990 |
| 388 | Ga0501035_0093753 | 3300049822 | Bacteria | 2641 |
| 389 | Ga0501035_0130766 | 3300049822 | Bacteria | 2188 |
| 390 | Ga0501035_0221435 | 3300049822 | Bacteria | 1615 |
| 391 | Ga0501044_0000489 | 3300049823 | Bacteria | 48052 |
| 392 | Ga0501044_0002104 | 3300049823 | Bacteria | 22907 |
| 393 | Ga0501044_0047629 | 3300049823 | Bacteria | 4433 |
| 394 | Ga0501044_0052384 | 3300049823 | Bacteria | 4205 |
| 395 | Ga0501044_0056027 | 3300049823 | Bacteria | 4047 |
| 396 | Ga0501044_0083199 | 3300049823 | Bacteria | 3237 |
| 397 | Ga0501044_0096489 | 3300049823 | Bacteria | 2978 |
| 398 | Ga0501044_0109214 | 3300049823 | Bacteria | 2775 |
| 399 | Ga0501044_0281213 | 3300049823 | Bacteria | 1597 |
| 400 | Ga0501044_0315292 | 3300049823 | Bacteria | 1489 |
| 401 | Ga0501044_0503637 | 3300049823 | Bacteria | 1112 |
| 402 | Ga0501045_0102395 | 3300049824 | Bacteria | 2120 |
| 403 | Ga0501045_0321595 | 3300049824 | Bacteria | 1151 |
| 404 | nmdc:mga03683_35546_c1 | 3300050489 | Bacteria | 2021 |
| 405 | nmdc:mga00v17_187525_c1 | 3300050491 | Bacteria | 1335 |
| 406 | nmdc:mga0yw44_68951_c1 | 3300050492 | Bacteria | 2189 |
| 407 | nmdc:mga06z11_2637_c1 | 3300050494 | Bacteria | 6873 |
| 408 | nmdc:mga07m45_85883_c1 | 3300050496 | Bacteria | 1799 |
| 409 | nmdc:mga0sz30_14294_c2 | 3300050516 | Bacteria | 2710 |
| 410 | Ga0495601_0018824 | 3300053077 | Bacteria | 4206 |
| 411 | Ga0500635_0054476 | 3300053080 | Bacteria | 1379 |
| 412 | Ga0495619_0018154 | 3300053085 | Bacteria | 4461 |
| 413 | Ga0500556_0007981 | 3300053104 | Bacteria | 3041 |
| 414 | Ga0500572_070287 | 3300053111 | Bacteria | 1081 |
| 415 | Ga0500559_0019495 | 3300053136 | Bacteria | 2866 |
| 416 | Ga0500600_0124888 | 3300053149 | Bacteria | 1320 |
| 417 | Ga0500616_0000194 | 3300053153 | Bacteria | 99376 |
| 418 | Ga0500616_0000452 | 3300053153 | Bacteria | 53746 |
| 419 | Ga0500616_0032362 | 3300053153 | Bacteria | 2859 |
| 420 | Ga0500645_007107 | 3300053730 | Bacteria | 3933 |
| 421 | Ga0501084_0005680 | 3300054114 | Bacteria | 10243 |
| 422 | Ga0466962_0090604 | 3300061719 | Bacteria | 1465 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047320 | Ga0495672_0221689 | Ga0495672_0221689_67_834 | 246 |
| 2 | 3300005445 | Ga0070708_100049924 | Ga0070708_1000499242 | 253 |
| 3 | 3300005467 | Ga0070706_100010530 | Ga0070706_1000105305 | 253 |
| 4 | 3300005468 | Ga0070707_100009737 | Ga0070707_1000097377 | 253 |
| 5 | 3300005518 | Ga0070699_100005493 | Ga0070699_1000054935 | 253 |
| 6 | 3300005536 | Ga0070697_100001576 | Ga0070697_1000015766 | 253 |
| 7 | 3300025922 | Ga0207646_10004151 | Ga0207646_100041516 | 253 |
| 8 | 3300046460 | Ga0495638_0098814 | Ga0495638_0098814_288_1169 | 253 |
| 9 | 3300049571 | Ga0501034_0030218 | Ga0501034_0030218_1959_2840 | 254 |
| 10 | 3300049572 | Ga0501036_0005006 | Ga0501036_0005006_3495_4376 | 254 |
| 11 | 3300049573 | Ga0501037_0091824 | Ga0501037_0091824_377_1258 | 254 |
| 12 | 3300049574 | Ga0501038_0001682 | Ga0501038_0001682_9818_10699 | 254 |
| 13 | 3300049575 | Ga0501039_0038913 | Ga0501039_0038913_537_1418 | 254 |
| 14 | 3300049578 | Ga0501042_0266628 | Ga0501042_0266628_154_1035 | 254 |
| 15 | 3300049579 | Ga0501043_0003778 | Ga0501043_0003778_1680_2561 | 254 |
| 16 | 3300049581 | Ga0501047_0006102 | Ga0501047_0006102_9725_10606 | 254 |
| 17 | 3300049589 | Ga0501073_0040042 | Ga0501073_0040042_76_957 | 254 |
| 18 | 3300049590 | Ga0501074_0091745 | Ga0501074_0091745_267_1148 | 254 |
| 19 | 3300049823 | Ga0501044_0056027 | Ga0501044_0056027_1566_2447 | 254 |
| 20 | 3300046543 | Ga0495645_0232096 | Ga0495645_0232096_262_1143 | 257 |
| 21 | 3300005334 | Ga0068869_100469986 | Ga0068869_1004699861 | 258 |
| 22 | 3300005843 | Ga0068860_100837466 | Ga0068860_1008374661 | 258 |
| 23 | 3300044735 | Ga0466968_0013764 | Ga0466968_0013764_431_1312 | 259 |
| 24 | 3300005436 | Ga0070713_100195880 | Ga0070713_1001958801 | 261 |
| 25 | 3300013105 | Ga0157369_10043158 | Ga0157369_100431584 | 261 |
| 26 | 3300005436 | Ga0070713_100091072 | Ga0070713_1000910722 | 262 |
| 27 | 3300025906 | Ga0207699_10119370 | Ga0207699_101193702 | 262 |
| 28 | 3300037068 | Ga0373925_0000009 | Ga0373925_0000009_32048_32857 | 262 |
| 29 | 3300044656 | Ga0466969_0013883 | Ga0466969_0013883_2010_2891 | 262 |
| 30 | 3300044684 | Ga0466966_0195224 | Ga0466966_0195224_86_970 | 262 |
| 31 | 3300044694 | Ga0466963_0035035 | Ga0466963_0035035_1783_2667 | 262 |
| 32 | 3300046454 | Ga0495592_0031358 | Ga0495592_0031358_1920_2837 | 262 |
| 33 | 3300046463 | Ga0495653_0018615 | Ga0495653_0018615_836_1753 | 262 |
| 34 | 3300046476 | Ga0495662_0000138 | Ga0495662_0000138_4714_5631 | 262 |
| 35 | 3300046511 | Ga0495608_0003041 | Ga0495608_0003041_4876_5793 | 262 |
| 36 | 3300046516 | Ga0495628_0015680 | Ga0495628_0015680_725_1642 | 262 |
| 37 | 3300046517 | Ga0495630_0009122 | Ga0495630_0009122_4430_5347 | 262 |
| 38 | 3300046526 | Ga0495666_0001201 | Ga0495666_0001201_10821_11738 | 262 |
| 39 | 3300046531 | Ga0495665_0005254 | Ga0495665_0005254_2963_3880 | 262 |
| 40 | 3300046536 | Ga0495587_0035577 | Ga0495587_0035577_641_1558 | 262 |
| 41 | 3300046559 | Ga0495667_0002865 | Ga0495667_0002865_6201_7118 | 262 |
| 42 | 3300046642 | Ga0495634_0026169 | Ga0495634_0026169_739_1656 | 262 |
| 43 | 3300046675 | Ga0495657_0006238 | Ga0495657_0006238_6215_7132 | 262 |
| 44 | 3300046689 | Ga0495613_0002177 | Ga0495613_0002177_4430_5347 | 262 |
| 45 | 3300047315 | Ga0495581_0009106 | Ga0495581_0009106_2344_3261 | 262 |
| 46 | 3300047317 | Ga0495604_0001662 | Ga0495604_0001662_16263_17180 | 262 |
| 47 | 3300047444 | Ga0495675_0030115 | Ga0495675_0030115_760_1677 | 262 |
| 48 | 3300047471 | Ga0495684_0058153 | Ga0495684_0058153_566_1483 | 262 |
| 49 | 3300053077 | Ga0495601_0018824 | Ga0495601_0018824_2352_3269 | 262 |
| 50 | 3300053085 | Ga0495619_0018154 | Ga0495619_0018154_396_1313 | 262 |
| 51 | 3300048929 | Ga0496126_0224753 | Ga0496126_0224753_476_1357 | 264 |
| 52 | 3300005327 | Ga0070658_10097396 | Ga0070658_100973962 | 266 |
| 53 | 3300005563 | Ga0068855_100409243 | Ga0068855_1004092431 | 266 |
| 54 | 3300005436 | Ga0070713_100035763 | Ga0070713_1000357632 | 269 |
| 55 | 3300006028 | Ga0070717_10171564 | Ga0070717_101715642 | 269 |
| 56 | 3300025928 | Ga0207700_10319508 | Ga0207700_103195082 | 269 |
| 57 | 3300036459 | Ga0372808_004443 | Ga0372808_004443_241_1122 | 270 |
| 58 | 3300053149 | Ga0500600_0124888 | Ga0500600_0124888_269_1150 | 273 |
| 59 | 3300026067 | Ga0207678_10013005 | Ga0207678_100130054 | 275 |
| 60 | 3300048923 | Ga0496120_0003005 | Ga0496120_0003005_5652_6545 | 276 |
| 61 | 3300048920 | Ga0496117_0002488 | Ga0496117_0002488_2024_2905 | 277 |
| 62 | 3300005367 | Ga0070667_100360952 | Ga0070667_1003609521 | 279 |
| 63 | 3300025986 | Ga0207658_10273475 | Ga0207658_102734752 | 279 |
| 64 | 3300049570 | Ga0501033_0003237 | Ga0501033_0003237_5132_6013 | 281 |
| 65 | 3300046694 | Ga0495649_0139278 | Ga0495649_0139278_301_1182 | 282 |
| 66 | 3300049570 | Ga0501033_0138414 | Ga0501033_0138414_762_1643 | 282 |
| 67 | 3300038443 | Ga0395901_0020545 | Ga0395901_0020545_4909_5790 | 283 |
| 68 | 3300045976 | Ga0466967_0008301 | Ga0466967_0008301_229_1110 | 283 |
| 69 | 3300005436 | Ga0070713_100251935 | Ga0070713_1002519351 | 284 |
| 70 | 3300046515 | Ga0495620_0013679 | Ga0495620_0013679_2468_3349 | 284 |
| 71 | 3300046522 | Ga0495643_0023665 | Ga0495643_0023665_806_1687 | 284 |
| 72 | 3300046616 | Ga0495668_0042456 | Ga0495668_0042456_38_919 | 284 |
| 73 | 3300046794 | Ga0495589_0075287 | Ga0495589_0075287_727_1608 | 284 |
| 74 | 3300047443 | Ga0495687_014284 | Ga0495687_014284_2810_3691 | 284 |
| 75 | 3300047447 | Ga0495685_011272 | Ga0495685_011272_29_910 | 284 |
| 76 | 3300026116 | Ga0207674_10476440 | Ga0207674_104764401 | 286 |
| 77 | 3300032126 | Ga0307415_100454956 | Ga0307415_1004549561 | 286 |
| 78 | 3300047319 | Ga0495674_0043678 | Ga0495674_0043678_1101_1982 | 286 |
| 79 | iso_pu_bacteria | 2751185782 | 2753271976 | 287 |
| 80 | 3300005329 | Ga0070683_100036644 | Ga0070683_1000366443 | 288 |
| 81 | 3300005334 | Ga0068869_100299699 | Ga0068869_1002996991 | 288 |
| 82 | 3300005335 | Ga0070666_10061494 | Ga0070666_100614942 | 288 |
| 83 | 3300005338 | Ga0068868_100046983 | Ga0068868_1000469832 | 288 |
| 84 | 3300005339 | Ga0070660_100112573 | Ga0070660_1001125732 | 288 |
| 85 | 3300005340 | Ga0070689_100022131 | Ga0070689_1000221314 | 288 |
| 86 | 3300005354 | Ga0070675_100074541 | Ga0070675_1000745413 | 288 |
| 87 | 3300005355 | Ga0070671_100082030 | Ga0070671_1000820304 | 288 |
| 88 | 3300005364 | Ga0070673_100137699 | Ga0070673_1001376991 | 288 |
| 89 | 3300005365 | Ga0070688_100251680 | Ga0070688_1002516802 | 288 |
| 90 | 3300005367 | Ga0070667_100242815 | Ga0070667_1002428151 | 288 |
| 91 | 3300005406 | Ga0070703_10052181 | Ga0070703_100521811 | 288 |
| 92 | 3300005456 | Ga0070678_100033207 | Ga0070678_1000332071 | 288 |
| 93 | 3300005458 | Ga0070681_10176949 | Ga0070681_101769492 | 288 |
| 94 | 3300005535 | Ga0070684_100246815 | Ga0070684_1002468151 | 288 |
| 95 | 3300005539 | Ga0068853_100100724 | Ga0068853_1001007242 | 288 |
| 96 | 3300005544 | Ga0070686_100034838 | Ga0070686_1000348382 | 288 |
| 97 | 3300005545 | Ga0070695_100071965 | Ga0070695_1000719651 | 288 |
| 98 | 3300005549 | Ga0070704_100240391 | Ga0070704_1002403911 | 288 |
| 99 | 3300005563 | Ga0068855_100099058 | Ga0068855_1000990584 | 288 |
| 100 | 3300005577 | Ga0068857_100324440 | Ga0068857_1003244401 | 288 |
| 101 | 3300005578 | Ga0068854_100047610 | Ga0068854_1000476102 | 288 |
| 102 | 3300005615 | Ga0070702_100148533 | Ga0070702_1001485331 | 288 |
| 103 | 3300005616 | Ga0068852_100032655 | Ga0068852_1000326552 | 288 |
| 104 | 3300005617 | Ga0068859_100303622 | Ga0068859_1003036222 | 288 |
| 105 | 3300005618 | Ga0068864_100053423 | Ga0068864_1000534234 | 288 |
| 106 | 3300005834 | Ga0068851_10170971 | Ga0068851_101709711 | 288 |
| 107 | 3300005841 | Ga0068863_100073415 | Ga0068863_1000734152 | 288 |
| 108 | 3300005842 | Ga0068858_100032185 | Ga0068858_1000321855 | 288 |
| 109 | 3300005843 | Ga0068860_100343671 | Ga0068860_1003436712 | 288 |
| 110 | 3300005844 | Ga0068862_100298352 | Ga0068862_1002983522 | 288 |
| 111 | 3300006163 | Ga0070715_10013470 | Ga0070715_100134702 | 288 |
| 112 | 3300006237 | Ga0097621_100015778 | Ga0097621_1000157782 | 288 |
| 113 | 3300006931 | Ga0097620_100303600 | Ga0097620_1003036002 | 288 |
| 114 | 3300009011 | Ga0105251_10057916 | Ga0105251_100579162 | 288 |
| 115 | 3300009093 | Ga0105240_10235488 | Ga0105240_102354882 | 288 |
| 116 | 3300009098 | Ga0105245_10288440 | Ga0105245_102884402 | 288 |
| 117 | 3300009101 | Ga0105247_10091138 | Ga0105247_100911381 | 288 |
| 118 | 3300009176 | Ga0105242_10237943 | Ga0105242_102379432 | 288 |
| 119 | 3300009177 | Ga0105248_10297482 | Ga0105248_102974822 | 288 |
| 120 | 3300009545 | Ga0105237_10172147 | Ga0105237_101721472 | 288 |
| 121 | 3300009551 | Ga0105238_10041980 | Ga0105238_100419804 | 288 |
| 122 | 3300009553 | Ga0105249_10170553 | Ga0105249_101705532 | 288 |
| 123 | 3300011119 | Ga0105246_10040418 | Ga0105246_100404184 | 288 |
| 124 | 3300013100 | Ga0157373_10064245 | Ga0157373_100642452 | 288 |
| 125 | 3300013297 | Ga0157378_10032184 | Ga0157378_100321844 | 288 |
| 126 | 3300013306 | Ga0163162_10450674 | Ga0163162_104506742 | 288 |
| 127 | 3300014325 | Ga0163163_10366436 | Ga0163163_103664362 | 288 |
| 128 | 3300014745 | Ga0157377_10038037 | Ga0157377_100380373 | 288 |
| 129 | 3300014968 | Ga0157379_10190659 | Ga0157379_101906592 | 288 |
| 130 | 3300022467 | Ga0224712_10082843 | Ga0224712_100828432 | 288 |
| 131 | 3300025903 | Ga0207680_10141885 | Ga0207680_101418852 | 288 |
| 132 | 3300025906 | Ga0207699_10011395 | Ga0207699_100113954 | 288 |
| 133 | 3300025908 | Ga0207643_10019236 | Ga0207643_100192363 | 288 |
| 134 | 3300025912 | Ga0207707_10163229 | Ga0207707_101632292 | 288 |
| 135 | 3300025913 | Ga0207695_10354065 | Ga0207695_103540651 | 288 |
| 136 | 3300025914 | Ga0207671_10336541 | Ga0207671_103365411 | 288 |
| 137 | 3300025920 | Ga0207649_10188626 | Ga0207649_101886262 | 288 |
| 138 | 3300025927 | Ga0207687_10100043 | Ga0207687_101000433 | 288 |
| 139 | 3300025928 | Ga0207700_10015055 | Ga0207700_100150553 | 288 |
| 140 | 3300025929 | Ga0207664_10163337 | Ga0207664_101633371 | 288 |
| 141 | 3300025929 | Ga0207664_10201756 | Ga0207664_102017561 | 288 |
| 142 | 3300025934 | Ga0207686_10169384 | Ga0207686_101693842 | 288 |
| 143 | 3300025942 | Ga0207689_10025785 | Ga0207689_100257855 | 288 |
| 144 | 3300025960 | Ga0207651_10281284 | Ga0207651_102812841 | 288 |
| 145 | 3300025981 | Ga0207640_10198591 | Ga0207640_101985912 | 288 |
| 146 | 3300026078 | Ga0207702_10073161 | Ga0207702_100731613 | 288 |
| 147 | 3300026088 | Ga0207641_10406929 | Ga0207641_104069291 | 288 |
| 148 | 3300026095 | Ga0207676_10436518 | Ga0207676_104365181 | 288 |
| 149 | 3300026118 | Ga0207675_100016519 | Ga0207675_1000165194 | 288 |
| 150 | 3300026121 | Ga0207683_10076992 | Ga0207683_100769924 | 288 |
| 151 | 3300028381 | Ga0268264_10106162 | Ga0268264_101061622 | 288 |
| 152 | 3300035121 | Ga0373960_0044876 | Ga0373960_0044876_124_1005 | 288 |
| 153 | 3300048904 | Ga0496101_0112222 | Ga0496101_0112222_730_1611 | 288 |
| 154 | 3300048905 | Ga0496102_0323988 | Ga0496102_0323988_24_905 | 288 |
| 155 | 3300048909 | Ga0496106_0031753 | Ga0496106_0031753_536_1417 | 288 |
| 156 | 3300048910 | Ga0496107_0034271 | Ga0496107_0034271_2581_3462 | 288 |
| 157 | 3300048914 | Ga0496111_0060797 | Ga0496111_0060797_1014_1895 | 288 |
| 158 | iso_pu_bacteria | 2547132424 | 2548694487 | 289 |
| 159 | iso_pu_bacteria | 2558860280 | 2559426978 | 289 |
| 160 | iso_pu_bacteria | 2616644814 | 2616698532 | 289 |
| 161 | iso_pu_bacteria | 2643221617 | 2644102162 | 289 |
| 162 | iso_pu_bacteria | 2643221620 | 2644115385 | 289 |
| 163 | iso_pu_bacteria | 2643221632 | 2644181440 | 289 |
| 164 | iso_pu_bacteria | 2643221687 | 2644490349 | 289 |
| 165 | iso_pu_bacteria | 2758568522 | 2760307193 | 289 |
| 166 | iso_pu_bacteria | 2799112218 | 2799183376 | 289 |
| 167 | iso_pu_bacteria | 2802429296 | 2804843855 | 289 |
| 168 | iso_pu_bacteria | 2808606375 | 2808916084 | 289 |
| 169 | iso_pu_bacteria | 2844852863 | 2844855031 | 289 |
| 170 | iso_pu_bacteria | 2857481737 | 2857486009 | 289 |
| 171 | iso_pu_bacteria | 2862281513 | 2862289182 | 289 |
| 172 | iso_pu_bacteria | 2862290372 | 2862296031 | 289 |
| 173 | iso_pu_bacteria | 2867428634 | 2867430758 | 289 |
| 174 | iso_pu_bacteria | 2883821847 | 2883824296 | 289 |
| 175 | iso_pu_bacteria | 2891395885 | 2891396627 | 289 |
| 176 | iso_pu_bacteria | 2899370129 | 2899373314 | 289 |
| 177 | iso_pu_bacteria | 2902837492 | 2902839839 | 289 |
| 178 | iso_pu_bacteria | 2904430863 | 2904433638 | 289 |
| 179 | iso_pu_bacteria | 2917736166 | 2917744110 | 289 |
| 180 | iso_pu_bacteria | 2919713450 | 2919713952 | 289 |
| 181 | iso_pu_bacteria | 2954380949 | 2954390222 | 289 |
| 182 | iso_pu_bacteria | 2954711539 | 2954711816 | 289 |
| 183 | iso_pu_bacteria | 2954721474 | 2954721733 | 289 |
| 184 | iso_pu_bacteria | 2954731030 | 2954740089 | 289 |
| 185 | iso_pu_bacteria | 2954740390 | 2954740645 | 289 |
| 186 | iso_pu_bacteria | 2954749733 | 2954758917 | 289 |
| 187 | iso_pu_bacteria | 2954759201 | 2954759655 | 289 |
| 188 | iso_pu_bacteria | 2995463766 | 2995469951 | 289 |
| 189 | iso_pu_bacteria | 3002998708 | 3003007879 | 289 |
| 190 | iso_pu_bacteria | 8003314358 | 8003316746 | 289 |
| 191 | iso_pu_bacteria | 8047710418 | 8047711091 | 289 |
| 192 | iso_pu_bacteria | 8047710418 | 8047718354 | 289 |
| 193 | iso_pu_bacteria | 8048127548 | 8048135965 | 289 |
| 194 | iso_pu_bacteria | 8056037122 | 8056038031 | 289 |
| 195 | iso_pu_bacteria | 8057345674 | 8057349317 | 289 |
| 196 | 3300037853 | Ga0436364_0344289 | Ga0436364_0344289_212_1093 | 290 |
| 197 | 3300045976 | Ga0466967_0157373 | Ga0466967_0157373_798_1694 | 291 |
| 198 | 3300049569 | Ga0501032_0003744 | Ga0501032_0003744_859_1770 | 291 |
| 199 | 3300049571 | Ga0501034_0013399 | Ga0501034_0013399_3415_4326 | 291 |
| 200 | 3300049573 | Ga0501037_0086665 | Ga0501037_0086665_929_1840 | 291 |
| 201 | 3300049574 | Ga0501038_0038095 | Ga0501038_0038095_3008_3919 | 291 |
| 202 | 3300049581 | Ga0501047_0064122 | Ga0501047_0064122_1526_2437 | 291 |
| 203 | 3300049582 | Ga0501048_0032408 | Ga0501048_0032408_2004_2915 | 291 |
| 204 | 3300049586 | Ga0501070_0051009 | Ga0501070_0051009_2236_3147 | 291 |
| 205 | 3300049742 | Ga0501080_0105326 | Ga0501080_0105326_1373_2248 | 291 |
| 206 | 3300049822 | Ga0501035_0093753 | Ga0501035_0093753_863_1774 | 291 |
| 207 | 3300049824 | Ga0501045_0102395 | Ga0501045_0102395_221_1132 | 291 |
| 208 | 3300044693 | Ga0466961_0003641 | Ga0466961_0003641_365_1243 | 292 |
| 209 | 3300048911 | Ga0496108_0000677 | Ga0496108_0000677_23823_24701 | 292 |
| 210 | 3300049823 | Ga0501044_0503637 | Ga0501044_0503637_176_1054 | 292 |
| 211 | 3300003792 | Ga0055540_1000435 | Ga0055540_100043521 | 293 |
| 212 | 3300003792 | Ga0055540_1003095 | Ga0055540_10030959 | 293 |
| 213 | 3300005336 | Ga0070680_100478268 | Ga0070680_1004782681 | 293 |
| 214 | 3300005337 | Ga0070682_100204259 | Ga0070682_1002042591 | 293 |
| 215 | 3300005347 | Ga0070668_100145240 | Ga0070668_1001452401 | 293 |
| 216 | 3300005455 | Ga0070663_100106951 | Ga0070663_1001069512 | 293 |
| 217 | 3300005530 | Ga0070679_100057296 | Ga0070679_1000572962 | 293 |
| 218 | 3300005563 | Ga0068855_100003376 | Ga0068855_10000337610 | 293 |
| 219 | 3300005563 | Ga0068855_100025362 | Ga0068855_1000253622 | 293 |
| 220 | 3300005614 | Ga0068856_100045695 | Ga0068856_1000456955 | 293 |
| 221 | 3300005937 | Ga0081455_10080171 | Ga0081455_100801713 | 293 |
| 222 | 3300005983 | Ga0081540_1000790 | Ga0081540_100079015 | 293 |
| 223 | 3300005983 | Ga0081540_1003466 | Ga0081540_10034665 | 293 |
| 224 | 3300006028 | Ga0070717_10161747 | Ga0070717_101617472 | 293 |
| 225 | 3300006038 | Ga0075365_10002423 | Ga0075365_100024239 | 293 |
| 226 | 3300006038 | Ga0075365_10224930 | Ga0075365_102249302 | 293 |
| 227 | 3300006042 | Ga0075368_10017945 | Ga0075368_100179452 | 293 |
| 228 | 3300006051 | Ga0075364_10125988 | Ga0075364_101259882 | 293 |
| 229 | 3300006177 | Ga0075362_10061131 | Ga0075362_100611312 | 293 |
| 230 | 3300006178 | Ga0075367_10011264 | Ga0075367_100112643 | 293 |
| 231 | 3300006186 | Ga0075369_10017486 | Ga0075369_100174862 | 293 |
| 232 | 3300006353 | Ga0075370_10015200 | Ga0075370_100152002 | 293 |
| 233 | 3300009036 | Ga0105244_10083774 | Ga0105244_100837741 | 293 |
| 234 | 3300009092 | Ga0105250_10024368 | Ga0105250_100243683 | 293 |
| 235 | 3300009148 | Ga0105243_10033043 | Ga0105243_100330433 | 293 |
| 236 | 3300009174 | Ga0105241_10039310 | Ga0105241_100393102 | 293 |
| 237 | 3300009174 | Ga0105241_10373710 | Ga0105241_103737101 | 293 |
| 238 | 3300011119 | Ga0105246_10100767 | Ga0105246_101007672 | 293 |
| 239 | 3300013296 | Ga0157374_10011788 | Ga0157374_100117885 | 293 |
| 240 | 3300013307 | Ga0157372_10083083 | Ga0157372_100830834 | 293 |
| 241 | 3300015688 | Ga0183367_1014 | Ga0183367_1014110 | 293 |
| 242 | 3300021388 | Ga0213875_10100744 | Ga0213875_101007441 | 293 |
| 243 | 3300025230 | Ga0209563_100519 | Ga0209563_1005196 | 293 |
| 244 | 3300025231 | Ga0207427_101265 | Ga0207427_1012653 | 293 |
| 245 | 3300025261 | Ga0209233_1000658 | Ga0209233_10006587 | 293 |
| 246 | 3300025273 | Ga0209673_1011811 | Ga0209673_10118113 | 293 |
| 247 | 3300025297 | Ga0209758_1006582 | Ga0209758_10065825 | 293 |
| 248 | 3300025303 | Ga0209051_1000421 | Ga0209051_100042137 | 293 |
| 249 | 3300025303 | Ga0209051_1001622 | Ga0209051_10016227 | 293 |
| 250 | 3300025898 | Ga0207692_10059027 | Ga0207692_100590272 | 293 |
| 251 | 3300025918 | Ga0207662_10252303 | Ga0207662_102523032 | 293 |
| 252 | 3300025928 | Ga0207700_10477978 | Ga0207700_104779782 | 293 |
| 253 | 3300025949 | Ga0207667_10001432 | Ga0207667_1000143215 | 293 |
| 254 | 3300025949 | Ga0207667_10060399 | Ga0207667_100603994 | 293 |
| 255 | 3300026067 | Ga0207678_10279312 | Ga0207678_102793121 | 293 |
| 256 | 3300026078 | Ga0207702_10032985 | Ga0207702_100329855 | 293 |
| 257 | 3300027312 | Ga0209371_1007100 | Ga0209371_10071004 | 293 |
| 258 | 3300028381 | Ga0268264_10112101 | Ga0268264_101121012 | 293 |
| 259 | 3300030500 | Ga0268256_1009322 | Ga0268256_10093222 | 293 |
| 260 | 3300030522 | Ga0307512_10008400 | Ga0307512_1000840011 | 293 |
| 261 | 3300031247 | Ga0265340_10008815 | Ga0265340_100088158 | 293 |
| 262 | 3300031456 | Ga0307513_10149627 | Ga0307513_101496273 | 293 |
| 263 | 3300031730 | Ga0307516_10000196 | Ga0307516_1000019662 | 293 |
| 264 | 3300031730 | Ga0307516_10001511 | Ga0307516_100015114 | 293 |
| 265 | 3300031838 | Ga0307518_10001212 | Ga0307518_100012129 | 293 |
| 266 | 3300037068 | Ga0373925_0003432 | Ga0373925_0003432_10963_11844 | 293 |
| 267 | 3300037068 | Ga0373925_0037435 | Ga0373925_0037435_1545_2426 | 293 |
| 268 | 3300037312 | Ga0395899_0108460 | Ga0395899_0108460_1015_1896 | 293 |
| 269 | 3300037466 | Ga0395898_0021115 | Ga0395898_0021115_304_1185 | 293 |
| 270 | 3300037466 | Ga0395898_0132061 | Ga0395898_0132061_1165_2046 | 293 |
| 271 | 3300037853 | Ga0436364_1150670 | Ga0436364_1150670_1477_2358 | 293 |
| 272 | 3300037853 | Ga0436364_1388430 | Ga0436364_1388430_1781_2662 | 293 |
| 273 | 3300038443 | Ga0395901_0272097 | Ga0395901_0272097_274_1155 | 293 |
| 274 | 3300039437 | Ga0436365_0674342 | Ga0436365_0674342_1286_2167 | 293 |
| 275 | 3300041507 | Ga0451851_1126265 | Ga0451851_1126265_50_931 | 293 |
| 276 | 3300041512 | Ga0451853_0405826 | Ga0451853_0405826_1388_2269 | 293 |
| 277 | 3300042138 | Ga0450903_014030 | Ga0450903_014030_106_1023 | 293 |
| 278 | 3300044656 | Ga0466969_0046494 | Ga0466969_0046494_792_1682 | 293 |
| 279 | 3300044658 | Ga0466972_0012320 | Ga0466972_0012320_534_1415 | 293 |
| 280 | 3300044658 | Ga0466972_0047127 | Ga0466972_0047127_850_1731 | 293 |
| 281 | 3300044658 | Ga0466972_0054583 | Ga0466972_0054583_1027_1908 | 293 |
| 282 | 3300044683 | Ga0466965_0000003 | Ga0466965_0000003_245157_246038 | 293 |
| 283 | 3300044684 | Ga0466966_0001900 | Ga0466966_0001900_9742_10623 | 293 |
| 284 | 3300044684 | Ga0466966_0009848 | Ga0466966_0009848_1863_2744 | 293 |
| 285 | 3300044684 | Ga0466966_0013957 | Ga0466966_0013957_46_927 | 293 |
| 286 | 3300044684 | Ga0466966_0082716 | Ga0466966_0082716_48_929 | 293 |
| 287 | 3300044684 | Ga0466966_0224010 | Ga0466966_0224010_11_892 | 293 |
| 288 | 3300044693 | Ga0466961_0009075 | Ga0466961_0009075_4690_5571 | 293 |
| 289 | 3300044693 | Ga0466961_0062207 | Ga0466961_0062207_557_1438 | 293 |
| 290 | 3300044694 | Ga0466963_0000223 | Ga0466963_0000223_2262_3143 | 293 |
| 291 | 3300044694 | Ga0466963_0151612 | Ga0466963_0151612_653_1534 | 293 |
| 292 | 3300044706 | Ga0466964_0008164 | Ga0466964_0008164_732_1613 | 293 |
| 293 | 3300044719 | Ga0466971_0000703 | Ga0466971_0000703_8890_9771 | 293 |
| 294 | 3300044765 | Ga0466970_0000009 | Ga0466970_0000009_21871_22752 | 293 |
| 295 | 3300044765 | Ga0466970_0007064 | Ga0466970_0007064_3619_4536 | 293 |
| 296 | 3300044765 | Ga0466970_0011352 | Ga0466970_0011352_3632_4513 | 293 |
| 297 | 3300044765 | Ga0466970_0146100 | Ga0466970_0146100_293_1174 | 293 |
| 298 | 3300044842 | Ga0466957_0002013 | Ga0466957_0002013_41_922 | 293 |
| 299 | 3300044842 | Ga0466957_0039989 | Ga0466957_0039989_1823_2707 | 293 |
| 300 | 3300044842 | Ga0466957_0084616 | Ga0466957_0084616_176_1057 | 293 |
| 301 | 3300044842 | Ga0466957_0099157 | Ga0466957_0099157_125_1006 | 293 |
| 302 | 3300044842 | Ga0466957_0227326 | Ga0466957_0227326_285_1166 | 293 |
| 303 | 3300044842 | Ga0466957_0279187 | Ga0466957_0279187_216_1097 | 293 |
| 304 | 3300044901 | Ga0466960_0038183 | Ga0466960_0038183_82_963 | 293 |
| 305 | 3300044901 | Ga0466960_0045544 | Ga0466960_0045544_517_1398 | 293 |
| 306 | 3300045049 | Ga0466959_0010395 | Ga0466959_0010395_1225_2106 | 293 |
| 307 | 3300045049 | Ga0466959_0129009 | Ga0466959_0129009_163_1044 | 293 |
| 308 | 3300045836 | Ga0466958_0003012 | Ga0466958_0003012_2523_3404 | 293 |
| 309 | 3300045836 | Ga0466958_0037927 | Ga0466958_0037927_1102_1983 | 293 |
| 310 | 3300045836 | Ga0466958_0168473 | Ga0466958_0168473_472_1353 | 293 |
| 311 | 3300045976 | Ga0466967_0000668 | Ga0466967_0000668_3759_4640 | 293 |
| 312 | 3300046462 | Ga0495651_0013140 | Ga0495651_0013140_4783_5664 | 293 |
| 313 | 3300046463 | Ga0495653_0041299 | Ga0495653_0041299_500_1381 | 293 |
| 314 | 3300046501 | Ga0495607_0021753 | Ga0495607_0021753_76_957 | 293 |
| 315 | 3300046511 | Ga0495608_0017154 | Ga0495608_0017154_2316_3197 | 293 |
| 316 | 3300046514 | Ga0495618_0029775 | Ga0495618_0029775_1375_2256 | 293 |
| 317 | 3300046514 | Ga0495618_0123203 | Ga0495618_0123203_571_1452 | 293 |
| 318 | 3300046516 | Ga0495628_0010911 | Ga0495628_0010911_5970_6851 | 293 |
| 319 | 3300046516 | Ga0495628_0086329 | Ga0495628_0086329_973_1854 | 293 |
| 320 | 3300046517 | Ga0495630_0112414 | Ga0495630_0112414_120_1001 | 293 |
| 321 | 3300046524 | Ga0495648_0127908 | Ga0495648_0127908_416_1297 | 293 |
| 322 | 3300046529 | Ga0495652_0006115 | Ga0495652_0006115_2445_3326 | 293 |
| 323 | 3300046543 | Ga0495645_0092642 | Ga0495645_0092642_544_1425 | 293 |
| 324 | 3300046559 | Ga0495667_0103000 | Ga0495667_0103000_586_1467 | 293 |
| 325 | 3300046642 | Ga0495634_0072450 | Ga0495634_0072450_899_1780 | 293 |
| 326 | 3300046675 | Ga0495657_0000530 | Ga0495657_0000530_4909_5790 | 293 |
| 327 | 3300046689 | Ga0495613_0005407 | Ga0495613_0005407_7213_8094 | 293 |
| 328 | 3300046809 | Ga0495600_0001586 | Ga0495600_0001586_2958_3839 | 293 |
| 329 | 3300047317 | Ga0495604_0008353 | Ga0495604_0008353_7097_7978 | 293 |
| 330 | 3300047317 | Ga0495604_0143388 | Ga0495604_0143388_695_1576 | 293 |
| 331 | 3300047322 | Ga0495680_0078541 | Ga0495680_0078541_104_985 | 293 |
| 332 | 3300047323 | Ga0495683_0035675 | Ga0495683_0035675_903_1784 | 293 |
| 333 | 3300047471 | Ga0495684_0059431 | Ga0495684_0059431_399_1280 | 293 |
| 334 | 3300048088 | Ga0495602_0246093 | Ga0495602_0246093_316_1197 | 293 |
| 335 | 3300048089 | Ga0495614_0026488 | Ga0495614_0026488_1165_2046 | 293 |
| 336 | 3300048907 | Ga0496104_0458426 | Ga0496104_0458426_77_958 | 293 |
| 337 | 3300048908 | Ga0496105_0030047 | Ga0496105_0030047_2206_3087 | 293 |
| 338 | 3300048908 | Ga0496105_0164830 | Ga0496105_0164830_791_1672 | 293 |
| 339 | 3300048912 | Ga0496109_0001466 | Ga0496109_0001466_3615_4496 | 293 |
| 340 | 3300048916 | Ga0496113_0295892 | Ga0496113_0295892_81_962 | 293 |
| 341 | 3300048917 | Ga0496114_0000292 | Ga0496114_0000292_5907_6788 | 293 |
| 342 | 3300048917 | Ga0496114_0163463 | Ga0496114_0163463_782_1663 | 293 |
| 343 | 3300048922 | Ga0496119_0000053 | Ga0496119_0000053_31228_32109 | 293 |
| 344 | 3300048924 | Ga0496121_0110546 | Ga0496121_0110546_72_953 | 293 |
| 345 | 3300048925 | Ga0496122_0008671 | Ga0496122_0008671_5533_6414 | 293 |
| 346 | 3300048926 | Ga0496123_0023329 | Ga0496123_0023329_3084_3965 | 293 |
| 347 | 3300048927 | Ga0496124_0005861 | Ga0496124_0005861_3300_4181 | 293 |
| 348 | 3300048927 | Ga0496124_0238086 | Ga0496124_0238086_50_931 | 293 |
| 349 | 3300048928 | Ga0496125_0095735 | Ga0496125_0095735_91_1008 | 293 |
| 350 | 3300048929 | Ga0496126_0000013 | Ga0496126_0000013_341934_342815 | 293 |
| 351 | 3300049568 | Ga0501031_0000683 | Ga0501031_0000683_10746_11627 | 293 |
| 352 | 3300049568 | Ga0501031_0021627 | Ga0501031_0021627_2431_3312 | 293 |
| 353 | 3300049568 | Ga0501031_0025326 | Ga0501031_0025326_1394_2275 | 293 |
| 354 | 3300049568 | Ga0501031_0170514 | Ga0501031_0170514_58_939 | 293 |
| 355 | 3300049569 | Ga0501032_0000291 | Ga0501032_0000291_26920_27801 | 293 |
| 356 | 3300049569 | Ga0501032_0003455 | Ga0501032_0003455_6141_7022 | 293 |
| 357 | 3300049569 | Ga0501032_0016546 | Ga0501032_0016546_1807_2688 | 293 |
| 358 | 3300049569 | Ga0501032_0033598 | Ga0501032_0033598_2044_2925 | 293 |
| 359 | 3300049570 | Ga0501033_0004216 | Ga0501033_0004216_4332_5213 | 293 |
| 360 | 3300049570 | Ga0501033_0041878 | Ga0501033_0041878_957_1838 | 293 |
| 361 | 3300049570 | Ga0501033_0066796 | Ga0501033_0066796_1439_2320 | 293 |
| 362 | 3300049570 | Ga0501033_0073254 | Ga0501033_0073254_297_1178 | 293 |
| 363 | 3300049570 | Ga0501033_0092820 | Ga0501033_0092820_357_1274 | 293 |
| 364 | 3300049570 | Ga0501033_0116916 | Ga0501033_0116916_363_1244 | 293 |
| 365 | 3300049570 | Ga0501033_0135001 | Ga0501033_0135001_865_1746 | 293 |
| 366 | 3300049570 | Ga0501033_0333476 | Ga0501033_0333476_160_1041 | 293 |
| 367 | 3300049570 | Ga0501033_0372291 | Ga0501033_0372291_66_947 | 293 |
| 368 | 3300049571 | Ga0501034_0002462 | Ga0501034_0002462_10595_11476 | 293 |
| 369 | 3300049571 | Ga0501034_0003908 | Ga0501034_0003908_14288_15169 | 293 |
| 370 | 3300049571 | Ga0501034_0012947 | Ga0501034_0012947_4631_5512 | 293 |
| 371 | 3300049571 | Ga0501034_0064386 | Ga0501034_0064386_2585_3466 | 293 |
| 372 | 3300049571 | Ga0501034_0156592 | Ga0501034_0156592_1191_2108 | 293 |
| 373 | 3300049572 | Ga0501036_0001130 | Ga0501036_0001130_3436_4317 | 293 |
| 374 | 3300049572 | Ga0501036_0011980 | Ga0501036_0011980_1171_2052 | 293 |
| 375 | 3300049572 | Ga0501036_0050628 | Ga0501036_0050628_839_1720 | 293 |
| 376 | 3300049572 | Ga0501036_0080666 | Ga0501036_0080666_528_1409 | 293 |
| 377 | 3300049572 | Ga0501036_0202050 | Ga0501036_0202050_591_1472 | 293 |
| 378 | 3300049572 | Ga0501036_0470597 | Ga0501036_0470597_143_1024 | 293 |
| 379 | 3300049573 | Ga0501037_0000280 | Ga0501037_0000280_28174_29055 | 293 |
| 380 | 3300049573 | Ga0501037_0003181 | Ga0501037_0003181_6161_7042 | 293 |
| 381 | 3300049573 | Ga0501037_0035691 | Ga0501037_0035691_881_1762 | 293 |
| 382 | 3300049574 | Ga0501038_0000883 | Ga0501038_0000883_9338_10219 | 293 |
| 383 | 3300049574 | Ga0501038_0007461 | Ga0501038_0007461_8915_9796 | 293 |
| 384 | 3300049574 | Ga0501038_0008514 | Ga0501038_0008514_532_1413 | 293 |
| 385 | 3300049574 | Ga0501038_0030996 | Ga0501038_0030996_1531_2412 | 293 |
| 386 | 3300049574 | Ga0501038_0139693 | Ga0501038_0139693_162_1043 | 293 |
| 387 | 3300049575 | Ga0501039_0000382 | Ga0501039_0000382_12712_13593 | 293 |
| 388 | 3300049575 | Ga0501039_0039913 | Ga0501039_0039913_2077_2958 | 293 |
| 389 | 3300049575 | Ga0501039_0105769 | Ga0501039_0105769_516_1397 | 293 |
| 390 | 3300049575 | Ga0501039_0495422 | Ga0501039_0495422_22_939 | 293 |
| 391 | 3300049576 | Ga0501040_0048745 | Ga0501040_0048745_654_1535 | 293 |
| 392 | 3300049578 | Ga0501042_0063520 | Ga0501042_0063520_1699_2580 | 293 |
| 393 | 3300049579 | Ga0501043_0001643 | Ga0501043_0001643_10852_11733 | 293 |
| 394 | 3300049579 | Ga0501043_0040703 | Ga0501043_0040703_308_1225 | 293 |
| 395 | 3300049579 | Ga0501043_0203770 | Ga0501043_0203770_467_1348 | 293 |
| 396 | 3300049579 | Ga0501043_0281649 | Ga0501043_0281649_335_1216 | 293 |
| 397 | 3300049580 | Ga0501046_0000442 | Ga0501046_0000442_25799_26680 | 293 |
| 398 | 3300049580 | Ga0501046_0002177 | Ga0501046_0002177_16132_17013 | 293 |
| 399 | 3300049580 | Ga0501046_0005101 | Ga0501046_0005101_10683_11564 | 293 |
| 400 | 3300049580 | Ga0501046_0082515 | Ga0501046_0082515_1082_1963 | 293 |
| 401 | 3300049580 | Ga0501046_0202752 | Ga0501046_0202752_286_1167 | 293 |
| 402 | 3300049581 | Ga0501047_0000324 | Ga0501047_0000324_8177_9058 | 293 |
| 403 | 3300049581 | Ga0501047_0002814 | Ga0501047_0002814_13889_14770 | 293 |
| 404 | 3300049581 | Ga0501047_0046993 | Ga0501047_0046993_2530_3411 | 293 |
| 405 | 3300049581 | Ga0501047_0068160 | Ga0501047_0068160_1804_2685 | 293 |
| 406 | 3300049581 | Ga0501047_0140512 | Ga0501047_0140512_317_1198 | 293 |
| 407 | 3300049581 | Ga0501047_0169337 | Ga0501047_0169337_467_1348 | 293 |
| 408 | 3300049581 | Ga0501047_0228936 | Ga0501047_0228936_309_1190 | 293 |
| 409 | 3300049581 | Ga0501047_0398150 | Ga0501047_0398150_56_937 | 293 |
| 410 | 3300049582 | Ga0501048_0001572 | Ga0501048_0001572_1746_2627 | 293 |
| 411 | 3300049582 | Ga0501048_0002950 | Ga0501048_0002950_7266_8147 | 293 |
| 412 | 3300049582 | Ga0501048_0034114 | Ga0501048_0034114_1763_2644 | 293 |
| 413 | 3300049583 | Ga0501067_0001971 | Ga0501067_0001971_5657_6538 | 293 |
| 414 | 3300049584 | Ga0501068_0006710 | Ga0501068_0006710_1873_2754 | 293 |
| 415 | 3300049584 | Ga0501068_0050789 | Ga0501068_0050789_558_1439 | 293 |
| 416 | 3300049585 | Ga0501069_0000958 | Ga0501069_0000958_10008_10889 | 293 |
| 417 | 3300049586 | Ga0501070_0001779 | Ga0501070_0001779_2498_3379 | 293 |
| 418 | 3300049586 | Ga0501070_0003700 | Ga0501070_0003700_1031_1912 | 293 |
| 419 | 3300049586 | Ga0501070_0095456 | Ga0501070_0095456_160_1077 | 293 |
| 420 | 3300049586 | Ga0501070_0125632 | Ga0501070_0125632_1170_2051 | 293 |
| 421 | 3300049587 | Ga0501071_0013346 | Ga0501071_0013346_1333_2214 | 293 |
| 422 | 3300049589 | Ga0501073_0001462 | Ga0501073_0001462_10827_11708 | 293 |
| 423 | 3300049589 | Ga0501073_0061789 | Ga0501073_0061789_897_1814 | 293 |
| 424 | 3300049590 | Ga0501074_0000718 | Ga0501074_0000718_13476_14357 | 293 |
| 425 | 3300049590 | Ga0501074_0025457 | Ga0501074_0025457_933_1814 | 293 |
| 426 | 3300049590 | Ga0501074_0035948 | Ga0501074_0035948_2548_3429 | 293 |
| 427 | 3300049742 | Ga0501080_0001004 | Ga0501080_0001004_10591_11472 | 293 |
| 428 | 3300049743 | Ga0501081_0068201 | Ga0501081_0068201_1226_2107 | 293 |
| 429 | 3300049744 | Ga0501083_0133624 | Ga0501083_0133624_143_1024 | 293 |
| 430 | 3300049822 | Ga0501035_0000587 | Ga0501035_0000587_33518_34399 | 293 |
| 431 | 3300049822 | Ga0501035_0002957 | Ga0501035_0002957_3785_4666 | 293 |
| 432 | 3300049822 | Ga0501035_0003938 | Ga0501035_0003938_6801_7682 | 293 |
| 433 | 3300049822 | Ga0501035_0044646 | Ga0501035_0044646_1032_1913 | 293 |
| 434 | 3300049822 | Ga0501035_0130766 | Ga0501035_0130766_375_1292 | 293 |
| 435 | 3300049822 | Ga0501035_0221435 | Ga0501035_0221435_599_1480 | 293 |
| 436 | 3300049823 | Ga0501044_0000489 | Ga0501044_0000489_32872_33753 | 293 |
| 437 | 3300049823 | Ga0501044_0002104 | Ga0501044_0002104_11299_12180 | 293 |
| 438 | 3300049823 | Ga0501044_0047629 | Ga0501044_0047629_1341_2222 | 293 |
| 439 | 3300049823 | Ga0501044_0052384 | Ga0501044_0052384_1800_2681 | 293 |
| 440 | 3300049823 | Ga0501044_0083199 | Ga0501044_0083199_972_1853 | 293 |
| 441 | 3300049823 | Ga0501044_0096489 | Ga0501044_0096489_1876_2757 | 293 |
| 442 | 3300049823 | Ga0501044_0109214 | Ga0501044_0109214_981_1862 | 293 |
| 443 | 3300049823 | Ga0501044_0281213 | Ga0501044_0281213_211_1092 | 293 |
| 444 | 3300049823 | Ga0501044_0315292 | Ga0501044_0315292_524_1405 | 293 |
| 445 | 3300049824 | Ga0501045_0321595 | Ga0501045_0321595_229_1110 | 293 |
| 446 | 3300050489 | nmdc:mga03683_35546_c1 | nmdc:mga03683_35546_c1_131_1012 | 293 |
| 447 | 3300050491 | nmdc:mga00v17_187525_c1 | nmdc:mga00v17_187525_c1_90_971 | 293 |
| 448 | 3300050492 | nmdc:mga0yw44_68951_c1 | nmdc:mga0yw44_68951_c1_75_956 | 293 |
| 449 | 3300050494 | nmdc:mga06z11_2637_c1 | nmdc:mga06z11_2637_c1_4045_4986 | 293 |
| 450 | 3300050496 | nmdc:mga07m45_85883_c1 | nmdc:mga07m45_85883_c1_523_1404 | 293 |
| 451 | 3300050516 | nmdc:mga0sz30_14294_c2 | nmdc:mga0sz30_14294_c2_340_1221 | 293 |
| 452 | 3300053080 | Ga0500635_0054476 | Ga0500635_0054476_16_897 | 293 |
| 453 | 3300053104 | Ga0500556_0007981 | Ga0500556_0007981_768_1649 | 293 |
| 454 | 3300053111 | Ga0500572_070287 | Ga0500572_070287_42_923 | 293 |
| 455 | 3300053136 | Ga0500559_0019495 | Ga0500559_0019495_284_1165 | 293 |
| 456 | 3300053153 | Ga0500616_0000194 | Ga0500616_0000194_9608_10489 | 293 |
| 457 | 3300053153 | Ga0500616_0000452 | Ga0500616_0000452_34254_35138 | 293 |
| 458 | 3300053153 | Ga0500616_0032362 | Ga0500616_0032362_1388_2269 | 293 |
| 459 | 3300053730 | Ga0500645_007107 | Ga0500645_007107_365_1246 | 293 |
| 460 | 3300054114 | Ga0501084_0005680 | Ga0501084_0005680_9352_10233 | 293 |
| 461 | 3300061719 | Ga0466962_0090604 | Ga0466962_0090604_190_1071 | 293 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6s2j-assembly1.cif.gz_A | square conformation of ktra r16k mutant ring with bound atp | 0.8418 | 2 | 112 |
| 6s5d-assembly1.cif.gz_B-3 | square conformation of ktra r16a mutant ring with bound atp | 0.8348 | 2 | 111 |
| 3fwz-assembly1.cif.gz_B | crystal structure of trka-n domain of inner membrane protein ybal from escherichia coli | 0.826 | 2 | 113 |
| 4j91-assembly1.cif.gz_A-2 | diamond-shaped octameric structure of ktra with adp bound | 0.8201 | 4 | 112 |
| 4j91-assembly1.cif.gz_C-2 | diamond-shaped octameric structure of ktra with adp bound | 0.82 | 4 | 112 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q12177_1_262_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9311 | 1 | 254 | 3.40.50.720 |
| af_Q9Y7K4_1_260_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9148 | 1 | 258 | 3.40.50.720 |
| af_Q9Y7K4_1_260_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9047 | 1 | 258 | 3.40.50.720 |
| af_Q12177_1_262_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9004 | 1 | 254 | 3.40.50.720 |
| af_I1L0F6_34_211_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8618 | 2 | 72 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R1I0Y4-F1-model_v4 | Nucleoside-diphosphate-sugar epimerase | 0.9883 | 1 | 293 |
GO:0004029
GO:0005737 |
| AF-A0A4R1I0Y4-F1-model_v4 | Nucleoside-diphosphate-sugar epimerase | 0.985 | 1 | 293 |
GO:0004029
GO:0005737 |
| AF-A0A165RXV1-F1-model_v4 | Oxidoreductase | 0.9734 | 1 | 113 |
GO:0004029
GO:0005737 |
| AF-V7LA19-F1-model_v4 | deleted | 0.9725 | 1 | 147 |
|
| AF-X8BAQ2-F1-model_v4 | deleted | 0.9695 | 1 | 97 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar