F448833

General Info

Members Datasets Scaffolds Average Seq Length
461 291 422 288

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2751185782|2753271976
Length 287
Sequence ITGGTGLVGSAVVAELLGHGHSVLALARSESSAQAAAKAGAEPIRGGLADLDVLRAGCARADGVVHLAFGNDFSGPEALARCVAEEGAALATLGSELAGSDRPLVTVSGTPWVAGRPSTEADPAPTDGPVGGRGRSVTAVLGLAGVRGSAVRLPRTVHNDGAGGFAGLLTGIARRSGVSGYPGDGTQRWPAVHALDAAVLFRLALERAPAGTCWHAVADEGDRVRDIAAVIGRRLGLPVEPVPAETFGPLGPIFATDQPSSSAHTRQVLGWAPKHPSLLADLENIRP

Samples

Sample ID Description Type Environment
1 2547132424 Nocardia nova SH22a Isolate Unclassified
2 2558860280 Kutzneria sp. 744 Isolate Unclassified
3 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
4 2643221617 Nocardioides sp. Root79 Isolate Unclassified
5 2643221620 Nocardioides sp. Root240 Isolate Unclassified
6 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
7 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
8 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
9 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
10 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
11 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
12 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
13 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
14 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
15 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
16 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
17 2867428634 Streptomyces sp. RP5T Isolate Unclassified
18 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
19 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
20 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
21 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
22 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
23 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
24 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
25 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
26 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
27 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
28 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
29 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
30 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
31 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
32 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
33 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
34 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
39 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
40 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
41 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
51 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
52 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
57 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
83 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
84 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
85 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
86 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
93 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
94 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
116 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
117 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
120 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
121 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
123 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
153 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
154 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
155 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
156 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
157 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
160 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
167 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
168 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
169 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
170 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
171 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
172 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
173 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
174 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
175 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
176 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
177 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
178 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
179 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
180 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
181 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
182 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
183 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
186 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
187 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
188 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
189 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
190 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
191 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
192 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
193 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
194 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
195 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
196 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
197 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
198 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
199 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
200 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
201 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
202 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
203 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
204 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
205 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
206 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
207 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
208 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
209 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
210 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
211 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
212 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
213 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
214 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
215 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
216 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
217 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
218 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
219 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
220 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
221 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
222 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
235 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
236 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
237 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
238 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
239 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
240 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
241 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
242 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
243 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
258 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
259 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
260 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
261 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
262 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
263 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
264 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
265 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
266 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
267 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
270 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
271 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
272 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
273 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
274 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
275 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
276 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
277 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
278 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
279 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
280 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
281 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
282 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
283 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
284 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
285 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
286 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
287 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
288 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
289 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
290 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
291 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.11
Metatranscriptomes 0.43
Isolates 8.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.94
Nodule 0
Rhizoplane 2.82
Rhizosphere 80.91
Stem 0
Stem Tuber 0.22
Unclassified 9.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055540_1000435 3300003792 Bacteria 33153
2 Ga0055540_1003095 3300003792 Bacteria 8265
3 Ga0070658_10097396 3300005327 Bacteria 2429
4 Ga0070683_100036644 3300005329 Bacteria 4489
5 Ga0068869_100299699 3300005334 Bacteria 1297
6 Ga0068869_100469986 3300005334 Bacteria 1045
7 Ga0070666_10061494 3300005335 Bacteria 2543
8 Ga0070680_100478268 3300005336 Bacteria 1065
9 Ga0070682_100204259 3300005337 Bacteria 1396
10 Ga0068868_100046983 3300005338 Bacteria 3380
11 Ga0070660_100112573 3300005339 Bacteria 2166
12 Ga0070689_100022131 3300005340 Bacteria 4744
13 Ga0070668_100145240 3300005347 Bacteria 1914
14 Ga0070675_100074541 3300005354 Bacteria 2819
15 Ga0070671_100082030 3300005355 Bacteria 2696
16 Ga0070673_100137699 3300005364 Bacteria 2057
17 Ga0070688_100251680 3300005365 Bacteria 1258
18 Ga0070667_100242815 3300005367 Bacteria 1609
19 Ga0070667_100360952 3300005367 Bacteria 1317
20 Ga0070703_10052181 3300005406 Bacteria 1311
21 Ga0070713_100035763 3300005436 Bacteria 4002
22 Ga0070713_100091072 3300005436 Bacteria 2623
23 Ga0070713_100195880 3300005436 Bacteria 1822
24 Ga0070713_100251935 3300005436 Bacteria 1611
25 Ga0070708_100049924 3300005445 Bacteria 3703
26 Ga0070663_100106951 3300005455 Bacteria 2096
27 Ga0070678_100033207 3300005456 Bacteria 3580
28 Ga0070681_10176949 3300005458 Bacteria 2056
29 Ga0070706_100010530 3300005467 Bacteria 8584
30 Ga0070707_100009737 3300005468 Bacteria 8933
31 Ga0070699_100005493 3300005518 Bacteria 11115
32 Ga0070679_100057296 3300005530 Bacteria 3884
33 Ga0070684_100246815 3300005535 Bacteria 1631
34 Ga0070697_100001576 3300005536 Bacteria 17387
35 Ga0068853_100100724 3300005539 Bacteria 2554
36 Ga0070686_100034838 3300005544 Bacteria 3105
37 Ga0070695_100071965 3300005545 Bacteria 2265
38 Ga0070704_100240391 3300005549 Bacteria 1481
39 Ga0068855_100003376 3300005563 Bacteria 19559
40 Ga0068855_100025362 3300005563 Bacteria 7094
41 Ga0068855_100099058 3300005563 Bacteria 3357
42 Ga0068855_100409243 3300005563 Bacteria 1485
43 Ga0068857_100324440 3300005577 Bacteria 1422
44 Ga0068854_100047610 3300005578 Bacteria 3056
45 Ga0068856_100045695 3300005614 Bacteria 4313
46 Ga0070702_100148533 3300005615 Bacteria 1501
47 Ga0068852_100032655 3300005616 Bacteria 4312
48 Ga0068859_100303622 3300005617 Bacteria 1690
49 Ga0068864_100053423 3300005618 Bacteria 3485
50 Ga0068851_10170971 3300005834 Bacteria 1199
51 Ga0068863_100073415 3300005841 Bacteria 3236
52 Ga0068858_100032185 3300005842 Bacteria 4871
53 Ga0068860_100343671 3300005843 Bacteria 1467
54 Ga0068860_100837466 3300005843 Bacteria 934
55 Ga0068862_100298352 3300005844 Bacteria 1482
56 Ga0081455_10080171 3300005937 Bacteria 2677
57 Ga0081540_1000790 3300005983 Bacteria 29061
58 Ga0081540_1003466 3300005983 Bacteria 12452
59 Ga0070717_10161747 3300006028 Bacteria 1942
60 Ga0070717_10171564 3300006028 Bacteria 1887
61 Ga0075365_10002423 3300006038 Bacteria 9143
62 Ga0075365_10224930 3300006038 Bacteria 1317
63 Ga0075368_10017945 3300006042 Bacteria 2654
64 Ga0075364_10125988 3300006051 Bacteria 1717
65 Ga0070715_10013470 3300006163 Bacteria 3005
66 Ga0075362_10061131 3300006177 Bacteria 1704
67 Ga0075367_10011264 3300006178 Bacteria 4724
68 Ga0075369_10017486 3300006186 Bacteria 2907
69 Ga0097621_100015778 3300006237 Bacteria 5694
70 Ga0075370_10015200 3300006353 Bacteria 4116
71 Ga0097620_100303600 3300006931 Bacteria 1690
72 Ga0105251_10057916 3300009011 Bacteria 1830
73 Ga0105244_10083774 3300009036 Bacteria 1575
74 Ga0105250_10024368 3300009092 Bacteria 2438
75 Ga0105240_10235488 3300009093 Bacteria 2125
76 Ga0105245_10288440 3300009098 Bacteria 1607
77 Ga0105247_10091138 3300009101 Bacteria 1935
78 Ga0105243_10033043 3300009148 Bacteria 3999
79 Ga0105241_10039310 3300009174 Bacteria 3568
80 Ga0105241_10373710 3300009174 Bacteria 1243
81 Ga0105242_10237943 3300009176 Bacteria 1635
82 Ga0105248_10297482 3300009177 Bacteria 1817
83 Ga0105237_10172147 3300009545 Bacteria 2165
84 Ga0105238_10041980 3300009551 Bacteria 4632
85 Ga0105249_10170553 3300009553 Bacteria 2109
86 Ga0105246_10040418 3300011119 Bacteria 3147
87 Ga0105246_10100767 3300011119 Bacteria 2102
88 Ga0157373_10064245 3300013100 Bacteria 2598
89 Ga0157369_10043158 3300013105 Bacteria 4916
90 Ga0157374_10011788 3300013296 Bacteria 7585
91 Ga0157378_10032184 3300013297 Bacteria 4633
92 Ga0163162_10450674 3300013306 Bacteria 1419
93 Ga0157372_10083083 3300013307 Bacteria 3628
94 Ga0163163_10366436 3300014325 Bacteria 1498
95 Ga0157377_10038037 3300014745 Bacteria 2655
96 Ga0157379_10190659 3300014968 Bacteria 1852
97 Ga0183367_1014 3300015688 Bacteria 330534
98 Ga0213875_10100744 3300021388 Bacteria 1348
99 Ga0224712_10082843 3300022467 Bacteria 1328
100 Ga0209563_100519 3300025230 Bacteria 13078
101 Ga0207427_101265 3300025231 Bacteria 9681
102 Ga0209233_1000658 3300025261 Bacteria 16772
103 Ga0209673_1011811 3300025273 Bacteria 3572
104 Ga0209758_1006582 3300025297 Bacteria 8247
105 Ga0209051_1000421 3300025303 Bacteria 58306
106 Ga0209051_1001622 3300025303 Bacteria 18338
107 Ga0207692_10059027 3300025898 Bacteria 1979
108 Ga0207680_10141885 3300025903 Bacteria 1593
109 Ga0207699_10011395 3300025906 Bacteria 4489
110 Ga0207699_10119370 3300025906 Bacteria 1703
111 Ga0207643_10019236 3300025908 Bacteria 3742
112 Ga0207707_10163229 3300025912 Bacteria 1947
113 Ga0207695_10354065 3300025913 Bacteria 1355
114 Ga0207671_10336541 3300025914 Bacteria 1196
115 Ga0207662_10252303 3300025918 Bacteria 1158
116 Ga0207649_10188626 3300025920 Bacteria 1448
117 Ga0207646_10004151 3300025922 Bacteria 15891
118 Ga0207687_10100043 3300025927 Bacteria 2132
119 Ga0207700_10015055 3300025928 Bacteria 5088
120 Ga0207700_10319508 3300025928 Bacteria 1345
121 Ga0207700_10477978 3300025928 Bacteria 1101
122 Ga0207664_10163337 3300025929 Bacteria 1901
123 Ga0207664_10201756 3300025929 Bacteria 1717
124 Ga0207686_10169384 3300025934 Bacteria 1539
125 Ga0207689_10025785 3300025942 Bacteria 4926
126 Ga0207667_10001432 3300025949 Bacteria 29907
127 Ga0207667_10060399 3300025949 Bacteria 3968
128 Ga0207651_10281284 3300025960 Bacteria 1375
129 Ga0207640_10198591 3300025981 Bacteria 1518
130 Ga0207658_10273475 3300025986 Bacteria 1445
131 Ga0207678_10013005 3300026067 Bacteria 7303
132 Ga0207678_10279312 3300026067 Bacteria 1433
133 Ga0207702_10032985 3300026078 Bacteria 4323
134 Ga0207702_10073161 3300026078 Bacteria 2955
135 Ga0207641_10406929 3300026088 Bacteria 1307
136 Ga0207676_10436518 3300026095 Bacteria 1231
137 Ga0207674_10476440 3300026116 Bacteria 1206
138 Ga0207675_100016519 3300026118 Bacteria 6892
139 Ga0207683_10076992 3300026121 Bacteria 2954
140 Ga0209371_1007100 3300027312 Bacteria 3979
141 Ga0268264_10106162 3300028381 Bacteria 2451
142 Ga0268264_10112101 3300028381 Bacteria 2391
143 Ga0268256_1009322 3300030500 Bacteria 3276
144 Ga0307512_10008400 3300030522 Bacteria 10071
145 Ga0265340_10008815 3300031247 Bacteria 5436
146 Ga0307513_10149627 3300031456 Bacteria 2246
147 Ga0307516_10000196 3300031730 Bacteria 78480
148 Ga0307516_10001511 3300031730 Bacteria 32004
149 Ga0307518_10001212 3300031838 Bacteria 19320
150 Ga0307415_100454956 3300032126 Bacteria 1108
151 Ga0373960_0044876 3300035121 Bacteria 1292
152 Ga0372808_004443 3300036459 Bacteria 1791
153 Ga0373925_0000009 3300037068 Bacteria 243099
154 Ga0373925_0003432 3300037068 Bacteria 12268
155 Ga0373925_0037435 3300037068 Bacteria 3582
156 Ga0395899_0108460 3300037312 Bacteria 1998
157 Ga0395898_0021115 3300037466 Bacteria 6605
158 Ga0395898_0132061 3300037466 Bacteria 2391
159 Ga0436364_0344289 3300037853 Bacteria 1931
160 Ga0436364_1150670 3300037853 Bacteria 4032
161 Ga0436364_1388430 3300037853 Bacteria 3262
162 Ga0395901_0020545 3300038443 Bacteria 6759
163 Ga0395901_0272097 3300038443 Bacteria 1761
164 Ga0436365_0674342 3300039437 Bacteria 3629
165 Ga0451851_1126265 3300041507 Bacteria 991
166 Ga0451853_0405826 3300041512 Bacteria 2479
167 Ga0450903_014030 3300042138 Bacteria 1270
168 Ga0466969_0013883 3300044656 Bacteria 4239
169 Ga0466969_0046494 3300044656 Bacteria 2152
170 Ga0466972_0012320 3300044658 Bacteria 4297
171 Ga0466972_0047127 3300044658 Bacteria 2085
172 Ga0466972_0054583 3300044658 Bacteria 1922
173 Ga0466965_0000003 3300044683 Bacteria 265985
174 Ga0466966_0001900 3300044684 Bacteria 13568
175 Ga0466966_0009848 3300044684 Bacteria 6334
176 Ga0466966_0013957 3300044684 Bacteria 5318
177 Ga0466966_0082716 3300044684 Bacteria 1998
178 Ga0466966_0195224 3300044684 Bacteria 1226
179 Ga0466966_0224010 3300044684 Bacteria 1135
180 Ga0466961_0003641 3300044693 Bacteria 9603
181 Ga0466961_0009075 3300044693 Bacteria 6341
182 Ga0466961_0062207 3300044693 Bacteria 2372
183 Ga0466963_0000223 3300044694 Bacteria 24157
184 Ga0466963_0035035 3300044694 Bacteria 3269
185 Ga0466963_0151612 3300044694 Bacteria 1610
186 Ga0466964_0008164 3300044706 Bacteria 3930
187 Ga0466971_0000703 3300044719 Bacteria 13361
188 Ga0466968_0013764 3300044735 Bacteria 3184
189 Ga0466970_0000009 3300044765 Bacteria 99007
190 Ga0466970_0007064 3300044765 Bacteria 5617
191 Ga0466970_0011352 3300044765 Bacteria 4541
192 Ga0466970_0146100 3300044765 Bacteria 1304
193 Ga0466957_0002013 3300044842 Bacteria 10829
194 Ga0466957_0039989 3300044842 Bacteria 2831
195 Ga0466957_0084616 3300044842 Bacteria 1980
196 Ga0466957_0099157 3300044842 Bacteria 1834
197 Ga0466957_0227326 3300044842 Bacteria 1234
198 Ga0466957_0279187 3300044842 Bacteria 1118
199 Ga0466960_0038183 3300044901 Bacteria 2256
200 Ga0466960_0045544 3300044901 Bacteria 2096
201 Ga0466959_0010395 3300045049 Bacteria 6650
202 Ga0466959_0129009 3300045049 Bacteria 1793
203 Ga0466958_0003012 3300045836 Bacteria 8628
204 Ga0466958_0037927 3300045836 Bacteria 2889
205 Ga0466958_0168473 3300045836 Bacteria 1386
206 Ga0466967_0000668 3300045976 Bacteria 17336
207 Ga0466967_0008301 3300045976 Bacteria 7593
208 Ga0466967_0157373 3300045976 Bacteria 2130
209 Ga0495592_0031358 3300046454 Bacteria 4017
210 Ga0495638_0098814 3300046460 Bacteria 1748
211 Ga0495651_0013140 3300046462 Bacteria 6401
212 Ga0495653_0018615 3300046463 Bacteria 5637
213 Ga0495653_0041299 3300046463 Bacteria 3601
214 Ga0495662_0000138 3300046476 Bacteria 28025
215 Ga0495607_0021753 3300046501 Bacteria 4033
216 Ga0495608_0003041 3300046511 Bacteria 11979
217 Ga0495608_0017154 3300046511 Bacteria 5012
218 Ga0495618_0029775 3300046514 Bacteria 3406
219 Ga0495618_0123203 3300046514 Bacteria 1660
220 Ga0495620_0013679 3300046515 Bacteria 4148
221 Ga0495628_0010911 3300046516 Bacteria 7693
222 Ga0495628_0015680 3300046516 Bacteria 6326
223 Ga0495628_0086329 3300046516 Bacteria 2433
224 Ga0495630_0009122 3300046517 Bacteria 7133
225 Ga0495630_0112414 3300046517 Bacteria 2063
226 Ga0495643_0023665 3300046522 Bacteria 3489
227 Ga0495648_0127908 3300046524 Bacteria 1355
228 Ga0495666_0001201 3300046526 Bacteria 12505
229 Ga0495652_0006115 3300046529 Bacteria 11252
230 Ga0495665_0005254 3300046531 Bacteria 6979
231 Ga0495587_0035577 3300046536 Bacteria 2999
232 Ga0495645_0092642 3300046543 Bacteria 2158
233 Ga0495645_0232096 3300046543 Bacteria 1236
234 Ga0495667_0002865 3300046559 Bacteria 11547
235 Ga0495667_0103000 3300046559 Bacteria 1846
236 Ga0495668_0042456 3300046616 Bacteria 2532
237 Ga0495634_0026169 3300046642 Bacteria 4073
238 Ga0495634_0072450 3300046642 Bacteria 2266
239 Ga0495657_0000530 3300046675 Bacteria 35507
240 Ga0495657_0006238 3300046675 Bacteria 9346
241 Ga0495613_0002177 3300046689 Bacteria 14834
242 Ga0495613_0005407 3300046689 Bacteria 9595
243 Ga0495649_0139278 3300046694 Bacteria 1278
244 Ga0495589_0075287 3300046794 Bacteria 1646
245 Ga0495600_0001586 3300046809 Bacteria 12637
246 Ga0495581_0009106 3300047315 Bacteria 5743
247 Ga0495604_0001662 3300047317 Bacteria 18301
248 Ga0495604_0008353 3300047317 Bacteria 8187
249 Ga0495604_0143388 3300047317 Bacteria 1704
250 Ga0495674_0043678 3300047319 Bacteria 3988
251 Ga0495672_0221689 3300047320 Bacteria 933
252 Ga0495680_0078541 3300047322 Bacteria 2498
253 Ga0495683_0035675 3300047323 Bacteria 2527
254 Ga0495687_014284 3300047443 Bacteria 4094
255 Ga0495675_0030115 3300047444 Bacteria 3463
256 Ga0495685_011272 3300047447 Bacteria 3012
257 Ga0495684_0058153 3300047471 Bacteria 2945
258 Ga0495684_0059431 3300047471 Bacteria 2911
259 Ga0495602_0246093 3300048088 Bacteria 1335
260 Ga0495614_0026488 3300048089 Bacteria 2499
261 Ga0496101_0112222 3300048904 Bacteria 2053
262 Ga0496102_0323988 3300048905 Bacteria 1451
263 Ga0496104_0458426 3300048907 Bacteria 1186
264 Ga0496105_0030047 3300048908 Bacteria 4451
265 Ga0496105_0164830 3300048908 Bacteria 1818
266 Ga0496106_0031753 3300048909 Bacteria 3935
267 Ga0496107_0034271 3300048910 Bacteria 3636
268 Ga0496108_0000677 3300048911 Bacteria 26362
269 Ga0496109_0001466 3300048912 Bacteria 19576
270 Ga0496111_0060797 3300048914 Bacteria 2738
271 Ga0496113_0295892 3300048916 Bacteria 1296
272 Ga0496114_0000292 3300048917 Bacteria 36655
273 Ga0496114_0163463 3300048917 Bacteria 1937
274 Ga0496117_0002488 3300048920 Bacteria 23114
275 Ga0496119_0000053 3300048922 Bacteria 182875
276 Ga0496120_0003005 3300048923 Bacteria 15993
277 Ga0496121_0110546 3300048924 Bacteria 2097
278 Ga0496122_0008671 3300048925 Bacteria 10904
279 Ga0496123_0023329 3300048926 Bacteria 4737
280 Ga0496124_0005861 3300048927 Bacteria 13621
281 Ga0496124_0238086 3300048927 Bacteria 1355
282 Ga0496125_0095735 3300048928 Bacteria 2207
283 Ga0496126_0000013 3300048929 Bacteria 690046
284 Ga0496126_0224753 3300048929 Bacteria 1575
285 Ga0501031_0000683 3300049568 Bacteria 20253
286 Ga0501031_0021627 3300049568 Bacteria 4193
287 Ga0501031_0025326 3300049568 Bacteria 3871
288 Ga0501031_0170514 3300049568 Bacteria 1422
289 Ga0501032_0000291 3300049569 Bacteria 42013
290 Ga0501032_0003455 3300049569 Bacteria 12108
291 Ga0501032_0003744 3300049569 Bacteria 11532
292 Ga0501032_0016546 3300049569 Bacteria 5186
293 Ga0501032_0033598 3300049569 Bacteria 3513
294 Ga0501033_0003237 3300049570 Bacteria 13474
295 Ga0501033_0004216 3300049570 Bacteria 11568
296 Ga0501033_0041878 3300049570 Bacteria 3415
297 Ga0501033_0066796 3300049570 Bacteria 2644
298 Ga0501033_0073254 3300049570 Bacteria 2514
299 Ga0501033_0092820 3300049570 Bacteria 2207
300 Ga0501033_0116916 3300049570 Bacteria 1937
301 Ga0501033_0135001 3300049570 Bacteria 1785
302 Ga0501033_0138414 3300049570 Bacteria 1761
303 Ga0501033_0333476 3300049570 Bacteria 1064
304 Ga0501033_0372291 3300049570 Bacteria 998
305 Ga0501034_0002462 3300049571 Bacteria 22323
306 Ga0501034_0003908 3300049571 Bacteria 16740
307 Ga0501034_0012947 3300049571 Bacteria 8598
308 Ga0501034_0013399 3300049571 Bacteria 8440
309 Ga0501034_0030218 3300049571 Bacteria 5506
310 Ga0501034_0064386 3300049571 Bacteria 3680
311 Ga0501034_0156592 3300049571 Bacteria 2251
312 Ga0501036_0001130 3300049572 Bacteria 20310
313 Ga0501036_0005006 3300049572 Bacteria 10723
314 Ga0501036_0011980 3300049572 Bacteria 7188
315 Ga0501036_0050628 3300049572 Bacteria 3517
316 Ga0501036_0080666 3300049572 Bacteria 2750
317 Ga0501036_0202050 3300049572 Bacteria 1671
318 Ga0501036_0470597 3300049572 Bacteria 1046
319 Ga0501037_0000280 3300049573 Bacteria 43512
320 Ga0501037_0003181 3300049573 Bacteria 11918
321 Ga0501037_0035691 3300049573 Bacteria 3665
322 Ga0501037_0086665 3300049573 Bacteria 2266
323 Ga0501037_0091824 3300049573 Bacteria 2196
324 Ga0501038_0000883 3300049574 Bacteria 26567
325 Ga0501038_0001682 3300049574 Bacteria 20489
326 Ga0501038_0007461 3300049574 Bacteria 10090
327 Ga0501038_0008514 3300049574 Bacteria 9424
328 Ga0501038_0030996 3300049574 Bacteria 4727
329 Ga0501038_0038095 3300049574 Bacteria 4211
330 Ga0501038_0139693 3300049574 Bacteria 1983
331 Ga0501039_0000382 3300049575 Bacteria 31795
332 Ga0501039_0038913 3300049575 Bacteria 3673
333 Ga0501039_0039913 3300049575 Bacteria 3624
334 Ga0501039_0105769 3300049575 Bacteria 2197
335 Ga0501039_0495422 3300049575 Bacteria 959
336 Ga0501040_0048745 3300049576 Bacteria 2895
337 Ga0501042_0063520 3300049578 Bacteria 2639
338 Ga0501042_0266628 3300049578 Bacteria 1236
339 Ga0501043_0001643 3300049579 Bacteria 19416
340 Ga0501043_0003778 3300049579 Bacteria 12443
341 Ga0501043_0040703 3300049579 Bacteria 3652
342 Ga0501043_0203770 3300049579 Bacteria 1534
343 Ga0501043_0281649 3300049579 Bacteria 1274
344 Ga0501046_0000442 3300049580 Bacteria 41660
345 Ga0501046_0002177 3300049580 Bacteria 18499
346 Ga0501046_0005101 3300049580 Bacteria 11782
347 Ga0501046_0082515 3300049580 Bacteria 2482
348 Ga0501046_0202752 3300049580 Bacteria 1475
349 Ga0501047_0000324 3300049581 Bacteria 55265
350 Ga0501047_0002814 3300049581 Bacteria 16515
351 Ga0501047_0006102 3300049581 Bacteria 11324
352 Ga0501047_0046993 3300049581 Bacteria 4171
353 Ga0501047_0064122 3300049581 Bacteria 3543
354 Ga0501047_0068160 3300049581 Bacteria 3427
355 Ga0501047_0140512 3300049581 Bacteria 2293
356 Ga0501047_0169337 3300049581 Bacteria 2053
357 Ga0501047_0228936 3300049581 Bacteria 1713
358 Ga0501047_0398150 3300049581 Bacteria 1210
359 Ga0501048_0001572 3300049582 Bacteria 17352
360 Ga0501048_0002950 3300049582 Bacteria 13002
361 Ga0501048_0032408 3300049582 Bacteria 3776
362 Ga0501048_0034114 3300049582 Bacteria 3674
363 Ga0501067_0001971 3300049583 Bacteria 11307
364 Ga0501068_0006710 3300049584 Bacteria 6360
365 Ga0501068_0050789 3300049584 Bacteria 2507
366 Ga0501069_0000958 3300049585 Bacteria 13759
367 Ga0501070_0001779 3300049586 Bacteria 19037
368 Ga0501070_0003700 3300049586 Bacteria 13210
369 Ga0501070_0051009 3300049586 Bacteria 3434
370 Ga0501070_0095456 3300049586 Bacteria 2460
371 Ga0501070_0125632 3300049586 Bacteria 2120
372 Ga0501071_0013346 3300049587 Bacteria 5597
373 Ga0501073_0001462 3300049589 Bacteria 17490
374 Ga0501073_0040042 3300049589 Bacteria 3319
375 Ga0501073_0061789 3300049589 Bacteria 2613
376 Ga0501074_0000718 3300049590 Bacteria 20753
377 Ga0501074_0025457 3300049590 Bacteria 4298
378 Ga0501074_0035948 3300049590 Bacteria 3589
379 Ga0501074_0091745 3300049590 Bacteria 2175
380 Ga0501080_0001004 3300049742 Bacteria 23167
381 Ga0501080_0105326 3300049742 Bacteria 2615
382 Ga0501081_0068201 3300049743 Bacteria 2476
383 Ga0501083_0133624 3300049744 Bacteria 1626
384 Ga0501035_0000587 3300049822 Bacteria 40047
385 Ga0501035_0002957 3300049822 Bacteria 16341
386 Ga0501035_0003938 3300049822 Bacteria 14157
387 Ga0501035_0044646 3300049822 Bacteria 3990
388 Ga0501035_0093753 3300049822 Bacteria 2641
389 Ga0501035_0130766 3300049822 Bacteria 2188
390 Ga0501035_0221435 3300049822 Bacteria 1615
391 Ga0501044_0000489 3300049823 Bacteria 48052
392 Ga0501044_0002104 3300049823 Bacteria 22907
393 Ga0501044_0047629 3300049823 Bacteria 4433
394 Ga0501044_0052384 3300049823 Bacteria 4205
395 Ga0501044_0056027 3300049823 Bacteria 4047
396 Ga0501044_0083199 3300049823 Bacteria 3237
397 Ga0501044_0096489 3300049823 Bacteria 2978
398 Ga0501044_0109214 3300049823 Bacteria 2775
399 Ga0501044_0281213 3300049823 Bacteria 1597
400 Ga0501044_0315292 3300049823 Bacteria 1489
401 Ga0501044_0503637 3300049823 Bacteria 1112
402 Ga0501045_0102395 3300049824 Bacteria 2120
403 Ga0501045_0321595 3300049824 Bacteria 1151
404 nmdc:mga03683_35546_c1 3300050489 Bacteria 2021
405 nmdc:mga00v17_187525_c1 3300050491 Bacteria 1335
406 nmdc:mga0yw44_68951_c1 3300050492 Bacteria 2189
407 nmdc:mga06z11_2637_c1 3300050494 Bacteria 6873
408 nmdc:mga07m45_85883_c1 3300050496 Bacteria 1799
409 nmdc:mga0sz30_14294_c2 3300050516 Bacteria 2710
410 Ga0495601_0018824 3300053077 Bacteria 4206
411 Ga0500635_0054476 3300053080 Bacteria 1379
412 Ga0495619_0018154 3300053085 Bacteria 4461
413 Ga0500556_0007981 3300053104 Bacteria 3041
414 Ga0500572_070287 3300053111 Bacteria 1081
415 Ga0500559_0019495 3300053136 Bacteria 2866
416 Ga0500600_0124888 3300053149 Bacteria 1320
417 Ga0500616_0000194 3300053153 Bacteria 99376
418 Ga0500616_0000452 3300053153 Bacteria 53746
419 Ga0500616_0032362 3300053153 Bacteria 2859
420 Ga0500645_007107 3300053730 Bacteria 3933
421 Ga0501084_0005680 3300054114 Bacteria 10243
422 Ga0466962_0090604 3300061719 Bacteria 1465

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047320 Ga0495672_0221689 Ga0495672_0221689_67_834 246
2 3300005445 Ga0070708_100049924 Ga0070708_1000499242 253
3 3300005467 Ga0070706_100010530 Ga0070706_1000105305 253
4 3300005468 Ga0070707_100009737 Ga0070707_1000097377 253
5 3300005518 Ga0070699_100005493 Ga0070699_1000054935 253
6 3300005536 Ga0070697_100001576 Ga0070697_1000015766 253
7 3300025922 Ga0207646_10004151 Ga0207646_100041516 253
8 3300046460 Ga0495638_0098814 Ga0495638_0098814_288_1169 253
9 3300049571 Ga0501034_0030218 Ga0501034_0030218_1959_2840 254
10 3300049572 Ga0501036_0005006 Ga0501036_0005006_3495_4376 254
11 3300049573 Ga0501037_0091824 Ga0501037_0091824_377_1258 254
12 3300049574 Ga0501038_0001682 Ga0501038_0001682_9818_10699 254
13 3300049575 Ga0501039_0038913 Ga0501039_0038913_537_1418 254
14 3300049578 Ga0501042_0266628 Ga0501042_0266628_154_1035 254
15 3300049579 Ga0501043_0003778 Ga0501043_0003778_1680_2561 254
16 3300049581 Ga0501047_0006102 Ga0501047_0006102_9725_10606 254
17 3300049589 Ga0501073_0040042 Ga0501073_0040042_76_957 254
18 3300049590 Ga0501074_0091745 Ga0501074_0091745_267_1148 254
19 3300049823 Ga0501044_0056027 Ga0501044_0056027_1566_2447 254
20 3300046543 Ga0495645_0232096 Ga0495645_0232096_262_1143 257
21 3300005334 Ga0068869_100469986 Ga0068869_1004699861 258
22 3300005843 Ga0068860_100837466 Ga0068860_1008374661 258
23 3300044735 Ga0466968_0013764 Ga0466968_0013764_431_1312 259
24 3300005436 Ga0070713_100195880 Ga0070713_1001958801 261
25 3300013105 Ga0157369_10043158 Ga0157369_100431584 261
26 3300005436 Ga0070713_100091072 Ga0070713_1000910722 262
27 3300025906 Ga0207699_10119370 Ga0207699_101193702 262
28 3300037068 Ga0373925_0000009 Ga0373925_0000009_32048_32857 262
29 3300044656 Ga0466969_0013883 Ga0466969_0013883_2010_2891 262
30 3300044684 Ga0466966_0195224 Ga0466966_0195224_86_970 262
31 3300044694 Ga0466963_0035035 Ga0466963_0035035_1783_2667 262
32 3300046454 Ga0495592_0031358 Ga0495592_0031358_1920_2837 262
33 3300046463 Ga0495653_0018615 Ga0495653_0018615_836_1753 262
34 3300046476 Ga0495662_0000138 Ga0495662_0000138_4714_5631 262
35 3300046511 Ga0495608_0003041 Ga0495608_0003041_4876_5793 262
36 3300046516 Ga0495628_0015680 Ga0495628_0015680_725_1642 262
37 3300046517 Ga0495630_0009122 Ga0495630_0009122_4430_5347 262
38 3300046526 Ga0495666_0001201 Ga0495666_0001201_10821_11738 262
39 3300046531 Ga0495665_0005254 Ga0495665_0005254_2963_3880 262
40 3300046536 Ga0495587_0035577 Ga0495587_0035577_641_1558 262
41 3300046559 Ga0495667_0002865 Ga0495667_0002865_6201_7118 262
42 3300046642 Ga0495634_0026169 Ga0495634_0026169_739_1656 262
43 3300046675 Ga0495657_0006238 Ga0495657_0006238_6215_7132 262
44 3300046689 Ga0495613_0002177 Ga0495613_0002177_4430_5347 262
45 3300047315 Ga0495581_0009106 Ga0495581_0009106_2344_3261 262
46 3300047317 Ga0495604_0001662 Ga0495604_0001662_16263_17180 262
47 3300047444 Ga0495675_0030115 Ga0495675_0030115_760_1677 262
48 3300047471 Ga0495684_0058153 Ga0495684_0058153_566_1483 262
49 3300053077 Ga0495601_0018824 Ga0495601_0018824_2352_3269 262
50 3300053085 Ga0495619_0018154 Ga0495619_0018154_396_1313 262
51 3300048929 Ga0496126_0224753 Ga0496126_0224753_476_1357 264
52 3300005327 Ga0070658_10097396 Ga0070658_100973962 266
53 3300005563 Ga0068855_100409243 Ga0068855_1004092431 266
54 3300005436 Ga0070713_100035763 Ga0070713_1000357632 269
55 3300006028 Ga0070717_10171564 Ga0070717_101715642 269
56 3300025928 Ga0207700_10319508 Ga0207700_103195082 269
57 3300036459 Ga0372808_004443 Ga0372808_004443_241_1122 270
58 3300053149 Ga0500600_0124888 Ga0500600_0124888_269_1150 273
59 3300026067 Ga0207678_10013005 Ga0207678_100130054 275
60 3300048923 Ga0496120_0003005 Ga0496120_0003005_5652_6545 276
61 3300048920 Ga0496117_0002488 Ga0496117_0002488_2024_2905 277
62 3300005367 Ga0070667_100360952 Ga0070667_1003609521 279
63 3300025986 Ga0207658_10273475 Ga0207658_102734752 279
64 3300049570 Ga0501033_0003237 Ga0501033_0003237_5132_6013 281
65 3300046694 Ga0495649_0139278 Ga0495649_0139278_301_1182 282
66 3300049570 Ga0501033_0138414 Ga0501033_0138414_762_1643 282
67 3300038443 Ga0395901_0020545 Ga0395901_0020545_4909_5790 283
68 3300045976 Ga0466967_0008301 Ga0466967_0008301_229_1110 283
69 3300005436 Ga0070713_100251935 Ga0070713_1002519351 284
70 3300046515 Ga0495620_0013679 Ga0495620_0013679_2468_3349 284
71 3300046522 Ga0495643_0023665 Ga0495643_0023665_806_1687 284
72 3300046616 Ga0495668_0042456 Ga0495668_0042456_38_919 284
73 3300046794 Ga0495589_0075287 Ga0495589_0075287_727_1608 284
74 3300047443 Ga0495687_014284 Ga0495687_014284_2810_3691 284
75 3300047447 Ga0495685_011272 Ga0495685_011272_29_910 284
76 3300026116 Ga0207674_10476440 Ga0207674_104764401 286
77 3300032126 Ga0307415_100454956 Ga0307415_1004549561 286
78 3300047319 Ga0495674_0043678 Ga0495674_0043678_1101_1982 286
79 iso_pu_bacteria 2751185782 2753271976 287
80 3300005329 Ga0070683_100036644 Ga0070683_1000366443 288
81 3300005334 Ga0068869_100299699 Ga0068869_1002996991 288
82 3300005335 Ga0070666_10061494 Ga0070666_100614942 288
83 3300005338 Ga0068868_100046983 Ga0068868_1000469832 288
84 3300005339 Ga0070660_100112573 Ga0070660_1001125732 288
85 3300005340 Ga0070689_100022131 Ga0070689_1000221314 288
86 3300005354 Ga0070675_100074541 Ga0070675_1000745413 288
87 3300005355 Ga0070671_100082030 Ga0070671_1000820304 288
88 3300005364 Ga0070673_100137699 Ga0070673_1001376991 288
89 3300005365 Ga0070688_100251680 Ga0070688_1002516802 288
90 3300005367 Ga0070667_100242815 Ga0070667_1002428151 288
91 3300005406 Ga0070703_10052181 Ga0070703_100521811 288
92 3300005456 Ga0070678_100033207 Ga0070678_1000332071 288
93 3300005458 Ga0070681_10176949 Ga0070681_101769492 288
94 3300005535 Ga0070684_100246815 Ga0070684_1002468151 288
95 3300005539 Ga0068853_100100724 Ga0068853_1001007242 288
96 3300005544 Ga0070686_100034838 Ga0070686_1000348382 288
97 3300005545 Ga0070695_100071965 Ga0070695_1000719651 288
98 3300005549 Ga0070704_100240391 Ga0070704_1002403911 288
99 3300005563 Ga0068855_100099058 Ga0068855_1000990584 288
100 3300005577 Ga0068857_100324440 Ga0068857_1003244401 288
101 3300005578 Ga0068854_100047610 Ga0068854_1000476102 288
102 3300005615 Ga0070702_100148533 Ga0070702_1001485331 288
103 3300005616 Ga0068852_100032655 Ga0068852_1000326552 288
104 3300005617 Ga0068859_100303622 Ga0068859_1003036222 288
105 3300005618 Ga0068864_100053423 Ga0068864_1000534234 288
106 3300005834 Ga0068851_10170971 Ga0068851_101709711 288
107 3300005841 Ga0068863_100073415 Ga0068863_1000734152 288
108 3300005842 Ga0068858_100032185 Ga0068858_1000321855 288
109 3300005843 Ga0068860_100343671 Ga0068860_1003436712 288
110 3300005844 Ga0068862_100298352 Ga0068862_1002983522 288
111 3300006163 Ga0070715_10013470 Ga0070715_100134702 288
112 3300006237 Ga0097621_100015778 Ga0097621_1000157782 288
113 3300006931 Ga0097620_100303600 Ga0097620_1003036002 288
114 3300009011 Ga0105251_10057916 Ga0105251_100579162 288
115 3300009093 Ga0105240_10235488 Ga0105240_102354882 288
116 3300009098 Ga0105245_10288440 Ga0105245_102884402 288
117 3300009101 Ga0105247_10091138 Ga0105247_100911381 288
118 3300009176 Ga0105242_10237943 Ga0105242_102379432 288
119 3300009177 Ga0105248_10297482 Ga0105248_102974822 288
120 3300009545 Ga0105237_10172147 Ga0105237_101721472 288
121 3300009551 Ga0105238_10041980 Ga0105238_100419804 288
122 3300009553 Ga0105249_10170553 Ga0105249_101705532 288
123 3300011119 Ga0105246_10040418 Ga0105246_100404184 288
124 3300013100 Ga0157373_10064245 Ga0157373_100642452 288
125 3300013297 Ga0157378_10032184 Ga0157378_100321844 288
126 3300013306 Ga0163162_10450674 Ga0163162_104506742 288
127 3300014325 Ga0163163_10366436 Ga0163163_103664362 288
128 3300014745 Ga0157377_10038037 Ga0157377_100380373 288
129 3300014968 Ga0157379_10190659 Ga0157379_101906592 288
130 3300022467 Ga0224712_10082843 Ga0224712_100828432 288
131 3300025903 Ga0207680_10141885 Ga0207680_101418852 288
132 3300025906 Ga0207699_10011395 Ga0207699_100113954 288
133 3300025908 Ga0207643_10019236 Ga0207643_100192363 288
134 3300025912 Ga0207707_10163229 Ga0207707_101632292 288
135 3300025913 Ga0207695_10354065 Ga0207695_103540651 288
136 3300025914 Ga0207671_10336541 Ga0207671_103365411 288
137 3300025920 Ga0207649_10188626 Ga0207649_101886262 288
138 3300025927 Ga0207687_10100043 Ga0207687_101000433 288
139 3300025928 Ga0207700_10015055 Ga0207700_100150553 288
140 3300025929 Ga0207664_10163337 Ga0207664_101633371 288
141 3300025929 Ga0207664_10201756 Ga0207664_102017561 288
142 3300025934 Ga0207686_10169384 Ga0207686_101693842 288
143 3300025942 Ga0207689_10025785 Ga0207689_100257855 288
144 3300025960 Ga0207651_10281284 Ga0207651_102812841 288
145 3300025981 Ga0207640_10198591 Ga0207640_101985912 288
146 3300026078 Ga0207702_10073161 Ga0207702_100731613 288
147 3300026088 Ga0207641_10406929 Ga0207641_104069291 288
148 3300026095 Ga0207676_10436518 Ga0207676_104365181 288
149 3300026118 Ga0207675_100016519 Ga0207675_1000165194 288
150 3300026121 Ga0207683_10076992 Ga0207683_100769924 288
151 3300028381 Ga0268264_10106162 Ga0268264_101061622 288
152 3300035121 Ga0373960_0044876 Ga0373960_0044876_124_1005 288
153 3300048904 Ga0496101_0112222 Ga0496101_0112222_730_1611 288
154 3300048905 Ga0496102_0323988 Ga0496102_0323988_24_905 288
155 3300048909 Ga0496106_0031753 Ga0496106_0031753_536_1417 288
156 3300048910 Ga0496107_0034271 Ga0496107_0034271_2581_3462 288
157 3300048914 Ga0496111_0060797 Ga0496111_0060797_1014_1895 288
158 iso_pu_bacteria 2547132424 2548694487 289
159 iso_pu_bacteria 2558860280 2559426978 289
160 iso_pu_bacteria 2616644814 2616698532 289
161 iso_pu_bacteria 2643221617 2644102162 289
162 iso_pu_bacteria 2643221620 2644115385 289
163 iso_pu_bacteria 2643221632 2644181440 289
164 iso_pu_bacteria 2643221687 2644490349 289
165 iso_pu_bacteria 2758568522 2760307193 289
166 iso_pu_bacteria 2799112218 2799183376 289
167 iso_pu_bacteria 2802429296 2804843855 289
168 iso_pu_bacteria 2808606375 2808916084 289
169 iso_pu_bacteria 2844852863 2844855031 289
170 iso_pu_bacteria 2857481737 2857486009 289
171 iso_pu_bacteria 2862281513 2862289182 289
172 iso_pu_bacteria 2862290372 2862296031 289
173 iso_pu_bacteria 2867428634 2867430758 289
174 iso_pu_bacteria 2883821847 2883824296 289
175 iso_pu_bacteria 2891395885 2891396627 289
176 iso_pu_bacteria 2899370129 2899373314 289
177 iso_pu_bacteria 2902837492 2902839839 289
178 iso_pu_bacteria 2904430863 2904433638 289
179 iso_pu_bacteria 2917736166 2917744110 289
180 iso_pu_bacteria 2919713450 2919713952 289
181 iso_pu_bacteria 2954380949 2954390222 289
182 iso_pu_bacteria 2954711539 2954711816 289
183 iso_pu_bacteria 2954721474 2954721733 289
184 iso_pu_bacteria 2954731030 2954740089 289
185 iso_pu_bacteria 2954740390 2954740645 289
186 iso_pu_bacteria 2954749733 2954758917 289
187 iso_pu_bacteria 2954759201 2954759655 289
188 iso_pu_bacteria 2995463766 2995469951 289
189 iso_pu_bacteria 3002998708 3003007879 289
190 iso_pu_bacteria 8003314358 8003316746 289
191 iso_pu_bacteria 8047710418 8047711091 289
192 iso_pu_bacteria 8047710418 8047718354 289
193 iso_pu_bacteria 8048127548 8048135965 289
194 iso_pu_bacteria 8056037122 8056038031 289
195 iso_pu_bacteria 8057345674 8057349317 289
196 3300037853 Ga0436364_0344289 Ga0436364_0344289_212_1093 290
197 3300045976 Ga0466967_0157373 Ga0466967_0157373_798_1694 291
198 3300049569 Ga0501032_0003744 Ga0501032_0003744_859_1770 291
199 3300049571 Ga0501034_0013399 Ga0501034_0013399_3415_4326 291
200 3300049573 Ga0501037_0086665 Ga0501037_0086665_929_1840 291
201 3300049574 Ga0501038_0038095 Ga0501038_0038095_3008_3919 291
202 3300049581 Ga0501047_0064122 Ga0501047_0064122_1526_2437 291
203 3300049582 Ga0501048_0032408 Ga0501048_0032408_2004_2915 291
204 3300049586 Ga0501070_0051009 Ga0501070_0051009_2236_3147 291
205 3300049742 Ga0501080_0105326 Ga0501080_0105326_1373_2248 291
206 3300049822 Ga0501035_0093753 Ga0501035_0093753_863_1774 291
207 3300049824 Ga0501045_0102395 Ga0501045_0102395_221_1132 291
208 3300044693 Ga0466961_0003641 Ga0466961_0003641_365_1243 292
209 3300048911 Ga0496108_0000677 Ga0496108_0000677_23823_24701 292
210 3300049823 Ga0501044_0503637 Ga0501044_0503637_176_1054 292
211 3300003792 Ga0055540_1000435 Ga0055540_100043521 293
212 3300003792 Ga0055540_1003095 Ga0055540_10030959 293
213 3300005336 Ga0070680_100478268 Ga0070680_1004782681 293
214 3300005337 Ga0070682_100204259 Ga0070682_1002042591 293
215 3300005347 Ga0070668_100145240 Ga0070668_1001452401 293
216 3300005455 Ga0070663_100106951 Ga0070663_1001069512 293
217 3300005530 Ga0070679_100057296 Ga0070679_1000572962 293
218 3300005563 Ga0068855_100003376 Ga0068855_10000337610 293
219 3300005563 Ga0068855_100025362 Ga0068855_1000253622 293
220 3300005614 Ga0068856_100045695 Ga0068856_1000456955 293
221 3300005937 Ga0081455_10080171 Ga0081455_100801713 293
222 3300005983 Ga0081540_1000790 Ga0081540_100079015 293
223 3300005983 Ga0081540_1003466 Ga0081540_10034665 293
224 3300006028 Ga0070717_10161747 Ga0070717_101617472 293
225 3300006038 Ga0075365_10002423 Ga0075365_100024239 293
226 3300006038 Ga0075365_10224930 Ga0075365_102249302 293
227 3300006042 Ga0075368_10017945 Ga0075368_100179452 293
228 3300006051 Ga0075364_10125988 Ga0075364_101259882 293
229 3300006177 Ga0075362_10061131 Ga0075362_100611312 293
230 3300006178 Ga0075367_10011264 Ga0075367_100112643 293
231 3300006186 Ga0075369_10017486 Ga0075369_100174862 293
232 3300006353 Ga0075370_10015200 Ga0075370_100152002 293
233 3300009036 Ga0105244_10083774 Ga0105244_100837741 293
234 3300009092 Ga0105250_10024368 Ga0105250_100243683 293
235 3300009148 Ga0105243_10033043 Ga0105243_100330433 293
236 3300009174 Ga0105241_10039310 Ga0105241_100393102 293
237 3300009174 Ga0105241_10373710 Ga0105241_103737101 293
238 3300011119 Ga0105246_10100767 Ga0105246_101007672 293
239 3300013296 Ga0157374_10011788 Ga0157374_100117885 293
240 3300013307 Ga0157372_10083083 Ga0157372_100830834 293
241 3300015688 Ga0183367_1014 Ga0183367_1014110 293
242 3300021388 Ga0213875_10100744 Ga0213875_101007441 293
243 3300025230 Ga0209563_100519 Ga0209563_1005196 293
244 3300025231 Ga0207427_101265 Ga0207427_1012653 293
245 3300025261 Ga0209233_1000658 Ga0209233_10006587 293
246 3300025273 Ga0209673_1011811 Ga0209673_10118113 293
247 3300025297 Ga0209758_1006582 Ga0209758_10065825 293
248 3300025303 Ga0209051_1000421 Ga0209051_100042137 293
249 3300025303 Ga0209051_1001622 Ga0209051_10016227 293
250 3300025898 Ga0207692_10059027 Ga0207692_100590272 293
251 3300025918 Ga0207662_10252303 Ga0207662_102523032 293
252 3300025928 Ga0207700_10477978 Ga0207700_104779782 293
253 3300025949 Ga0207667_10001432 Ga0207667_1000143215 293
254 3300025949 Ga0207667_10060399 Ga0207667_100603994 293
255 3300026067 Ga0207678_10279312 Ga0207678_102793121 293
256 3300026078 Ga0207702_10032985 Ga0207702_100329855 293
257 3300027312 Ga0209371_1007100 Ga0209371_10071004 293
258 3300028381 Ga0268264_10112101 Ga0268264_101121012 293
259 3300030500 Ga0268256_1009322 Ga0268256_10093222 293
260 3300030522 Ga0307512_10008400 Ga0307512_1000840011 293
261 3300031247 Ga0265340_10008815 Ga0265340_100088158 293
262 3300031456 Ga0307513_10149627 Ga0307513_101496273 293
263 3300031730 Ga0307516_10000196 Ga0307516_1000019662 293
264 3300031730 Ga0307516_10001511 Ga0307516_100015114 293
265 3300031838 Ga0307518_10001212 Ga0307518_100012129 293
266 3300037068 Ga0373925_0003432 Ga0373925_0003432_10963_11844 293
267 3300037068 Ga0373925_0037435 Ga0373925_0037435_1545_2426 293
268 3300037312 Ga0395899_0108460 Ga0395899_0108460_1015_1896 293
269 3300037466 Ga0395898_0021115 Ga0395898_0021115_304_1185 293
270 3300037466 Ga0395898_0132061 Ga0395898_0132061_1165_2046 293
271 3300037853 Ga0436364_1150670 Ga0436364_1150670_1477_2358 293
272 3300037853 Ga0436364_1388430 Ga0436364_1388430_1781_2662 293
273 3300038443 Ga0395901_0272097 Ga0395901_0272097_274_1155 293
274 3300039437 Ga0436365_0674342 Ga0436365_0674342_1286_2167 293
275 3300041507 Ga0451851_1126265 Ga0451851_1126265_50_931 293
276 3300041512 Ga0451853_0405826 Ga0451853_0405826_1388_2269 293
277 3300042138 Ga0450903_014030 Ga0450903_014030_106_1023 293
278 3300044656 Ga0466969_0046494 Ga0466969_0046494_792_1682 293
279 3300044658 Ga0466972_0012320 Ga0466972_0012320_534_1415 293
280 3300044658 Ga0466972_0047127 Ga0466972_0047127_850_1731 293
281 3300044658 Ga0466972_0054583 Ga0466972_0054583_1027_1908 293
282 3300044683 Ga0466965_0000003 Ga0466965_0000003_245157_246038 293
283 3300044684 Ga0466966_0001900 Ga0466966_0001900_9742_10623 293
284 3300044684 Ga0466966_0009848 Ga0466966_0009848_1863_2744 293
285 3300044684 Ga0466966_0013957 Ga0466966_0013957_46_927 293
286 3300044684 Ga0466966_0082716 Ga0466966_0082716_48_929 293
287 3300044684 Ga0466966_0224010 Ga0466966_0224010_11_892 293
288 3300044693 Ga0466961_0009075 Ga0466961_0009075_4690_5571 293
289 3300044693 Ga0466961_0062207 Ga0466961_0062207_557_1438 293
290 3300044694 Ga0466963_0000223 Ga0466963_0000223_2262_3143 293
291 3300044694 Ga0466963_0151612 Ga0466963_0151612_653_1534 293
292 3300044706 Ga0466964_0008164 Ga0466964_0008164_732_1613 293
293 3300044719 Ga0466971_0000703 Ga0466971_0000703_8890_9771 293
294 3300044765 Ga0466970_0000009 Ga0466970_0000009_21871_22752 293
295 3300044765 Ga0466970_0007064 Ga0466970_0007064_3619_4536 293
296 3300044765 Ga0466970_0011352 Ga0466970_0011352_3632_4513 293
297 3300044765 Ga0466970_0146100 Ga0466970_0146100_293_1174 293
298 3300044842 Ga0466957_0002013 Ga0466957_0002013_41_922 293
299 3300044842 Ga0466957_0039989 Ga0466957_0039989_1823_2707 293
300 3300044842 Ga0466957_0084616 Ga0466957_0084616_176_1057 293
301 3300044842 Ga0466957_0099157 Ga0466957_0099157_125_1006 293
302 3300044842 Ga0466957_0227326 Ga0466957_0227326_285_1166 293
303 3300044842 Ga0466957_0279187 Ga0466957_0279187_216_1097 293
304 3300044901 Ga0466960_0038183 Ga0466960_0038183_82_963 293
305 3300044901 Ga0466960_0045544 Ga0466960_0045544_517_1398 293
306 3300045049 Ga0466959_0010395 Ga0466959_0010395_1225_2106 293
307 3300045049 Ga0466959_0129009 Ga0466959_0129009_163_1044 293
308 3300045836 Ga0466958_0003012 Ga0466958_0003012_2523_3404 293
309 3300045836 Ga0466958_0037927 Ga0466958_0037927_1102_1983 293
310 3300045836 Ga0466958_0168473 Ga0466958_0168473_472_1353 293
311 3300045976 Ga0466967_0000668 Ga0466967_0000668_3759_4640 293
312 3300046462 Ga0495651_0013140 Ga0495651_0013140_4783_5664 293
313 3300046463 Ga0495653_0041299 Ga0495653_0041299_500_1381 293
314 3300046501 Ga0495607_0021753 Ga0495607_0021753_76_957 293
315 3300046511 Ga0495608_0017154 Ga0495608_0017154_2316_3197 293
316 3300046514 Ga0495618_0029775 Ga0495618_0029775_1375_2256 293
317 3300046514 Ga0495618_0123203 Ga0495618_0123203_571_1452 293
318 3300046516 Ga0495628_0010911 Ga0495628_0010911_5970_6851 293
319 3300046516 Ga0495628_0086329 Ga0495628_0086329_973_1854 293
320 3300046517 Ga0495630_0112414 Ga0495630_0112414_120_1001 293
321 3300046524 Ga0495648_0127908 Ga0495648_0127908_416_1297 293
322 3300046529 Ga0495652_0006115 Ga0495652_0006115_2445_3326 293
323 3300046543 Ga0495645_0092642 Ga0495645_0092642_544_1425 293
324 3300046559 Ga0495667_0103000 Ga0495667_0103000_586_1467 293
325 3300046642 Ga0495634_0072450 Ga0495634_0072450_899_1780 293
326 3300046675 Ga0495657_0000530 Ga0495657_0000530_4909_5790 293
327 3300046689 Ga0495613_0005407 Ga0495613_0005407_7213_8094 293
328 3300046809 Ga0495600_0001586 Ga0495600_0001586_2958_3839 293
329 3300047317 Ga0495604_0008353 Ga0495604_0008353_7097_7978 293
330 3300047317 Ga0495604_0143388 Ga0495604_0143388_695_1576 293
331 3300047322 Ga0495680_0078541 Ga0495680_0078541_104_985 293
332 3300047323 Ga0495683_0035675 Ga0495683_0035675_903_1784 293
333 3300047471 Ga0495684_0059431 Ga0495684_0059431_399_1280 293
334 3300048088 Ga0495602_0246093 Ga0495602_0246093_316_1197 293
335 3300048089 Ga0495614_0026488 Ga0495614_0026488_1165_2046 293
336 3300048907 Ga0496104_0458426 Ga0496104_0458426_77_958 293
337 3300048908 Ga0496105_0030047 Ga0496105_0030047_2206_3087 293
338 3300048908 Ga0496105_0164830 Ga0496105_0164830_791_1672 293
339 3300048912 Ga0496109_0001466 Ga0496109_0001466_3615_4496 293
340 3300048916 Ga0496113_0295892 Ga0496113_0295892_81_962 293
341 3300048917 Ga0496114_0000292 Ga0496114_0000292_5907_6788 293
342 3300048917 Ga0496114_0163463 Ga0496114_0163463_782_1663 293
343 3300048922 Ga0496119_0000053 Ga0496119_0000053_31228_32109 293
344 3300048924 Ga0496121_0110546 Ga0496121_0110546_72_953 293
345 3300048925 Ga0496122_0008671 Ga0496122_0008671_5533_6414 293
346 3300048926 Ga0496123_0023329 Ga0496123_0023329_3084_3965 293
347 3300048927 Ga0496124_0005861 Ga0496124_0005861_3300_4181 293
348 3300048927 Ga0496124_0238086 Ga0496124_0238086_50_931 293
349 3300048928 Ga0496125_0095735 Ga0496125_0095735_91_1008 293
350 3300048929 Ga0496126_0000013 Ga0496126_0000013_341934_342815 293
351 3300049568 Ga0501031_0000683 Ga0501031_0000683_10746_11627 293
352 3300049568 Ga0501031_0021627 Ga0501031_0021627_2431_3312 293
353 3300049568 Ga0501031_0025326 Ga0501031_0025326_1394_2275 293
354 3300049568 Ga0501031_0170514 Ga0501031_0170514_58_939 293
355 3300049569 Ga0501032_0000291 Ga0501032_0000291_26920_27801 293
356 3300049569 Ga0501032_0003455 Ga0501032_0003455_6141_7022 293
357 3300049569 Ga0501032_0016546 Ga0501032_0016546_1807_2688 293
358 3300049569 Ga0501032_0033598 Ga0501032_0033598_2044_2925 293
359 3300049570 Ga0501033_0004216 Ga0501033_0004216_4332_5213 293
360 3300049570 Ga0501033_0041878 Ga0501033_0041878_957_1838 293
361 3300049570 Ga0501033_0066796 Ga0501033_0066796_1439_2320 293
362 3300049570 Ga0501033_0073254 Ga0501033_0073254_297_1178 293
363 3300049570 Ga0501033_0092820 Ga0501033_0092820_357_1274 293
364 3300049570 Ga0501033_0116916 Ga0501033_0116916_363_1244 293
365 3300049570 Ga0501033_0135001 Ga0501033_0135001_865_1746 293
366 3300049570 Ga0501033_0333476 Ga0501033_0333476_160_1041 293
367 3300049570 Ga0501033_0372291 Ga0501033_0372291_66_947 293
368 3300049571 Ga0501034_0002462 Ga0501034_0002462_10595_11476 293
369 3300049571 Ga0501034_0003908 Ga0501034_0003908_14288_15169 293
370 3300049571 Ga0501034_0012947 Ga0501034_0012947_4631_5512 293
371 3300049571 Ga0501034_0064386 Ga0501034_0064386_2585_3466 293
372 3300049571 Ga0501034_0156592 Ga0501034_0156592_1191_2108 293
373 3300049572 Ga0501036_0001130 Ga0501036_0001130_3436_4317 293
374 3300049572 Ga0501036_0011980 Ga0501036_0011980_1171_2052 293
375 3300049572 Ga0501036_0050628 Ga0501036_0050628_839_1720 293
376 3300049572 Ga0501036_0080666 Ga0501036_0080666_528_1409 293
377 3300049572 Ga0501036_0202050 Ga0501036_0202050_591_1472 293
378 3300049572 Ga0501036_0470597 Ga0501036_0470597_143_1024 293
379 3300049573 Ga0501037_0000280 Ga0501037_0000280_28174_29055 293
380 3300049573 Ga0501037_0003181 Ga0501037_0003181_6161_7042 293
381 3300049573 Ga0501037_0035691 Ga0501037_0035691_881_1762 293
382 3300049574 Ga0501038_0000883 Ga0501038_0000883_9338_10219 293
383 3300049574 Ga0501038_0007461 Ga0501038_0007461_8915_9796 293
384 3300049574 Ga0501038_0008514 Ga0501038_0008514_532_1413 293
385 3300049574 Ga0501038_0030996 Ga0501038_0030996_1531_2412 293
386 3300049574 Ga0501038_0139693 Ga0501038_0139693_162_1043 293
387 3300049575 Ga0501039_0000382 Ga0501039_0000382_12712_13593 293
388 3300049575 Ga0501039_0039913 Ga0501039_0039913_2077_2958 293
389 3300049575 Ga0501039_0105769 Ga0501039_0105769_516_1397 293
390 3300049575 Ga0501039_0495422 Ga0501039_0495422_22_939 293
391 3300049576 Ga0501040_0048745 Ga0501040_0048745_654_1535 293
392 3300049578 Ga0501042_0063520 Ga0501042_0063520_1699_2580 293
393 3300049579 Ga0501043_0001643 Ga0501043_0001643_10852_11733 293
394 3300049579 Ga0501043_0040703 Ga0501043_0040703_308_1225 293
395 3300049579 Ga0501043_0203770 Ga0501043_0203770_467_1348 293
396 3300049579 Ga0501043_0281649 Ga0501043_0281649_335_1216 293
397 3300049580 Ga0501046_0000442 Ga0501046_0000442_25799_26680 293
398 3300049580 Ga0501046_0002177 Ga0501046_0002177_16132_17013 293
399 3300049580 Ga0501046_0005101 Ga0501046_0005101_10683_11564 293
400 3300049580 Ga0501046_0082515 Ga0501046_0082515_1082_1963 293
401 3300049580 Ga0501046_0202752 Ga0501046_0202752_286_1167 293
402 3300049581 Ga0501047_0000324 Ga0501047_0000324_8177_9058 293
403 3300049581 Ga0501047_0002814 Ga0501047_0002814_13889_14770 293
404 3300049581 Ga0501047_0046993 Ga0501047_0046993_2530_3411 293
405 3300049581 Ga0501047_0068160 Ga0501047_0068160_1804_2685 293
406 3300049581 Ga0501047_0140512 Ga0501047_0140512_317_1198 293
407 3300049581 Ga0501047_0169337 Ga0501047_0169337_467_1348 293
408 3300049581 Ga0501047_0228936 Ga0501047_0228936_309_1190 293
409 3300049581 Ga0501047_0398150 Ga0501047_0398150_56_937 293
410 3300049582 Ga0501048_0001572 Ga0501048_0001572_1746_2627 293
411 3300049582 Ga0501048_0002950 Ga0501048_0002950_7266_8147 293
412 3300049582 Ga0501048_0034114 Ga0501048_0034114_1763_2644 293
413 3300049583 Ga0501067_0001971 Ga0501067_0001971_5657_6538 293
414 3300049584 Ga0501068_0006710 Ga0501068_0006710_1873_2754 293
415 3300049584 Ga0501068_0050789 Ga0501068_0050789_558_1439 293
416 3300049585 Ga0501069_0000958 Ga0501069_0000958_10008_10889 293
417 3300049586 Ga0501070_0001779 Ga0501070_0001779_2498_3379 293
418 3300049586 Ga0501070_0003700 Ga0501070_0003700_1031_1912 293
419 3300049586 Ga0501070_0095456 Ga0501070_0095456_160_1077 293
420 3300049586 Ga0501070_0125632 Ga0501070_0125632_1170_2051 293
421 3300049587 Ga0501071_0013346 Ga0501071_0013346_1333_2214 293
422 3300049589 Ga0501073_0001462 Ga0501073_0001462_10827_11708 293
423 3300049589 Ga0501073_0061789 Ga0501073_0061789_897_1814 293
424 3300049590 Ga0501074_0000718 Ga0501074_0000718_13476_14357 293
425 3300049590 Ga0501074_0025457 Ga0501074_0025457_933_1814 293
426 3300049590 Ga0501074_0035948 Ga0501074_0035948_2548_3429 293
427 3300049742 Ga0501080_0001004 Ga0501080_0001004_10591_11472 293
428 3300049743 Ga0501081_0068201 Ga0501081_0068201_1226_2107 293
429 3300049744 Ga0501083_0133624 Ga0501083_0133624_143_1024 293
430 3300049822 Ga0501035_0000587 Ga0501035_0000587_33518_34399 293
431 3300049822 Ga0501035_0002957 Ga0501035_0002957_3785_4666 293
432 3300049822 Ga0501035_0003938 Ga0501035_0003938_6801_7682 293
433 3300049822 Ga0501035_0044646 Ga0501035_0044646_1032_1913 293
434 3300049822 Ga0501035_0130766 Ga0501035_0130766_375_1292 293
435 3300049822 Ga0501035_0221435 Ga0501035_0221435_599_1480 293
436 3300049823 Ga0501044_0000489 Ga0501044_0000489_32872_33753 293
437 3300049823 Ga0501044_0002104 Ga0501044_0002104_11299_12180 293
438 3300049823 Ga0501044_0047629 Ga0501044_0047629_1341_2222 293
439 3300049823 Ga0501044_0052384 Ga0501044_0052384_1800_2681 293
440 3300049823 Ga0501044_0083199 Ga0501044_0083199_972_1853 293
441 3300049823 Ga0501044_0096489 Ga0501044_0096489_1876_2757 293
442 3300049823 Ga0501044_0109214 Ga0501044_0109214_981_1862 293
443 3300049823 Ga0501044_0281213 Ga0501044_0281213_211_1092 293
444 3300049823 Ga0501044_0315292 Ga0501044_0315292_524_1405 293
445 3300049824 Ga0501045_0321595 Ga0501045_0321595_229_1110 293
446 3300050489 nmdc:mga03683_35546_c1 nmdc:mga03683_35546_c1_131_1012 293
447 3300050491 nmdc:mga00v17_187525_c1 nmdc:mga00v17_187525_c1_90_971 293
448 3300050492 nmdc:mga0yw44_68951_c1 nmdc:mga0yw44_68951_c1_75_956 293
449 3300050494 nmdc:mga06z11_2637_c1 nmdc:mga06z11_2637_c1_4045_4986 293
450 3300050496 nmdc:mga07m45_85883_c1 nmdc:mga07m45_85883_c1_523_1404 293
451 3300050516 nmdc:mga0sz30_14294_c2 nmdc:mga0sz30_14294_c2_340_1221 293
452 3300053080 Ga0500635_0054476 Ga0500635_0054476_16_897 293
453 3300053104 Ga0500556_0007981 Ga0500556_0007981_768_1649 293
454 3300053111 Ga0500572_070287 Ga0500572_070287_42_923 293
455 3300053136 Ga0500559_0019495 Ga0500559_0019495_284_1165 293
456 3300053153 Ga0500616_0000194 Ga0500616_0000194_9608_10489 293
457 3300053153 Ga0500616_0000452 Ga0500616_0000452_34254_35138 293
458 3300053153 Ga0500616_0032362 Ga0500616_0032362_1388_2269 293
459 3300053730 Ga0500645_007107 Ga0500645_007107_365_1246 293
460 3300054114 Ga0501084_0005680 Ga0501084_0005680_9352_10233 293
461 3300061719 Ga0466962_0090604 Ga0466962_0090604_190_1071 293

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

1

126

0.91

PF05368

NmrA

NmrA-like family

1

92

0.87

PF13460

NAD_binding_10

NAD(P)H-binding

3

110

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6s2j-assembly1.cif.gz_A square conformation of ktra r16k mutant ring with bound atp 0.8418 2 112
6s5d-assembly1.cif.gz_B-3 square conformation of ktra r16a mutant ring with bound atp 0.8348 2 111
3fwz-assembly1.cif.gz_B crystal structure of trka-n domain of inner membrane protein ybal from escherichia coli 0.826 2 113
4j91-assembly1.cif.gz_A-2 diamond-shaped octameric structure of ktra with adp bound 0.8201 4 112
4j91-assembly1.cif.gz_C-2 diamond-shaped octameric structure of ktra with adp bound 0.82 4 112
ID Description Score Start End Superfamily
af_Q12177_1_262_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9311 1 254 3.40.50.720
af_Q9Y7K4_1_260_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9148 1 258 3.40.50.720
af_Q9Y7K4_1_260_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9047 1 258 3.40.50.720
af_Q12177_1_262_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9004 1 254 3.40.50.720
af_I1L0F6_34_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8618 2 72 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4R1I0Y4-F1-model_v4 Nucleoside-diphosphate-sugar epimerase 0.9883 1 293 GO:0004029
GO:0005737
AF-A0A4R1I0Y4-F1-model_v4 Nucleoside-diphosphate-sugar epimerase 0.985 1 293 GO:0004029
GO:0005737
AF-A0A165RXV1-F1-model_v4 Oxidoreductase 0.9734 1 113 GO:0004029
GO:0005737
AF-V7LA19-F1-model_v4 deleted 0.9725 1 147
AF-X8BAQ2-F1-model_v4 deleted 0.9695 1 97

Feature Viewer

pLDDT pTM Quality
95.66 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map