F448811

General Info

Members Datasets Scaffolds Average Seq Length
461 255 455 232

Family's Representative Sequence

Representative Sequence 3300049590|Ga0501074_0318783|Ga0501074_0318783_200_985
Length 261
Sequence MSDAPLDAVMEAPGPAQTAVHPAPPSLRLENVTRIYKQGERDLVVFDNVSLTLAPGEIVALVGPSGAGKSSLLHIAGLLEAPTSGEVYIGGRAASMLPERERTLMRRDTLGFVYQFHHLLPEFSALENITIPRRIAGGSRKHSEEWARRLLHMVGLAERGSHRPSQLSGGEQQRVAIARALANRPKVILADEPTGNLDPATADAVFRVLISIVRKSHVSALIATHNYALAEKMDRTLVLDKGVLTDGNDAPTVASPAENPL

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
4 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
5 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
6 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
97 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
98 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
99 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
102 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
148 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
151 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
152 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
153 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
154 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
155 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
156 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
157 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
158 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
159 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
160 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
161 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
162 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
163 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
164 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
165 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
166 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
167 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
168 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
169 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
170 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
171 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
172 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
180 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
181 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
182 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
183 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
184 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
185 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
188 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
189 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
190 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
191 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
192 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
193 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
194 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
195 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
196 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
197 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
198 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
199 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
200 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
201 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
202 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
203 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
204 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
205 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
206 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
207 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
211 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
221 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
222 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
223 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
224 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
225 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
226 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
230 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
231 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
232 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
233 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
234 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
235 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
236 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
237 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
238 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
239 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
240 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
241 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
242 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
243 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
244 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
245 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
246 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
247 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
248 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
249 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
250 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
251 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
252 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
253 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
254 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
255 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.7
Metatranscriptomes 0
Isolates 1.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.92
Nodule 0
Rhizoplane 0.43
Rhizosphere 75.05
Stem 0
Stem Tuber 0
Unclassified 7.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1006292 3300002773 Bacteria 3275
2 JGI25165J46597_1000003 3300003214 Bacteria 694080
3 JGI25153J46596_10000416 3300003215 Bacteria 28007
4 JGI25153J46596_10001498 3300003215 Bacteria 13925
5 rootH2_10004047 3300003320 Bacteria 7680
6 Ga0055526_1001078 3300003771 Bacteria 19915
7 Ga0055530_10013005 3300003791 Bacteria 2865
8 Ga0065165_1003657 3300005262 Bacteria 10498
9 Ga0065707_10110887 3300005295 Bacteria 2413
10 Ga0070658_10046014 3300005327 Bacteria 3530
11 Ga0070658_10331862 3300005327 Bacteria 1300
12 Ga0070658_10372176 3300005327 Bacteria 1225
13 Ga0070676_10033601 3300005328 Bacteria 2942
14 Ga0070683_100015082 3300005329 Bacteria 6780
15 Ga0070690_100127332 3300005330 Bacteria 1716
16 Ga0070670_100328082 3300005331 Bacteria 1342
17 Ga0068869_100042053 3300005334 Bacteria 3275
18 Ga0070666_10012146 3300005335 Bacteria 5425
19 Ga0070666_10025820 3300005335 Bacteria 3832
20 Ga0070666_10126903 3300005335 Bacteria 1771
21 Ga0070682_100590814 3300005337 Bacteria 875
22 Ga0068868_100159051 3300005338 Bacteria 1864
23 Ga0068868_100307652 3300005338 Bacteria 1347
24 Ga0068868_100320243 3300005338 Bacteria 1321
25 Ga0070660_100058095 3300005339 Bacteria 2999
26 Ga0070660_100685512 3300005339 Bacteria 859
27 Ga0070691_10012790 3300005341 Bacteria 3846
28 Ga0070668_100026014 3300005347 Bacteria 4438
29 Ga0070668_100062352 3300005347 Bacteria 2888
30 Ga0070671_100151684 3300005355 Bacteria 1957
31 Ga0070671_100297957 3300005355 Bacteria 1373
32 Ga0070674_100012019 3300005356 Bacteria 5302
33 Ga0070673_100384456 3300005364 Bacteria 1252
34 Ga0070659_100006745 3300005366 Bacteria 8302
35 Ga0070659_100171655 3300005366 Bacteria 1777
36 Ga0070659_100280856 3300005366 Bacteria 1385
37 Ga0070659_100427949 3300005366 Bacteria 1120
38 Ga0070667_100023389 3300005367 Bacteria 5126
39 Ga0070667_100028660 3300005367 Bacteria 4637
40 Ga0070667_100145405 3300005367 Bacteria 2079
41 Ga0070700_100020175 3300005441 Bacteria 3856
42 Ga0070663_100163171 3300005455 Bacteria 1717
43 Ga0070678_100249613 3300005456 Bacteria 1487
44 Ga0070662_100060316 3300005457 Bacteria 2766
45 Ga0070662_100095674 3300005457 Bacteria 2239
46 Ga0070681_10241515 3300005458 Bacteria 1720
47 Ga0070681_10250740 3300005458 Bacteria 1683
48 Ga0068867_100001875 3300005459 Bacteria 14607
49 Ga0068867_100261613 3300005459 Bacteria 1411
50 Ga0070706_100007193 3300005467 Bacteria 10463
51 Ga0070707_100056681 3300005468 Bacteria 3759
52 Ga0070707_100229420 3300005468 Bacteria 1808
53 Ga0070698_100135672 3300005471 Bacteria 2415
54 Ga0070699_100185351 3300005518 Bacteria 1848
55 Ga0070684_100054004 3300005535 Bacteria 3500
56 Ga0068853_100077618 3300005539 Bacteria 2901
57 Ga0068853_100098728 3300005539 Bacteria 2579
58 Ga0070672_100021434 3300005543 Bacteria 4728
59 Ga0070693_100260655 3300005547 Bacteria 1153
60 Ga0070665_100015897 3300005548 Bacteria 7553
61 Ga0070665_100126692 3300005548 Bacteria 2556
62 Ga0070665_100178824 3300005548 Bacteria 2122
63 Ga0070665_100296525 3300005548 Bacteria 1619
64 Ga0070665_100330072 3300005548 Bacteria 1530
65 Ga0068855_100016375 3300005563 Bacteria 8914
66 Ga0068855_100196655 3300005563 Bacteria 2271
67 Ga0068855_100453570 3300005563 Bacteria 1399
68 Ga0070664_100321885 3300005564 Bacteria 1401
69 Ga0068857_100027756 3300005577 Bacteria 4992
70 Ga0068854_100009422 3300005578 Bacteria 6304
71 Ga0068854_100147092 3300005578 Bacteria 1813
72 Ga0068854_100322003 3300005578 Bacteria 1257
73 Ga0068852_100077434 3300005616 Bacteria 2940
74 Ga0068859_100036873 3300005617 Bacteria 4908
75 Ga0068859_100162280 3300005617 Bacteria 2314
76 Ga0068864_100008633 3300005618 Bacteria 8406
77 Ga0068864_100046099 3300005618 Bacteria 3740
78 Ga0068861_100004599 3300005719 Bacteria 9262
79 Ga0068851_10061674 3300005834 Bacteria 1923
80 Ga0068851_10157031 3300005834 Bacteria 1247
81 Ga0068870_10584112 3300005840 Bacteria 757
82 Ga0068863_100033010 3300005841 Bacteria 4931
83 Ga0068863_100362111 3300005841 Bacteria 1414
84 Ga0068858_100061148 3300005842 Bacteria 3481
85 Ga0068858_100379420 3300005842 Bacteria 1356
86 Ga0068858_100384128 3300005842 Bacteria 1348
87 Ga0068860_100020270 3300005843 Bacteria 6441
88 Ga0068860_100192904 3300005843 Bacteria 1972
89 Ga0068860_100201487 3300005843 Bacteria 1929
90 Ga0068860_100224726 3300005843 Bacteria 1823
91 Ga0068862_100033806 3300005844 Bacteria 4325
92 Ga0075365_10117546 3300006038 Bacteria 1832
93 Ga0075365_10431313 3300006038 Bacteria 931
94 Ga0075368_10187238 3300006042 Bacteria 873
95 Ga0075363_100081475 3300006048 Bacteria 1770
96 Ga0075362_10024768 3300006177 Bacteria 2548
97 Ga0075362_10034311 3300006177 Bacteria 2211
98 Ga0075367_10002766 3300006178 Bacteria 8123
99 Ga0075369_10094035 3300006186 Bacteria 1340
100 Ga0075366_10051499 3300006195 Bacteria 2446
101 Ga0075366_10141910 3300006195 Bacteria 1452
102 Ga0097621_100065228 3300006237 Bacteria 2996
103 Ga0097621_100074197 3300006237 Bacteria 2817
104 Ga0075370_10002638 3300006353 Bacteria 8375
105 Ga0075370_10004382 3300006353 Bacteria 6844
106 Ga0075370_10039537 3300006353 Bacteria 2658
107 Ga0075370_10043334 3300006353 Bacteria 2543
108 Ga0075370_10051345 3300006353 Bacteria 2339
109 Ga0075370_10088376 3300006353 Bacteria 1786
110 Ga0068871_100015577 3300006358 Bacteria 5696
111 Ga0068871_100024205 3300006358 Bacteria 4705
112 Ga0068871_100114163 3300006358 Bacteria 2275
113 Ga0068871_100405495 3300006358 Bacteria 1215
114 Ga0068865_100014910 3300006881 Bacteria 4948
115 Ga0068865_100021790 3300006881 Bacteria 4171
116 Ga0097620_100036872 3300006931 Bacteria 4908
117 Ga0097620_100162279 3300006931 Bacteria 2314
118 Ga0105240_10025185 3300009093 Bacteria 7825
119 Ga0105240_10176069 3300009093 Bacteria 2529
120 Ga0105240_10430734 3300009093 Bacteria 1480
121 Ga0105240_10465206 3300009093 Bacteria 1412
122 Ga0105240_10847946 3300009093 Bacteria 987
123 Ga0105245_10058532 3300009098 Bacteria 3469
124 Ga0105245_10077638 3300009098 Bacteria 3028
125 Ga0105245_10313084 3300009098 Bacteria 1544
126 Ga0105245_10605312 3300009098 Bacteria 1123
127 Ga0105245_10877790 3300009098 Bacteria 938
128 Ga0105243_10658464 3300009148 Bacteria 1016
129 Ga0105243_10937925 3300009148 Bacteria 864
130 Ga0105241_10014857 3300009174 Bacteria 5701
131 Ga0105241_10027967 3300009174 Bacteria 4199
132 Ga0105241_10202833 3300009174 Bacteria 1658
133 Ga0105241_10677465 3300009174 Bacteria 939
134 Ga0105242_10048531 3300009176 Bacteria 3451
135 Ga0105248_10017001 3300009177 Bacteria 8011
136 Ga0105248_10038968 3300009177 Bacteria 5321
137 Ga0105248_10086028 3300009177 Bacteria 3537
138 Ga0105248_10479083 3300009177 Bacteria 1403
139 Ga0105248_10862421 3300009177 Bacteria 1022
140 Ga0105237_10004426 3300009545 Bacteria 16286
141 Ga0105237_10075359 3300009545 Bacteria 3365
142 Ga0105237_10259798 3300009545 Bacteria 1739
143 Ga0105237_10347152 3300009545 Bacteria 1488
144 Ga0105238_10035570 3300009551 Bacteria 5063
145 Ga0105238_10045293 3300009551 Bacteria 4444
146 Ga0105238_10121260 3300009551 Bacteria 2594
147 Ga0105238_10243659 3300009551 Bacteria 1775
148 Ga0105249_10531818 3300009553 Bacteria 1224
149 Ga0105239_10112843 3300010375 Bacteria 3014
150 Ga0105239_10130362 3300010375 Bacteria 2796
151 Ga0105239_10175588 3300010375 Bacteria 2396
152 Ga0105239_10220093 3300010375 Bacteria 2129
153 Ga0157373_10059398 3300013100 Bacteria 2709
154 Ga0157370_10015443 3300013104 Bacteria 7762
155 Ga0157370_10047650 3300013104 Bacteria 4107
156 Ga0157370_10119820 3300013104 Bacteria 2457
157 Ga0157369_10038375 3300013105 Bacteria 5237
158 Ga0157369_10987379 3300013105 Bacteria 862
159 Ga0157374_10061633 3300013296 Bacteria 3514
160 Ga0157378_10001232 3300013297 Bacteria 23149
161 Ga0157378_10041956 3300013297 Bacteria 4060
162 Ga0157378_10100758 3300013297 Bacteria 2637
163 Ga0157378_10166471 3300013297 Bacteria 2065
164 Ga0163162_10045427 3300013306 Bacteria 4400
165 Ga0157372_10036093 3300013307 Bacteria 5447
166 Ga0157375_10010463 3300013308 Bacteria 8164
167 Ga0157375_10761020 3300013308 Bacteria 1119
168 Ga0163163_10000491 3300014325 Bacteria 35805
169 Ga0163163_10172849 3300014325 Bacteria 2207
170 Ga0157380_10398294 3300014326 Bacteria 1305
171 Ga0157379_10002383 3300014968 Bacteria 15713
172 Ga0157379_10075651 3300014968 Bacteria 3015
173 Ga0157379_10177371 3300014968 Bacteria 1924
174 Ga0157379_10216328 3300014968 Bacteria 1735
175 Ga0157376_10015900 3300014969 Bacteria 5699
176 Ga0157376_10717248 3300014969 Bacteria 1006
177 Ga0163161_10059025 3300017792 Bacteria 2789
178 Ga0207425_1003634 3300025245 Bacteria 4865
179 Ga0209129_1000113 3300025258 Bacteria 145178
180 Ga0209233_1000015 3300025261 Bacteria 980563
181 Ga0209233_1019655 3300025261 Bacteria 1790
182 Ga0209673_1018609 3300025273 Bacteria 2520
183 Ga0209564_1000186 3300025295 Bacteria 147120
184 Ga0209758_1000013 3300025297 Bacteria 873003
185 Ga0209758_1000172 3300025297 Bacteria 147763
186 Ga0209758_1000304 3300025297 Bacteria 95770
187 Ga0209050_1000489 3300025298 Bacteria 68506
188 Ga0209256_1017432 3300025299 Bacteria 2384
189 Ga0209051_1011385 3300025303 Bacteria 4395
190 Ga0207656_10150937 3300025321 Bacteria 1100
191 Ga0207680_10003566 3300025903 Bacteria 7321
192 Ga0207680_10032044 3300025903 Bacteria 2983
193 Ga0207680_10462608 3300025903 Bacteria 901
194 Ga0207645_10026229 3300025907 Bacteria 3766
195 Ga0207643_10461204 3300025908 Bacteria 809
196 Ga0207705_10000130 3300025909 Bacteria 82082
197 Ga0207705_10349134 3300025909 Bacteria 1139
198 Ga0207705_10443359 3300025909 Bacteria 1006
199 Ga0207684_10002617 3300025910 Bacteria 18008
200 Ga0207654_10009257 3300025911 Bacteria 4997
201 Ga0207654_10455666 3300025911 Bacteria 897
202 Ga0207707_10000839 3300025912 Bacteria 30215
203 Ga0207695_10039419 3300025913 Bacteria 5078
204 Ga0207695_10186200 3300025913 Bacteria 1995
205 Ga0207695_10331238 3300025913 Bacteria 1411
206 Ga0207695_10383871 3300025913 Bacteria 1290
207 Ga0207695_10581315 3300025913 Bacteria 1001
208 Ga0207695_10637007 3300025913 Bacteria 947
209 Ga0207695_10803230 3300025913 Bacteria 821
210 Ga0207671_10037184 3300025914 Bacteria 3611
211 Ga0207663_10400352 3300025916 Bacteria 1050
212 Ga0207660_10004518 3300025917 Bacteria 9072
213 Ga0207657_10007135 3300025919 Bacteria 11475
214 Ga0207652_10199228 3300025921 Bacteria 1802
215 Ga0207652_10662378 3300025921 Bacteria 933
216 Ga0207646_10004423 3300025922 Bacteria 15282
217 Ga0207694_10081790 3300025924 Bacteria 2538
218 Ga0207694_10104513 3300025924 Bacteria 2247
219 Ga0207694_10192887 3300025924 Bacteria 1656
220 Ga0207687_10161090 3300025927 Bacteria 1722
221 Ga0207687_10164813 3300025927 Bacteria 1704
222 Ga0207644_10275667 3300025931 Bacteria 1349
223 Ga0207690_10091545 3300025932 Bacteria 2150
224 Ga0207706_10059009 3300025933 Bacteria 3379
225 Ga0207706_10319195 3300025933 Bacteria 1352
226 Ga0207686_10017974 3300025934 Bacteria 3995
227 Ga0207669_10345510 3300025937 Bacteria 1147
228 Ga0207704_10229891 3300025938 Bacteria 1378
229 Ga0207711_10029220 3300025941 Bacteria 4647
230 Ga0207711_10135942 3300025941 Bacteria 2208
231 Ga0207711_10362855 3300025941 Bacteria 1342
232 Ga0207711_10738059 3300025941 Bacteria 918
233 Ga0207689_10059472 3300025942 Bacteria 3143
234 Ga0207689_10115784 3300025942 Bacteria 2204
235 Ga0207689_10623203 3300025942 Bacteria 908
236 Ga0207667_10025262 3300025949 Bacteria 6505
237 Ga0207667_10123327 3300025949 Bacteria 2669
238 Ga0207667_10330879 3300025949 Bacteria 1555
239 Ga0207667_10610989 3300025949 Bacteria 1099
240 Ga0207668_10019038 3300025972 Bacteria 4331
241 Ga0207640_10094014 3300025981 Bacteria 2084
242 Ga0207658_10027614 3300025986 Bacteria 3990
243 Ga0207658_10081440 3300025986 Bacteria 2482
244 Ga0207658_10146773 3300025986 Bacteria 1917
245 Ga0207658_10151261 3300025986 Bacteria 1891
246 Ga0207658_10209915 3300025986 Bacteria 1631
247 Ga0207677_10098991 3300026023 Bacteria 2140
248 Ga0207677_10196208 3300026023 Bacteria 1601
249 Ga0207703_10079664 3300026035 Bacteria 2726
250 Ga0207703_10087580 3300026035 Bacteria 2611
251 Ga0207703_10181384 3300026035 Bacteria 1858
252 Ga0207639_10128543 3300026041 Bacteria 2094
253 Ga0207678_10124787 3300026067 Bacteria 2197
254 Ga0207641_10021216 3300026088 Bacteria 5339
255 Ga0207648_10009980 3300026089 Bacteria 9037
256 Ga0207648_10121845 3300026089 Bacteria 2293
257 Ga0207648_10267114 3300026089 Bacteria 1528
258 Ga0207676_10239963 3300026095 Bacteria 1625
259 Ga0207674_10024174 3300026116 Bacteria 6496
260 Ga0207674_10209805 3300026116 Bacteria 1897
261 Ga0207674_10526521 3300026116 Bacteria 1142
262 Ga0207675_100218230 3300026118 Bacteria 1837
263 Ga0207683_10027589 3300026121 Bacteria 4906
264 Ga0207698_10050450 3300026142 Bacteria 3174
265 Ga0268266_10016716 3300028379 Bacteria 6272
266 Ga0268266_10040266 3300028379 Bacteria 3982
267 Ga0268266_10055863 3300028379 Bacteria 3395
268 Ga0268264_10078985 3300028381 Bacteria 2806
269 Ga0268264_10164935 3300028381 Bacteria 1999
270 Ga0307517_10000394 3300028786 Bacteria 74695
271 Ga0307517_10106629 3300028786 Bacteria 2165
272 Ga0307517_10282095 3300028786 Bacteria 946
273 Ga0307515_10126153 3300028794 Bacteria 2857
274 Ga0307515_10194131 3300028794 Bacteria 1929
275 Ga0265338_10090729 3300028800 Bacteria 2528
276 Ga0265338_10150228 3300028800 Bacteria 1811
277 Ga0307512_10015509 3300030522 Bacteria 7062
278 Ga0307512_10252162 3300030522 Bacteria 878
279 Ga0265330_10138510 3300031235 Bacteria 1035
280 Ga0265330_10146877 3300031235 Bacteria 1002
281 Ga0265332_10065420 3300031238 Bacteria 1552
282 Ga0265320_10000561 3300031240 Bacteria 28649
283 Ga0265325_10024292 3300031241 Bacteria 3299
284 Ga0265325_10060030 3300031241 Bacteria 1933
285 Ga0265340_10006654 3300031247 Bacteria 6338
286 Ga0265340_10075636 3300031247 Bacteria 1591
287 Ga0265339_10050128 3300031249 Bacteria 2284
288 Ga0265331_10019471 3300031250 Bacteria 3505
289 Ga0265327_10121495 3300031251 Bacteria 1237
290 Ga0265316_10092029 3300031344 Bacteria 2312
291 Ga0265316_10344448 3300031344 Bacteria 1080
292 Ga0307513_10067876 3300031456 Bacteria 3738
293 Ga0307513_10173622 3300031456 Bacteria 2029
294 Ga0307513_10191105 3300031456 Bacteria 1899
295 Ga0307513_10249245 3300031456 Bacteria 1574
296 Ga0307513_10444498 3300031456 Bacteria 1022
297 Ga0307509_10000950 3300031507 Bacteria 49553
298 Ga0307509_10020699 3300031507 Bacteria 7461
299 Ga0307509_10036100 3300031507 Bacteria 5416
300 Ga0307509_10182015 3300031507 Bacteria 1965
301 Ga0265313_10000482 3300031595 Bacteria 41863
302 Ga0265313_10024957 3300031595 Bacteria 3179
303 Ga0307508_10000150 3300031616 Bacteria 83110
304 Ga0307508_10000912 3300031616 Bacteria 34407
305 Ga0307514_10026860 3300031649 Bacteria 4653
306 Ga0265314_10003381 3300031711 Bacteria 15464
307 Ga0265314_10015573 3300031711 Bacteria 6029
308 Ga0265314_10040254 3300031711 Bacteria 3356
309 Ga0265314_10311902 3300031711 Bacteria 878
310 Ga0265342_10108092 3300031712 Bacteria 1577
311 Ga0307516_10120325 3300031730 Bacteria 2417
312 Ga0307516_10318037 3300031730 Bacteria 1228
313 Ga0307518_10099014 3300031838 Bacteria 2090
314 Ga0307510_10003618 3300033180 Bacteria 18050
315 Ga0307510_10041561 3300033180 Bacteria 5024
316 Ga0307510_10083991 3300033180 Bacteria 3069
317 Ga0307510_10153269 3300033180 Bacteria 1918
318 Ga0373926_0022809 3300035083 Bacteria 2172
319 Ga0373928_0018448 3300035084 Bacteria 1446
320 Ga0373946_0030113 3300035171 Bacteria 2165
321 Ga0373931_0019380 3300035691 Bacteria 3395
322 Ga0373925_0007849 3300037068 Bacteria 7773
323 Ga0395900_0037167 3300037418 Bacteria 5022
324 Ga0395905_1001584 3300037471 Bacteria 739
325 Ga0400483_202922 3300039062 Bacteria 1298
326 Ga0436365_1029241 3300039437 Bacteria 3960
327 Ga0436360_0091358 3300039438 Bacteria 2727
328 Ga0436363_0818177 3300039450 Bacteria 3114
329 Ga0451853_2462852 3300041512 Bacteria 1112
330 Ga0450890_030284 3300042127 Bacteria 768
331 Ga0451577_0000058 3300042876 Bacteria 272673
332 Ga0451577_0005288 3300042876 Bacteria 13268
333 Ga0451577_0327109 3300042876 Bacteria 1390
334 Ga0451577_0578387 3300042876 Bacteria 1019
335 Ga0453683_0019776 3300044673 Bacteria 4309
336 Ga0453684_0000122 3300044712 Bacteria 340529
337 Ga0453684_0009178 3300044712 Bacteria 17388
338 Ga0453684_0133738 3300044712 Bacteria 2972
339 Ga0451576_0018914 3300045051 Bacteria 7529
340 Ga0495592_0000490 3300046454 Bacteria 28863
341 Ga0495590_0037894 3300046457 Bacteria 1680
342 Ga0495638_0021926 3300046460 Bacteria 4199
343 Ga0495650_0003109 3300046471 Bacteria 12452
344 Ga0495620_0140041 3300046515 Bacteria 946
345 Ga0495630_0046979 3300046517 Bacteria 3228
346 Ga0495631_0105569 3300046518 Bacteria 1212
347 Ga0495632_0005244 3300046519 Bacteria 8619
348 Ga0495632_0010408 3300046519 Bacteria 5513
349 Ga0495621_0049780 3300046539 Bacteria 1496
350 Ga0495622_0007824 3300046557 Bacteria 4963
351 Ga0495611_0120420 3300046648 Bacteria 1224
352 Ga0495625_0011335 3300046660 Bacteria 7279
353 Ga0495646_0179874 3300046680 Bacteria 1161
354 Ga0495658_0015942 3300046683 Bacteria 3864
355 Ga0495624_0198273 3300046690 Bacteria 1220
356 Ga0495649_0002567 3300046694 Bacteria 12721
357 Ga0495660_0013939 3300046810 Bacteria 4659
358 Ga0495660_0040208 3300046810 Bacteria 2593
359 Ga0495687_000414 3300047443 Bacteria 52840
360 Ga0495687_047308 3300047443 Bacteria 1851
361 Ga0495687_055415 3300047443 Bacteria 1657
362 Ga0495593_0018004 3300047673 Bacteria 3974
363 Ga0495602_0309488 3300048088 Bacteria 1153
364 Ga0495602_0309537 3300048088 Bacteria 1153
365 Ga0495626_0016219 3300048091 Bacteria 3789
366 Ga0495626_0037057 3300048091 Bacteria 2320
367 Ga0496106_0011322 3300048909 Bacteria 6602
368 Ga0496115_0714458 3300048918 Bacteria 787
369 Ga0496121_0001453 3300048924 Bacteria 40007
370 Ga0501033_0073684 3300049570 Bacteria 2507
371 Ga0501033_0428861 3300049570 Bacteria 920
372 Ga0501034_0140080 3300049571 Bacteria 2399
373 Ga0501034_0827405 3300049571 Bacteria 817
374 Ga0501036_0058142 3300049572 Bacteria 3276
375 Ga0501036_0130596 3300049572 Bacteria 2121
376 Ga0501037_0127606 3300049573 Bacteria 1825
377 Ga0501038_0185604 3300049574 Bacteria 1676
378 Ga0501039_0161220 3300049575 Bacteria 1763
379 Ga0501043_0179297 3300049579 Bacteria 1651
380 Ga0501043_0247296 3300049579 Bacteria 1374
381 Ga0501046_0001906 3300049580 Bacteria 19804
382 Ga0501047_0000350 3300049581 Bacteria 52125
383 Ga0501047_0005770 3300049581 Bacteria 11658
384 Ga0501047_0017733 3300049581 Bacteria 6820
385 Ga0501047_0041047 3300049581 Bacteria 4472
386 Ga0501047_0069231 3300049581 Bacteria 3398
387 Ga0501069_0009948 3300049585 Bacteria 5028
388 Ga0501070_0008463 3300049586 Bacteria 8691
389 Ga0501070_0680293 3300049586 Bacteria 815
390 Ga0501073_0083855 3300049589 Bacteria 2217
391 Ga0501073_0441647 3300049589 Bacteria 899
392 Ga0501074_0032541 3300049590 Bacteria 3777
393 Ga0501074_0318783 3300049590 Bacteria 1104
394 Ga0501077_0204985 3300049593 Bacteria 1253
395 Ga0501079_0014738 3300049741 Bacteria 5958
396 Ga0501080_0078800 3300049742 Bacteria 3063
397 Ga0501080_0288033 3300049742 Bacteria 1492
398 Ga0501080_0402202 3300049742 Bacteria 1232
399 Ga0501035_0011540 3300049822 Bacteria 8188
400 Ga0501035_0021645 3300049822 Bacteria 5912
401 Ga0501035_0055396 3300049822 Bacteria 3540
402 Ga0501035_0126136 3300049822 Bacteria 2234
403 Ga0501035_0353942 3300049822 Bacteria 1228
404 Ga0501044_0001970 3300049823 Bacteria 23744
405 Ga0501044_0049439 3300049823 Bacteria 4341
406 Ga0501044_0053897 3300049823 Bacteria 4136
407 Ga0501044_0265343 3300049823 Bacteria 1654
408 Ga0501044_0401056 3300049823 Bacteria 1284
409 Ga0501044_0448268 3300049823 Bacteria 1197
410 Ga0501044_0495869 3300049823 Bacteria 1123
411 Ga0501044_0591104 3300049823 Bacteria 1004
412 nmdc:mga03n38_202399_c1 3300050490 Bacteria 1028
413 nmdc:mga0yw44_93689_c1 3300050492 Bacteria 1902
414 nmdc:mga0k408_11609_c1 3300050493 Bacteria 4802
415 nmdc:mga0k408_222915_c1 3300050493 Bacteria 1126
416 nmdc:mga0k408_298964_c1 3300050493 Bacteria 961
417 nmdc:mga0k408_32543_c1 3300050493 Bacteria 2979
418 nmdc:mga0k408_3927_c1 3300050493 Bacteria 7887
419 nmdc:mga0k408_6987_c1 3300050493 Bacteria 6022
420 nmdc:mga0k408_90969_c1 3300050493 Bacteria 1447
421 nmdc:mga06z11_3635_c1 3300050494 Bacteria 5982
422 nmdc:mga06z11_48079_c1 3300050494 Bacteria 2170
423 nmdc:mga07m45_10314_c3 3300050496 Bacteria 1941
424 nmdc:mga07m45_11861_c1 3300050496 Bacteria 4590
425 nmdc:mga07m45_184622_c1 3300050496 Bacteria 1213
426 nmdc:mga07m45_2404_c1 3300050496 Bacteria 8783
427 nmdc:mga07m45_26810_c1 3300050496 Bacteria 3169
428 nmdc:mga07m45_341934_c1 3300050496 Bacteria 870
429 nmdc:mga07m45_40295_c1 3300050496 Bacteria 2614
430 nmdc:mga07m45_52421_c1 3300050496 Bacteria 2303
431 nmdc:mga0sz30_30037_c2 3300050516 Bacteria 833
432 Ga0500578_0001295 3300053086 Bacteria 25808
433 Ga0500578_0364777 3300053086 Bacteria 841
434 Ga0500643_000003 3300053087 Bacteria 876659
435 Ga0500644_0004280 3300053088 Bacteria 3567
436 Ga0500646_0011069 3300053090 Bacteria 2317
437 Ga0500651_0020230 3300053093 Bacteria 4141
438 Ga0500650_0061861 3300053098 Bacteria 1749
439 Ga0500555_016967 3300053103 Bacteria 2099
440 Ga0500595_001314 3300053119 Bacteria 13488
441 Ga0500595_006462 3300053119 Bacteria 4969
442 Ga0500595_028654 3300053119 Bacteria 1897
443 Ga0500597_140075 3300053120 Bacteria 1043
444 Ga0500628_000765 3300053129 Bacteria 5720
445 Ga0500642_0033443 3300053130 Bacteria 2166
446 Ga0500652_002286 3300053131 Bacteria 5764
447 Ga0500658_0002203 3300053134 Bacteria 7568
448 Ga0500559_0000049 3300053136 Bacteria 93378
449 Ga0500568_0008143 3300053139 Bacteria 5081
450 Ga0500573_0000008 3300053140 Bacteria 237795
451 Ga0500577_0004058 3300053142 Bacteria 3837
452 Ga0500622_0000146 3300053156 Bacteria 74615
453 Ga0500639_039988 3300053163 Bacteria 2468
454 Ga0500645_021359 3300053730 Bacteria 1999
455 Ga0501084_0114925 3300054114 Bacteria 2262

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049822 Ga0501035_0353942 Ga0501035_0353942_15_653 205
2 3300042876 Ga0451577_0327109 Ga0451577_0327109_545_1210 211
3 3300025942 Ga0207689_10115784 Ga0207689_101157842 218
4 3300013105 Ga0157369_10987379 Ga0157369_109873792 219
5 iso_pu_bacteria 2643221592 2643967756 219
6 iso_pu_bacteria 2643221625 2644140578 219
7 iso_pu_bacteria 2643221648 2644273545 219
8 3300014968 Ga0157379_10177371 Ga0157379_101773711 220
9 3300037471 Ga0395905_1001584 Ga0395905_1001584_10_705 220
10 3300047443 Ga0495687_000414 Ga0495687_000414_42557_43219 220
11 3300048091 Ga0495626_0037057 Ga0495626_0037057_24_686 220
12 3300049572 Ga0501036_0130596 Ga0501036_0130596_928_1617 220
13 3300049579 Ga0501043_0179297 Ga0501043_0179297_489_1178 220
14 3300049581 Ga0501047_0017733 Ga0501047_0017733_3125_3814 220
15 3300049585 Ga0501069_0009948 Ga0501069_0009948_577_1266 220
16 3300049586 Ga0501070_0008463 Ga0501070_0008463_5844_6533 220
17 3300049589 Ga0501073_0083855 Ga0501073_0083855_470_1159 220
18 3300049590 Ga0501074_0032541 Ga0501074_0032541_2189_2878 220
19 3300049593 Ga0501077_0204985 Ga0501077_0204985_392_1081 220
20 3300049741 Ga0501079_0014738 Ga0501079_0014738_2174_2863 220
21 3300049742 Ga0501080_0078800 Ga0501080_0078800_724_1413 220
22 3300049822 Ga0501035_0021645 Ga0501035_0021645_5206_5895 220
23 3300049823 Ga0501044_0265343 Ga0501044_0265343_66_755 220
24 3300050493 nmdc:mga0k408_32543_c1 nmdc:mga0k408_32543_c1_733_1395 220
25 3300050496 nmdc:mga07m45_184622_c1 nmdc:mga07m45_184622_c1_264_926 220
26 3300053086 Ga0500578_0364777 Ga0500578_0364777_168_830 220
27 3300053088 Ga0500644_0004280 Ga0500644_0004280_1711_2373 220
28 3300053136 Ga0500559_0000049 Ga0500559_0000049_78289_78951 220
29 3300054114 Ga0501084_0114925 Ga0501084_0114925_1483_2172 220
30 iso_pu_bacteria 2585428057 2587730704 220
31 iso_pu_bacteria 2585428058 2587736997 220
32 iso_pu_bacteria 2588253510 2588294887 220
33 3300009174 Ga0105241_10014857 Ga0105241_100148577 221
34 3300014968 Ga0157379_10002383 Ga0157379_1000238314 221
35 3300039062 Ga0400483_202922 Ga0400483_202922_255_932 221
36 3300048088 Ga0495602_0309537 Ga0495602_0309537_321_1088 221
37 3300003214 JGI25165J46597_1000003 JGI25165J46597_100000329 222
38 3300005327 Ga0070658_10046014 Ga0070658_100460143 222
39 3300005329 Ga0070683_100015082 Ga0070683_1000150823 222
40 3300005334 Ga0068869_100042053 Ga0068869_1000420533 222
41 3300005335 Ga0070666_10025820 Ga0070666_100258203 222
42 3300005335 Ga0070666_10126903 Ga0070666_101269032 222
43 3300005337 Ga0070682_100590814 Ga0070682_1005908141 222
44 3300005338 Ga0068868_100320243 Ga0068868_1003202431 222
45 3300005339 Ga0070660_100058095 Ga0070660_1000580951 222
46 3300005339 Ga0070660_100685512 Ga0070660_1006855121 222
47 3300005355 Ga0070671_100297957 Ga0070671_1002979573 222
48 3300005366 Ga0070659_100171655 Ga0070659_1001716551 222
49 3300005367 Ga0070667_100023389 Ga0070667_1000233892 222
50 3300005456 Ga0070678_100249613 Ga0070678_1002496132 222
51 3300005457 Ga0070662_100095674 Ga0070662_1000956743 222
52 3300005458 Ga0070681_10241515 Ga0070681_102415151 222
53 3300005459 Ga0068867_100261613 Ga0068867_1002616132 222
54 3300005471 Ga0070698_100135672 Ga0070698_1001356722 222
55 3300005535 Ga0070684_100054004 Ga0070684_1000540041 222
56 3300005548 Ga0070665_100015897 Ga0070665_1000158976 222
57 3300005548 Ga0070665_100126692 Ga0070665_1001266922 222
58 3300005548 Ga0070665_100178824 Ga0070665_1001788243 222
59 3300005563 Ga0068855_100453570 Ga0068855_1004535702 222
60 3300005834 Ga0068851_10157031 Ga0068851_101570311 222
61 3300005841 Ga0068863_100033010 Ga0068863_1000330106 222
62 3300005842 Ga0068858_100379420 Ga0068858_1003794202 222
63 3300005843 Ga0068860_100201487 Ga0068860_1002014872 222
64 3300006237 Ga0097621_100065228 Ga0097621_1000652283 222
65 3300006237 Ga0097621_100074197 Ga0097621_1000741972 222
66 3300006358 Ga0068871_100015577 Ga0068871_1000155776 222
67 3300006358 Ga0068871_100024205 Ga0068871_1000242053 222
68 3300006358 Ga0068871_100405495 Ga0068871_1004054952 222
69 3300006881 Ga0068865_100021790 Ga0068865_1000217902 222
70 3300009093 Ga0105240_10176069 Ga0105240_101760693 222
71 3300009098 Ga0105245_10058532 Ga0105245_100585322 222
72 3300009098 Ga0105245_10313084 Ga0105245_103130842 222
73 3300009148 Ga0105243_10937925 Ga0105243_109379251 222
74 3300009174 Ga0105241_10677465 Ga0105241_106774652 222
75 3300009176 Ga0105242_10048531 Ga0105242_100485312 222
76 3300009177 Ga0105248_10017001 Ga0105248_100170015 222
77 3300009177 Ga0105248_10038968 Ga0105248_100389686 222
78 3300009177 Ga0105248_10479083 Ga0105248_104790832 222
79 3300009177 Ga0105248_10862421 Ga0105248_108624211 222
80 3300009545 Ga0105237_10259798 Ga0105237_102597982 222
81 3300009545 Ga0105237_10347152 Ga0105237_103471523 222
82 3300009551 Ga0105238_10121260 Ga0105238_101212605 222
83 3300009551 Ga0105238_10243659 Ga0105238_102436593 222
84 3300010375 Ga0105239_10220093 Ga0105239_102200933 222
85 3300013104 Ga0157370_10015443 Ga0157370_100154434 222
86 3300013104 Ga0157370_10119820 Ga0157370_101198203 222
87 3300013296 Ga0157374_10061633 Ga0157374_100616335 222
88 3300013297 Ga0157378_10100758 Ga0157378_101007583 222
89 3300013297 Ga0157378_10166471 Ga0157378_101664713 222
90 3300013308 Ga0157375_10010463 Ga0157375_100104636 222
91 3300014325 Ga0163163_10000491 Ga0163163_1000049137 222
92 3300014968 Ga0157379_10075651 Ga0157379_100756513 222
93 3300014968 Ga0157379_10216328 Ga0157379_102163282 222
94 3300014969 Ga0157376_10015900 Ga0157376_100159001 222
95 3300017792 Ga0163161_10059025 Ga0163161_100590252 222
96 3300025261 Ga0209233_1000015 Ga0209233_1000015751 222
97 3300025261 Ga0209233_1019655 Ga0209233_10196552 222
98 3300025297 Ga0209758_1000013 Ga0209758_1000013374 222
99 3300025903 Ga0207680_10003566 Ga0207680_100035663 222
100 3300025903 Ga0207680_10462608 Ga0207680_104626081 222
101 3300025909 Ga0207705_10443359 Ga0207705_104433592 222
102 3300025911 Ga0207654_10009257 Ga0207654_100092573 222
103 3300025911 Ga0207654_10455666 Ga0207654_104556661 222
104 3300025913 Ga0207695_10039419 Ga0207695_100394195 222
105 3300025913 Ga0207695_10331238 Ga0207695_103312382 222
106 3300025913 Ga0207695_10383871 Ga0207695_103838712 222
107 3300025913 Ga0207695_10803230 Ga0207695_108032301 222
108 3300025916 Ga0207663_10400352 Ga0207663_104003522 222
109 3300025919 Ga0207657_10007135 Ga0207657_100071357 222
110 3300025921 Ga0207652_10199228 Ga0207652_101992282 222
111 3300025921 Ga0207652_10662378 Ga0207652_106623781 222
112 3300025924 Ga0207694_10104513 Ga0207694_101045134 222
113 3300025924 Ga0207694_10192887 Ga0207694_101928872 222
114 3300025927 Ga0207687_10164813 Ga0207687_101648132 222
115 3300025932 Ga0207690_10091545 Ga0207690_100915451 222
116 3300025933 Ga0207706_10319195 Ga0207706_103191952 222
117 3300025934 Ga0207686_10017974 Ga0207686_100179744 222
118 3300025941 Ga0207711_10029220 Ga0207711_100292204 222
119 3300025941 Ga0207711_10135942 Ga0207711_101359422 222
120 3300025941 Ga0207711_10738059 Ga0207711_107380592 222
121 3300025942 Ga0207689_10059472 Ga0207689_100594722 222
122 3300025942 Ga0207689_10623203 Ga0207689_106232032 222
123 3300025949 Ga0207667_10123327 Ga0207667_101233273 222
124 3300025949 Ga0207667_10330879 Ga0207667_103308792 222
125 3300025949 Ga0207667_10610989 Ga0207667_106109892 222
126 3300025986 Ga0207658_10209915 Ga0207658_102099152 222
127 3300026088 Ga0207641_10021216 Ga0207641_100212165 222
128 3300026089 Ga0207648_10009980 Ga0207648_100099803 222
129 3300026116 Ga0207674_10209805 Ga0207674_102098053 222
130 3300026116 Ga0207674_10526521 Ga0207674_105265211 222
131 3300026121 Ga0207683_10027589 Ga0207683_100275896 222
132 3300028379 Ga0268266_10016716 Ga0268266_100167168 222
133 3300028379 Ga0268266_10040266 Ga0268266_100402664 222
134 3300028379 Ga0268266_10055863 Ga0268266_100558633 222
135 3300028381 Ga0268264_10164935 Ga0268264_101649352 222
136 3300028800 Ga0265338_10150228 Ga0265338_101502282 222
137 3300031238 Ga0265332_10065420 Ga0265332_100654202 222
138 3300031240 Ga0265320_10000561 Ga0265320_1000056120 222
139 3300031241 Ga0265325_10024292 Ga0265325_100242923 222
140 3300031241 Ga0265325_10060030 Ga0265325_100600302 222
141 3300031247 Ga0265340_10075636 Ga0265340_100756362 222
142 3300031249 Ga0265339_10050128 Ga0265339_100501282 222
143 3300031250 Ga0265331_10019471 Ga0265331_100194713 222
144 3300031344 Ga0265316_10092029 Ga0265316_100920292 222
145 3300031507 Ga0307509_10182015 Ga0307509_101820152 222
146 3300031595 Ga0265313_10000482 Ga0265313_1000048214 222
147 3300031595 Ga0265313_10024957 Ga0265313_100249576 222
148 3300031711 Ga0265314_10015573 Ga0265314_100155733 222
149 3300031711 Ga0265314_10040254 Ga0265314_100402542 222
150 3300031711 Ga0265314_10311902 Ga0265314_103119021 222
151 3300031712 Ga0265342_10108092 Ga0265342_101080922 222
152 3300033180 Ga0307510_10003618 Ga0307510_1000361814 222
153 3300037418 Ga0395900_0037167 Ga0395900_0037167_3779_4471 222
154 3300039437 Ga0436365_1029241 Ga0436365_1029241_827_1531 222
155 3300039438 Ga0436360_0091358 Ga0436360_0091358_335_1063 222
156 3300046515 Ga0495620_0140041 Ga0495620_0140041_23_706 222
157 3300046539 Ga0495621_0049780 Ga0495621_0049780_269_964 222
158 3300046557 Ga0495622_0007824 Ga0495622_0007824_1004_1693 222
159 3300046690 Ga0495624_0198273 Ga0495624_0198273_180_872 222
160 3300048924 Ga0496121_0001453 Ga0496121_0001453_33228_33920 222
161 3300049570 Ga0501033_0073684 Ga0501033_0073684_795_1487 222
162 3300049570 Ga0501033_0428861 Ga0501033_0428861_204_902 222
163 3300049571 Ga0501034_0140080 Ga0501034_0140080_1148_1840 222
164 3300049571 Ga0501034_0827405 Ga0501034_0827405_101_796 222
165 3300049572 Ga0501036_0058142 Ga0501036_0058142_392_1084 222
166 3300049574 Ga0501038_0185604 Ga0501038_0185604_421_1113 222
167 3300049575 Ga0501039_0161220 Ga0501039_0161220_964_1656 222
168 3300049579 Ga0501043_0247296 Ga0501043_0247296_553_1245 222
169 3300049580 Ga0501046_0001906 Ga0501046_0001906_14165_14857 222
170 3300049581 Ga0501047_0000350 Ga0501047_0000350_26281_26973 222
171 3300049581 Ga0501047_0005770 Ga0501047_0005770_6545_7237 222
172 3300049581 Ga0501047_0041047 Ga0501047_0041047_3090_3782 222
173 3300049581 Ga0501047_0069231 Ga0501047_0069231_856_1554 222
174 3300049586 Ga0501070_0680293 Ga0501070_0680293_38_730 222
175 3300049589 Ga0501073_0441647 Ga0501073_0441647_117_809 222
176 3300049742 Ga0501080_0288033 Ga0501080_0288033_203_895 222
177 3300049742 Ga0501080_0402202 Ga0501080_0402202_335_1027 222
178 3300049822 Ga0501035_0011540 Ga0501035_0011540_2622_3320 222
179 3300049822 Ga0501035_0055396 Ga0501035_0055396_1184_1876 222
180 3300049822 Ga0501035_0126136 Ga0501035_0126136_29_721 222
181 3300049823 Ga0501044_0001970 Ga0501044_0001970_4025_4723 222
182 3300049823 Ga0501044_0049439 Ga0501044_0049439_1102_1794 222
183 3300049823 Ga0501044_0053897 Ga0501044_0053897_1075_1767 222
184 3300049823 Ga0501044_0401056 Ga0501044_0401056_363_1055 222
185 3300049823 Ga0501044_0448268 Ga0501044_0448268_385_1077 222
186 3300049823 Ga0501044_0495869 Ga0501044_0495869_376_1068 222
187 3300049823 Ga0501044_0591104 Ga0501044_0591104_218_910 222
188 3300053086 Ga0500578_0001295 Ga0500578_0001295_2572_3240 222
189 3300053087 Ga0500643_000003 Ga0500643_000003_514996_515688 222
190 3300053103 Ga0500555_016967 Ga0500555_016967_187_885 222
191 3300053119 Ga0500595_001314 Ga0500595_001314_5027_5728 222
192 3300053119 Ga0500595_006462 Ga0500595_006462_513_1205 222
193 3300053119 Ga0500595_028654 Ga0500595_028654_696_1388 222
194 3300053120 Ga0500597_140075 Ga0500597_140075_84_773 222
195 3300053140 Ga0500573_0000008 Ga0500573_0000008_179733_180425 222
196 3300053163 Ga0500639_039988 Ga0500639_039988_81_773 222
197 3300003320 rootH2_10004047 rootH2_100040473 223
198 3300003791 Ga0055530_10013005 Ga0055530_100130052 223
199 3300005262 Ga0065165_1003657 Ga0065165_10036572 223
200 3300005327 Ga0070658_10372176 Ga0070658_103721762 223
201 3300005330 Ga0070690_100127332 Ga0070690_1001273322 223
202 3300005331 Ga0070670_100328082 Ga0070670_1003280822 223
203 3300005335 Ga0070666_10012146 Ga0070666_100121466 223
204 3300005338 Ga0068868_100307652 Ga0068868_1003076522 223
205 3300005341 Ga0070691_10012790 Ga0070691_100127903 223
206 3300005347 Ga0070668_100026014 Ga0070668_1000260145 223
207 3300005347 Ga0070668_100062352 Ga0070668_1000623523 223
208 3300005356 Ga0070674_100012019 Ga0070674_1000120196 223
209 3300005364 Ga0070673_100384456 Ga0070673_1003844562 223
210 3300005366 Ga0070659_100006745 Ga0070659_1000067452 223
211 3300005366 Ga0070659_100427949 Ga0070659_1004279491 223
212 3300005367 Ga0070667_100028660 Ga0070667_1000286606 223
213 3300005441 Ga0070700_100020175 Ga0070700_1000201752 223
214 3300005458 Ga0070681_10250740 Ga0070681_102507402 223
215 3300005459 Ga0068867_100001875 Ga0068867_10000187511 223
216 3300005468 Ga0070707_100056681 Ga0070707_1000566812 223
217 3300005468 Ga0070707_100229420 Ga0070707_1002294202 223
218 3300005539 Ga0068853_100077618 Ga0068853_1000776182 223
219 3300005543 Ga0070672_100021434 Ga0070672_1000214346 223
220 3300005547 Ga0070693_100260655 Ga0070693_1002606552 223
221 3300005548 Ga0070665_100296525 Ga0070665_1002965253 223
222 3300005548 Ga0070665_100330072 Ga0070665_1003300722 223
223 3300005563 Ga0068855_100016375 Ga0068855_1000163755 223
224 3300005563 Ga0068855_100196655 Ga0068855_1001966553 223
225 3300005578 Ga0068854_100322003 Ga0068854_1003220032 223
226 3300005616 Ga0068852_100077434 Ga0068852_1000774343 223
227 3300005617 Ga0068859_100036873 Ga0068859_1000368732 223
228 3300005617 Ga0068859_100162280 Ga0068859_1001622802 223
229 3300005618 Ga0068864_100046099 Ga0068864_1000460992 223
230 3300005719 Ga0068861_100004599 Ga0068861_1000045996 223
231 3300005834 Ga0068851_10061674 Ga0068851_100616742 223
232 3300005841 Ga0068863_100362111 Ga0068863_1003621112 223
233 3300005842 Ga0068858_100061148 Ga0068858_1000611483 223
234 3300005842 Ga0068858_100384128 Ga0068858_1003841282 223
235 3300005843 Ga0068860_100020270 Ga0068860_1000202707 223
236 3300005843 Ga0068860_100192904 Ga0068860_1001929045 223
237 3300005843 Ga0068860_100224726 Ga0068860_1002247263 223
238 3300005844 Ga0068862_100033806 Ga0068862_1000338066 223
239 3300006358 Ga0068871_100114163 Ga0068871_1001141635 223
240 3300006881 Ga0068865_100014910 Ga0068865_1000149102 223
241 3300006931 Ga0097620_100036872 Ga0097620_1000368726 223
242 3300006931 Ga0097620_100162279 Ga0097620_1001622792 223
243 3300009093 Ga0105240_10430734 Ga0105240_104307341 223
244 3300009093 Ga0105240_10465206 Ga0105240_104652062 223
245 3300009093 Ga0105240_10847946 Ga0105240_108479461 223
246 3300009098 Ga0105245_10605312 Ga0105245_106053122 223
247 3300009174 Ga0105241_10027967 Ga0105241_100279673 223
248 3300009174 Ga0105241_10202833 Ga0105241_102028333 223
249 3300009177 Ga0105248_10086028 Ga0105248_100860284 223
250 3300009545 Ga0105237_10075359 Ga0105237_100753594 223
251 3300009551 Ga0105238_10035570 Ga0105238_100355704 223
252 3300009551 Ga0105238_10045293 Ga0105238_100452934 223
253 3300009553 Ga0105249_10531818 Ga0105249_105318182 223
254 3300010375 Ga0105239_10112843 Ga0105239_101128432 223
255 3300010375 Ga0105239_10175588 Ga0105239_101755884 223
256 3300013100 Ga0157373_10059398 Ga0157373_100593982 223
257 3300013104 Ga0157370_10047650 Ga0157370_100476504 223
258 3300013105 Ga0157369_10038375 Ga0157369_100383756 223
259 3300013297 Ga0157378_10001232 Ga0157378_100012324 223
260 3300013297 Ga0157378_10041956 Ga0157378_100419563 223
261 3300013306 Ga0163162_10045427 Ga0163162_100454272 223
262 3300013307 Ga0157372_10036093 Ga0157372_100360933 223
263 3300013308 Ga0157375_10761020 Ga0157375_107610202 223
264 3300014325 Ga0163163_10172849 Ga0163163_101728492 223
265 3300014326 Ga0157380_10398294 Ga0157380_103982942 223
266 3300014969 Ga0157376_10717248 Ga0157376_107172482 223
267 3300025273 Ga0209673_1018609 Ga0209673_10186092 223
268 3300025298 Ga0209050_1000489 Ga0209050_100048951 223
269 3300025303 Ga0209051_1011385 Ga0209051_10113853 223
270 3300025321 Ga0207656_10150937 Ga0207656_101509372 223
271 3300025903 Ga0207680_10032044 Ga0207680_100320443 223
272 3300025907 Ga0207645_10026229 Ga0207645_100262292 223
273 3300025909 Ga0207705_10000130 Ga0207705_1000013053 223
274 3300025912 Ga0207707_10000839 Ga0207707_100008393 223
275 3300025913 Ga0207695_10186200 Ga0207695_101862003 223
276 3300025913 Ga0207695_10637007 Ga0207695_106370071 223
277 3300025917 Ga0207660_10004518 Ga0207660_100045183 223
278 3300025922 Ga0207646_10004423 Ga0207646_100044233 223
279 3300025924 Ga0207694_10081790 Ga0207694_100817903 223
280 3300025937 Ga0207669_10345510 Ga0207669_103455101 223
281 3300025941 Ga0207711_10362855 Ga0207711_103628552 223
282 3300025949 Ga0207667_10025262 Ga0207667_100252622 223
283 3300025972 Ga0207668_10019038 Ga0207668_100190382 223
284 3300025981 Ga0207640_10094014 Ga0207640_100940142 223
285 3300025986 Ga0207658_10027614 Ga0207658_100276142 223
286 3300025986 Ga0207658_10081440 Ga0207658_100814402 223
287 3300025986 Ga0207658_10151261 Ga0207658_101512612 223
288 3300026023 Ga0207677_10098991 Ga0207677_100989911 223
289 3300026035 Ga0207703_10079664 Ga0207703_100796642 223
290 3300026035 Ga0207703_10087580 Ga0207703_100875802 223
291 3300026089 Ga0207648_10267114 Ga0207648_102671141 223
292 3300026142 Ga0207698_10050450 Ga0207698_100504504 223
293 3300028381 Ga0268264_10078985 Ga0268264_100789854 223
294 3300028800 Ga0265338_10090729 Ga0265338_100907292 223
295 3300031235 Ga0265330_10138510 Ga0265330_101385102 223
296 3300031235 Ga0265330_10146877 Ga0265330_101468772 223
297 3300031247 Ga0265340_10006654 Ga0265340_100066543 223
298 3300031251 Ga0265327_10121495 Ga0265327_101214951 223
299 3300031344 Ga0265316_10344448 Ga0265316_103444482 223
300 3300031456 Ga0307513_10444498 Ga0307513_104444982 223
301 3300031711 Ga0265314_10003381 Ga0265314_1000338112 223
302 3300048088 Ga0495602_0309488 Ga0495602_0309488_402_1073 223
303 3300048918 Ga0496115_0714458 Ga0496115_0714458_13_726 223
304 3300049573 Ga0501037_0127606 Ga0501037_0127606_864_1571 223
305 3300050493 nmdc:mga0k408_90969_c1 nmdc:mga0k408_90969_c1_390_1061 223
306 3300050496 nmdc:mga07m45_2404_c1 nmdc:mga07m45_2404_c1_7124_7795 223
307 3300003215 JGI25153J46596_10000416 JGI25153J46596_1000041612 224
308 3300005327 Ga0070658_10331862 Ga0070658_103318622 224
309 3300005328 Ga0070676_10033601 Ga0070676_100336012 224
310 3300005338 Ga0068868_100159051 Ga0068868_1001590512 224
311 3300005355 Ga0070671_100151684 Ga0070671_1001516842 224
312 3300005366 Ga0070659_100280856 Ga0070659_1002808562 224
313 3300005367 Ga0070667_100145405 Ga0070667_1001454052 224
314 3300005455 Ga0070663_100163171 Ga0070663_1001631711 224
315 3300005457 Ga0070662_100060316 Ga0070662_1000603162 224
316 3300005467 Ga0070706_100007193 Ga0070706_10000719310 224
317 3300005518 Ga0070699_100185351 Ga0070699_1001853511 224
318 3300005539 Ga0068853_100098728 Ga0068853_1000987283 224
319 3300005564 Ga0070664_100321885 Ga0070664_1003218852 224
320 3300005577 Ga0068857_100027756 Ga0068857_1000277564 224
321 3300005578 Ga0068854_100009422 Ga0068854_1000094226 224
322 3300005578 Ga0068854_100147092 Ga0068854_1001470922 224
323 3300005618 Ga0068864_100008633 Ga0068864_1000086338 224
324 3300005840 Ga0068870_10584112 Ga0068870_105841121 224
325 3300006038 Ga0075365_10117546 Ga0075365_101175462 224
326 3300006038 Ga0075365_10431313 Ga0075365_104313131 224
327 3300006042 Ga0075368_10187238 Ga0075368_101872382 224
328 3300006048 Ga0075363_100081475 Ga0075363_1000814752 224
329 3300006177 Ga0075362_10024768 Ga0075362_100247682 224
330 3300006177 Ga0075362_10034311 Ga0075362_100343113 224
331 3300006178 Ga0075367_10002766 Ga0075367_100027667 224
332 3300006186 Ga0075369_10094035 Ga0075369_100940352 224
333 3300006195 Ga0075366_10051499 Ga0075366_100514992 224
334 3300006195 Ga0075366_10141910 Ga0075366_101419102 224
335 3300006353 Ga0075370_10002638 Ga0075370_100026382 224
336 3300006353 Ga0075370_10004382 Ga0075370_100043827 224
337 3300006353 Ga0075370_10039537 Ga0075370_100395372 224
338 3300006353 Ga0075370_10043334 Ga0075370_100433343 224
339 3300006353 Ga0075370_10051345 Ga0075370_100513452 224
340 3300006353 Ga0075370_10088376 Ga0075370_100883762 224
341 3300009093 Ga0105240_10025185 Ga0105240_100251856 224
342 3300009098 Ga0105245_10077638 Ga0105245_100776383 224
343 3300009098 Ga0105245_10877790 Ga0105245_108777901 224
344 3300009148 Ga0105243_10658464 Ga0105243_106584641 224
345 3300009545 Ga0105237_10004426 Ga0105237_1000442611 224
346 3300010375 Ga0105239_10130362 Ga0105239_101303622 224
347 3300025297 Ga0209758_1000304 Ga0209758_100030433 224
348 3300025908 Ga0207643_10461204 Ga0207643_104612041 224
349 3300025909 Ga0207705_10349134 Ga0207705_103491342 224
350 3300025910 Ga0207684_10002617 Ga0207684_100026177 224
351 3300025913 Ga0207695_10581315 Ga0207695_105813151 224
352 3300025914 Ga0207671_10037184 Ga0207671_100371842 224
353 3300025927 Ga0207687_10161090 Ga0207687_101610902 224
354 3300025931 Ga0207644_10275667 Ga0207644_102756672 224
355 3300025933 Ga0207706_10059009 Ga0207706_100590092 224
356 3300025938 Ga0207704_10229891 Ga0207704_102298912 224
357 3300025986 Ga0207658_10146773 Ga0207658_101467732 224
358 3300026023 Ga0207677_10196208 Ga0207677_101962082 224
359 3300026035 Ga0207703_10181384 Ga0207703_101813842 224
360 3300026041 Ga0207639_10128543 Ga0207639_101285433 224
361 3300026067 Ga0207678_10124787 Ga0207678_101247872 224
362 3300026089 Ga0207648_10121845 Ga0207648_101218452 224
363 3300026095 Ga0207676_10239963 Ga0207676_102399632 224
364 3300026116 Ga0207674_10024174 Ga0207674_100241742 224
365 3300026118 Ga0207675_100218230 Ga0207675_1002182302 224
366 3300028786 Ga0307517_10000394 Ga0307517_1000039415 224
367 3300028786 Ga0307517_10106629 Ga0307517_101066292 224
368 3300028786 Ga0307517_10282095 Ga0307517_102820952 224
369 3300028794 Ga0307515_10126153 Ga0307515_101261533 224
370 3300028794 Ga0307515_10194131 Ga0307515_101941312 224
371 3300030522 Ga0307512_10015509 Ga0307512_100155096 224
372 3300030522 Ga0307512_10252162 Ga0307512_102521621 224
373 3300031456 Ga0307513_10067876 Ga0307513_100678762 224
374 3300031456 Ga0307513_10173622 Ga0307513_101736222 224
375 3300031456 Ga0307513_10191105 Ga0307513_101911052 224
376 3300031456 Ga0307513_10249245 Ga0307513_102492452 224
377 3300031507 Ga0307509_10000950 Ga0307509_1000095036 224
378 3300031507 Ga0307509_10020699 Ga0307509_100206992 224
379 3300031507 Ga0307509_10036100 Ga0307509_100361005 224
380 3300031616 Ga0307508_10000150 Ga0307508_1000015088 224
381 3300031616 Ga0307508_10000912 Ga0307508_1000091210 224
382 3300031649 Ga0307514_10026860 Ga0307514_100268603 224
383 3300031730 Ga0307516_10120325 Ga0307516_101203252 224
384 3300031730 Ga0307516_10318037 Ga0307516_103180372 224
385 3300031838 Ga0307518_10099014 Ga0307518_100990142 224
386 3300033180 Ga0307510_10041561 Ga0307510_100415612 224
387 3300033180 Ga0307510_10083991 Ga0307510_100839912 224
388 3300033180 Ga0307510_10153269 Ga0307510_101532692 224
389 3300035084 Ga0373928_0018448 Ga0373928_0018448_183_857 224
390 3300035691 Ga0373931_0019380 Ga0373931_0019380_2359_3033 224
391 3300039450 Ga0436363_0818177 Ga0436363_0818177_1892_2569 224
392 3300041512 Ga0451853_2462852 Ga0451853_2462852_10_684 224
393 3300042127 Ga0450890_030284 Ga0450890_030284_30_704 224
394 3300042876 Ga0451577_0000058 Ga0451577_0000058_210677_211351 224
395 3300042876 Ga0451577_0005288 Ga0451577_0005288_885_1568 224
396 3300042876 Ga0451577_0578387 Ga0451577_0578387_266_949 224
397 3300044673 Ga0453683_0019776 Ga0453683_0019776_1016_1699 224
398 3300044712 Ga0453684_0000122 Ga0453684_0000122_87252_87926 224
399 3300044712 Ga0453684_0009178 Ga0453684_0009178_308_991 224
400 3300044712 Ga0453684_0133738 Ga0453684_0133738_1408_2091 224
401 3300045051 Ga0451576_0018914 Ga0451576_0018914_1420_2103 224
402 3300046454 Ga0495592_0000490 Ga0495592_0000490_17140_17817 224
403 3300046460 Ga0495638_0021926 Ga0495638_0021926_1805_2479 224
404 3300046471 Ga0495650_0003109 Ga0495650_0003109_9283_9963 224
405 3300046517 Ga0495630_0046979 Ga0495630_0046979_2030_2704 224
406 3300046518 Ga0495631_0105569 Ga0495631_0105569_339_1058 224
407 3300046519 Ga0495632_0005244 Ga0495632_0005244_3399_4073 224
408 3300046519 Ga0495632_0010408 Ga0495632_0010408_233_952 224
409 3300046648 Ga0495611_0120420 Ga0495611_0120420_260_934 224
410 3300046660 Ga0495625_0011335 Ga0495625_0011335_1141_1863 224
411 3300046680 Ga0495646_0179874 Ga0495646_0179874_419_1096 224
412 3300046683 Ga0495658_0015942 Ga0495658_0015942_1507_2181 224
413 3300046694 Ga0495649_0002567 Ga0495649_0002567_11271_11990 224
414 3300046810 Ga0495660_0013939 Ga0495660_0013939_1647_2366 224
415 3300047443 Ga0495687_047308 Ga0495687_047308_511_1233 224
416 3300047443 Ga0495687_055415 Ga0495687_055415_511_1230 224
417 3300047673 Ga0495593_0018004 Ga0495593_0018004_2613_3287 224
418 3300048091 Ga0495626_0016219 Ga0495626_0016219_821_1540 224
419 3300048909 Ga0496106_0011322 Ga0496106_0011322_797_1474 224
420 3300050490 nmdc:mga03n38_202399_c1 nmdc:mga03n38_202399_c1_11_727 224
421 3300050492 nmdc:mga0yw44_93689_c1 nmdc:mga0yw44_93689_c1_294_1010 224
422 3300050493 nmdc:mga0k408_11609_c1 nmdc:mga0k408_11609_c1_2131_2847 224
423 3300050493 nmdc:mga0k408_222915_c1 nmdc:mga0k408_222915_c1_324_1043 224
424 3300050493 nmdc:mga0k408_298964_c1 nmdc:mga0k408_298964_c1_135_809 224
425 3300050493 nmdc:mga0k408_3927_c1 nmdc:mga0k408_3927_c1_1181_1900 224
426 3300050493 nmdc:mga0k408_6987_c1 nmdc:mga0k408_6987_c1_1409_2125 224
427 3300050494 nmdc:mga06z11_3635_c1 nmdc:mga06z11_3635_c1_4657_5376 224
428 3300050494 nmdc:mga06z11_48079_c1 nmdc:mga06z11_48079_c1_427_1143 224
429 3300050496 nmdc:mga07m45_10314_c3 nmdc:mga07m45_10314_c3_802_1476 224
430 3300050496 nmdc:mga07m45_11861_c1 nmdc:mga07m45_11861_c1_989_1705 224
431 3300050496 nmdc:mga07m45_26810_c1 nmdc:mga07m45_26810_c1_1038_1751 224
432 3300050496 nmdc:mga07m45_341934_c1 nmdc:mga07m45_341934_c1_39_755 224
433 3300050496 nmdc:mga07m45_40295_c1 nmdc:mga07m45_40295_c1_582_1307 224
434 3300050496 nmdc:mga07m45_52421_c1 nmdc:mga07m45_52421_c1_1371_2186 224
435 3300050516 nmdc:mga0sz30_30037_c2 nmdc:mga0sz30_30037_c2_31_750 224
436 3300053090 Ga0500646_0011069 Ga0500646_0011069_143_817 224
437 3300053093 Ga0500651_0020230 Ga0500651_0020230_2626_3300 224
438 3300053098 Ga0500650_0061861 Ga0500650_0061861_961_1635 224
439 3300053129 Ga0500628_000765 Ga0500628_000765_1472_2146 224
440 3300053130 Ga0500642_0033443 Ga0500642_0033443_83_757 224
441 3300053131 Ga0500652_002286 Ga0500652_002286_2790_3464 224
442 3300053134 Ga0500658_0002203 Ga0500658_0002203_2501_3223 224
443 3300053139 Ga0500568_0008143 Ga0500568_0008143_2526_3263 224
444 3300053142 Ga0500577_0004058 Ga0500577_0004058_1385_2059 224
445 3300053156 Ga0500622_0000146 Ga0500622_0000146_31563_32237 224
446 3300053730 Ga0500645_021359 Ga0500645_021359_1165_1842 224
447 3300002773 JGI25152J39213_1006292 JGI25152J39213_10062923 225
448 3300003215 JGI25153J46596_10001498 JGI25153J46596_100014987 225
449 3300003771 Ga0055526_1001078 Ga0055526_100107819 225
450 3300005295 Ga0065707_10110887 Ga0065707_101108873 225
451 3300025245 Ga0207425_1003634 Ga0207425_10036344 225
452 3300025258 Ga0209129_1000113 Ga0209129_100011396 225
453 3300025295 Ga0209564_1000186 Ga0209564_100018696 225
454 3300025297 Ga0209758_1000172 Ga0209758_100017296 225
455 3300025299 Ga0209256_1017432 Ga0209256_10174322 225
456 3300035083 Ga0373926_0022809 Ga0373926_0022809_263_979 225
457 3300035171 Ga0373946_0030113 Ga0373946_0030113_704_1420 225
458 3300037068 Ga0373925_0007849 Ga0373925_0007849_1988_2704 225
459 3300046457 Ga0495590_0037894 Ga0495590_0037894_608_1339 225
460 3300046810 Ga0495660_0040208 Ga0495660_0040208_1474_2205 225
461 3300049590 Ga0501074_0318783 Ga0501074_0318783_200_985 225

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

46

195

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9575 6 225
7w7a-assembly2.cif.gz_E heme exporter in complex with mn-containing protoporphyrin ix, mn-anomalous data 0.9564 5 222
7w7b-assembly2.cif.gz_G heme exporter hrtba in complex with protoporphyrin ix containing manganese(iii), high resolution data 0.9506 4 224
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9498 4 225
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9486 4 225
ID Description Score Start End Superfamily
af_A4I4M8_123_401_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9531 32 225 3.40.50.300
af_Q8T665_1_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9525 4 225 3.40.50.300
af_Q4DP20_46_317_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9518 4 225 3.40.50.300
2pclA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9515 4 225 3.40.50.300
af_O05779_1_226_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9502 5 225 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2T2QVM2-F1-model_v4 Macrolide ABC transporter ATP-binding protein 0.9562 4 224 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A249L385-F1-model_v4 Cell division ATP-binding protein FtsE 0.9516 6 225 GO:0005524
GO:0005886
GO:0016887
GO:0022857
GO:0051301
AF-A0A7U6KJ76-F1-model_v4 ABC transporter, ATP-binding protein 0.9511 4 221 GO:0005524
GO:0016887
AF-A0A6J6SH26-F1-model_v4 Cell division ATP-binding protein FtsE 0.9498 6 225 GO:0005524
GO:0005886
GO:0016887
GO:0022857
GO:0051301
AF-A0A553SR16-F1-model_v4 MFS transporter 0.9495 73 212 GO:0005524
GO:0005886
GO:0016887
GO:0033232

Feature Viewer

pLDDT pTM Quality
93.19 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map