F448788

General Info

Members Datasets Scaffolds Average Seq Length
461 172 460 362

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0047341|Ga0466967_0047341_1690_2793
Length 367
Sequence MINLAFFPSRRLAFYMVRLFLTRSLAVLVALVLVLMTLDLLGEAGKILAVPGNGDAQLWHYVALRIPLLTSRFLPFSVLLGTLIAFVGLNQHSEVVAMKAAGLSAHQILAPLVIASIGIAAALFAFDELVVVNSARVVDAWSDNDYKPIPPASGVVGNVWLLNTDDLIQAKLVSGSGPRMLAQGVSIYDRSGGVLQRVIQAARAVPSPQSRDWRLEDVKIYDANMNVVRHLPEMQAMPGVTPAQLTLARVDPTELNYWTLKRRIDELEAAGRPTDEARAGLAHKISGPLSTLLMPLLAAVAAFGLARSGQVLLRAAVGMALGFAYFVADNFSLAMGNAGAYPPMIAAWAPFLLFLLIGETVLVRTEE

Samples

Sample ID Description Type Environment
1 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
114 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
115 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
116 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
117 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
125 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
133 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
134 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
135 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
136 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
137 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
138 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
139 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
140 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
141 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
149 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
150 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
151 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
152 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
153 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
154 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
155 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
167 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
168 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
169 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
170 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
171 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
172 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 4.77
Rhizosphere 94.36
Stem 0
Stem Tuber 0.22
Unclassified 0.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10036444 3300001979 Bacteria 1528
2 JGI24737J22298_10013612 3300001990 Bacteria 2646
3 JGI24735J21928_10002483 3300002067 Bacteria 6400
4 JGI24735J21928_10010719 3300002067 Bacteria 2916
5 Ga0065707_10158544 3300005295 Bacteria 1586
6 Ga0070658_10009142 3300005327 Bacteria 7966
7 Ga0070658_10011098 3300005327 Bacteria 7223
8 Ga0070658_10026334 3300005327 Bacteria 4665
9 Ga0070658_10042892 3300005327 Bacteria 3654
10 Ga0070658_10134085 3300005327 Bacteria 2065
11 Ga0070676_10021355 3300005328 Bacteria 3625
12 Ga0070676_10107385 3300005328 Bacteria 1733
13 Ga0070670_100023778 3300005331 Bacteria 5272
14 Ga0070670_100056672 3300005331 Bacteria 3363
15 Ga0070670_100124027 3300005331 Bacteria 2229
16 Ga0070677_10012509 3300005333 Bacteria 2947
17 Ga0070666_10001550 3300005335 Bacteria 13958
18 Ga0070666_10012588 3300005335 Bacteria 5342
19 Ga0070666_10137139 3300005335 Bacteria 1703
20 Ga0070666_10234836 3300005335 Bacteria 1296
21 Ga0070680_100004527 3300005336 Bacteria 10467
22 Ga0068868_100002343 3300005338 Bacteria 13104
23 Ga0068868_100065915 3300005338 Bacteria 2878
24 Ga0070660_100003460 3300005339 Bacteria 10868
25 Ga0070660_100009551 3300005339 Bacteria 6829
26 Ga0070660_100017135 3300005339 Bacteria 5274
27 Ga0070660_100067179 3300005339 Bacteria 2793
28 Ga0070660_100173800 3300005339 Bacteria 1741
29 Ga0070661_100014219 3300005344 Bacteria 5607
30 Ga0070661_100026078 3300005344 Bacteria 4200
31 Ga0070661_100049220 3300005344 Bacteria 3085
32 Ga0070668_100361393 3300005347 Bacteria 1231
33 Ga0070675_100006027 3300005354 Bacteria 9288
34 Ga0070675_100078966 3300005354 Bacteria 2742
35 Ga0070675_100099351 3300005354 Bacteria 2449
36 Ga0070671_100002863 3300005355 Bacteria 13424
37 Ga0070671_100002968 3300005355 Bacteria 13201
38 Ga0070671_100004366 3300005355 Bacteria 11182
39 Ga0070671_100015012 3300005355 Bacteria 6255
40 Ga0070674_100017574 3300005356 Bacteria 4504
41 Ga0070674_100018834 3300005356 Bacteria 4374
42 Ga0070674_100035667 3300005356 Bacteria 3333
43 Ga0070674_100123110 3300005356 Bacteria 1922
44 Ga0070673_100089700 3300005364 Bacteria 2510
45 Ga0070659_100001753 3300005366 Bacteria 15585
46 Ga0070659_100002004 3300005366 Bacteria 14545
47 Ga0070659_100016450 3300005366 Bacteria 5554
48 Ga0070659_100057081 3300005366 Bacteria 3078
49 Ga0070659_100096172 3300005366 Bacteria 2379
50 Ga0070659_100098578 3300005366 Bacteria 2350
51 Ga0070659_100152904 3300005366 Bacteria 1883
52 Ga0070667_100002750 3300005367 Bacteria 15219
53 Ga0070667_100145155 3300005367 Bacteria 2081
54 Ga0070714_100032704 3300005435 Bacteria 4344
55 Ga0070714_100071127 3300005435 Bacteria 3007
56 Ga0070714_100168462 3300005435 Bacteria 1986
57 Ga0070713_100006844 3300005436 Bacteria 7944
58 Ga0070713_100048894 3300005436 Bacteria 3485
59 Ga0070663_100002833 3300005455 Bacteria 9849
60 Ga0070663_100032971 3300005455 Bacteria 3575
61 Ga0070663_100069420 3300005455 Bacteria 2560
62 Ga0070662_100000513 3300005457 Bacteria 23294
63 Ga0070662_100002965 3300005457 Bacteria 10548
64 Ga0070662_100013967 3300005457 Bacteria 5351
65 Ga0070662_100052037 3300005457 Bacteria 2959
66 Ga0070662_100060117 3300005457 Bacteria 2770
67 Ga0070662_100065899 3300005457 Bacteria 2656
68 Ga0070662_100133404 3300005457 Bacteria 1918
69 Ga0068867_100056646 3300005459 Bacteria 2900
70 Ga0068867_100175235 3300005459 Bacteria 1701
71 Ga0070685_10157710 3300005466 Bacteria 1444
72 Ga0070679_100047584 3300005530 Bacteria 4274
73 Ga0070679_100306342 3300005530 Bacteria 1539
74 Ga0068853_100413643 3300005539 Bacteria 1264
75 Ga0070672_100002918 3300005543 Bacteria 10997
76 Ga0070672_100020345 3300005543 Bacteria 4839
77 Ga0070672_100022445 3300005543 Bacteria 4637
78 Ga0070672_100100502 3300005543 Bacteria 2346
79 Ga0070672_100249521 3300005543 Bacteria 1494
80 Ga0070665_100021002 3300005548 Bacteria 6564
81 Ga0070665_100023887 3300005548 Bacteria 6158
82 Ga0070665_100045231 3300005548 Bacteria 4421
83 Ga0068855_100015155 3300005563 Bacteria 9283
84 Ga0068855_100028359 3300005563 Bacteria 6697
85 Ga0068855_100175876 3300005563 Bacteria 2422
86 Ga0068855_100193285 3300005563 Bacteria 2294
87 Ga0070664_100003721 3300005564 Bacteria 12292
88 Ga0070664_100004827 3300005564 Bacteria 10798
89 Ga0070664_100005219 3300005564 Bacteria 10417
90 Ga0070664_100038561 3300005564 Bacteria 4023
91 Ga0070664_100086016 3300005564 Bacteria 2716
92 Ga0068857_100017400 3300005577 Bacteria 6299
93 Ga0068857_100018151 3300005577 Bacteria 6171
94 Ga0068857_100089798 3300005577 Bacteria 2749
95 Ga0068854_100004964 3300005578 Bacteria 8385
96 Ga0068854_100170770 3300005578 Bacteria 1692
97 Ga0068854_100243653 3300005578 Bacteria 1433
98 Ga0068856_100053048 3300005614 Bacteria 3999
99 Ga0068852_100000873 3300005616 Bacteria 19972
100 Ga0068852_100029771 3300005616 Bacteria 4488
101 Ga0068852_100074550 3300005616 Bacteria 2989
102 Ga0068852_100110110 3300005616 Bacteria 2502
103 Ga0068852_100253859 3300005616 Bacteria 1686
104 Ga0068859_100059901 3300005617 Bacteria 3836
105 Ga0068864_100008287 3300005618 Bacteria 8572
106 Ga0068866_10015285 3300005718 Bacteria 3407
107 Ga0068861_100044450 3300005719 Bacteria 3340
108 Ga0068863_100039885 3300005841 Bacteria 4465
109 Ga0068858_100004720 3300005842 Bacteria 13342
110 Ga0081539_10026310 3300005985 Bacteria 3716
111 Ga0081539_10045601 3300005985 Bacteria 2519
112 Ga0070716_100222565 3300006173 Bacteria 1269
113 Ga0070712_100046258 3300006175 Bacteria 3008
114 Ga0097621_100015473 3300006237 Bacteria 5740
115 Ga0068871_100181450 3300006358 Bacteria 1809
116 Ga0075431_100011561 3300006847 Bacteria 8904
117 Ga0068865_100205581 3300006881 Bacteria 1531
118 Ga0097620_100059901 3300006931 Bacteria 3836
119 Ga0105245_10030338 3300009098 Bacteria 4780
120 Ga0105245_10243605 3300009098 Bacteria 1744
121 Ga0105245_10288827 3300009098 Bacteria 1606
122 Ga0105243_10118396 3300009148 Bacteria 2228
123 Ga0105241_10107938 3300009174 Bacteria 2224
124 Ga0105248_10002097 3300009177 Bacteria 22084
125 Ga0105248_10019537 3300009177 Bacteria 7499
126 Ga0105248_10111250 3300009177 Bacteria 3089
127 Ga0105248_10145038 3300009177 Bacteria 2679
128 Ga0105248_10182023 3300009177 Bacteria 2368
129 Ga0105248_10320133 3300009177 Bacteria 1747
130 Ga0105237_10027818 3300009545 Bacteria 5762
131 Ga0105237_10175021 3300009545 Bacteria 2146
132 Ga0157373_10009971 3300013100 Bacteria 7000
133 Ga0157373_10010407 3300013100 Bacteria 6842
134 Ga0157373_10040217 3300013100 Bacteria 3346
135 Ga0157371_10010504 3300013102 Bacteria 7200
136 Ga0157371_10027607 3300013102 Bacteria 4116
137 Ga0157371_10049670 3300013102 Bacteria 2979
138 Ga0157371_10081885 3300013102 Bacteria 2285
139 Ga0157370_10003273 3300013104 Bacteria 19092
140 Ga0157370_10127249 3300013104 Bacteria 2378
141 Ga0157370_10162209 3300013104 Bacteria 2080
142 Ga0157369_10001571 3300013105 Bacteria 27954
143 Ga0157369_10053506 3300013105 Bacteria 4363
144 Ga0157369_10338248 3300013105 Bacteria 1564
145 Ga0157378_10028456 3300013297 Bacteria 4931
146 Ga0157378_10232464 3300013297 Bacteria 1757
147 Ga0163162_10112104 3300013306 Bacteria 2826
148 Ga0157372_10025167 3300013307 Bacteria 6468
149 Ga0157372_10031759 3300013307 Bacteria 5785
150 Ga0157372_10064461 3300013307 Bacteria 4111
151 Ga0157372_10158344 3300013307 Bacteria 2616
152 Ga0157375_10004450 3300013308 Bacteria 12166
153 Ga0157380_10013211 3300014326 Bacteria 6014
154 Ga0157380_10014919 3300014326 Bacteria 5697
155 Ga0157380_10027730 3300014326 Bacteria 4310
156 Ga0157380_10463310 3300014326 Bacteria 1221
157 Ga0157377_10106144 3300014745 Bacteria 1682
158 Ga0163161_10017595 3300017792 Bacteria 5004
159 Ga0163161_10042729 3300017792 Bacteria 3262
160 Ga0207656_10012002 3300025321 Bacteria 3286
161 Ga0207682_10003272 3300025893 Bacteria 7085
162 Ga0207682_10021935 3300025893 Bacteria 2513
163 Ga0207642_10002708 3300025899 Bacteria 5533
164 Ga0207642_10052703 3300025899 Bacteria 1847
165 Ga0207688_10005472 3300025901 Bacteria 6906
166 Ga0207680_10009702 3300025903 Bacteria 4787
167 Ga0207680_10011013 3300025903 Bacteria 4551
168 Ga0207680_10100039 3300025903 Bacteria 1861
169 Ga0207680_10130747 3300025903 Bacteria 1654
170 Ga0207647_10022826 3300025904 Bacteria 4150
171 Ga0207647_10039478 3300025904 Bacteria 2977
172 Ga0207645_10011912 3300025907 Bacteria 5918
173 Ga0207645_10022812 3300025907 Bacteria 4069
174 Ga0207643_10104384 3300025908 Bacteria 1664
175 Ga0207705_10002565 3300025909 Bacteria 13966
176 Ga0207705_10009543 3300025909 Bacteria 7061
177 Ga0207705_10162072 3300025909 Bacteria 1680
178 Ga0207695_10201233 3300025913 Bacteria 1906
179 Ga0207693_10025441 3300025915 Bacteria 4693
180 Ga0207660_10000059 3300025917 Bacteria 56766
181 Ga0207657_10001318 3300025919 Bacteria 26369
182 Ga0207657_10002036 3300025919 Bacteria 21865
183 Ga0207657_10007817 3300025919 Bacteria 10914
184 Ga0207657_10037304 3300025919 Bacteria 4341
185 Ga0207657_10043044 3300025919 Bacteria 3980
186 Ga0207649_10007074 3300025920 Bacteria 6093
187 Ga0207649_10019851 3300025920 Bacteria 3847
188 Ga0207649_10090845 3300025920 Bacteria 1999
189 Ga0207652_10027123 3300025921 Bacteria 4773
190 Ga0207681_10029297 3300025923 Bacteria 3574
191 Ga0207694_10002110 3300025924 Bacteria 16396
192 Ga0207650_10009574 3300025925 Bacteria 6626
193 Ga0207650_10013470 3300025925 Bacteria 5663
194 Ga0207650_10091137 3300025925 Bacteria 2329
195 Ga0207659_10002600 3300025926 Bacteria 10750
196 Ga0207659_10365966 3300025926 Bacteria 1199
197 Ga0207644_10000960 3300025931 Bacteria 18405
198 Ga0207644_10001058 3300025931 Bacteria 17593
199 Ga0207644_10001995 3300025931 Bacteria 13214
200 Ga0207644_10003712 3300025931 Bacteria 9889
201 Ga0207644_10005104 3300025931 Bacteria 8574
202 Ga0207690_10002468 3300025932 Bacteria 11176
203 Ga0207690_10013257 3300025932 Bacteria 4949
204 Ga0207690_10061728 3300025932 Bacteria 2549
205 Ga0207690_10096573 3300025932 Bacteria 2101
206 Ga0207690_10154936 3300025932 Bacteria 1702
207 Ga0207690_10164835 3300025932 Bacteria 1655
208 Ga0207706_10001436 3300025933 Bacteria 23850
209 Ga0207706_10023100 3300025933 Bacteria 5585
210 Ga0207706_10025601 3300025933 Bacteria 5285
211 Ga0207706_10032125 3300025933 Bacteria 4674
212 Ga0207706_10033418 3300025933 Bacteria 4579
213 Ga0207706_10046285 3300025933 Bacteria 3852
214 Ga0207706_10057998 3300025933 Bacteria 3411
215 Ga0207706_10078398 3300025933 Bacteria 2905
216 Ga0207706_10101701 3300025933 Bacteria 2529
217 Ga0207706_10107058 3300025933 Bacteria 2460
218 Ga0207691_10000954 3300025940 Bacteria 28639
219 Ga0207691_10006076 3300025940 Bacteria 11667
220 Ga0207691_10022747 3300025940 Bacteria 5909
221 Ga0207691_10036043 3300025940 Bacteria 4585
222 Ga0207691_10103148 3300025940 Bacteria 2543
223 Ga0207711_10002646 3300025941 Bacteria 15840
224 Ga0207711_10008690 3300025941 Bacteria 8497
225 Ga0207711_10009269 3300025941 Bacteria 8217
226 Ga0207689_10028006 3300025942 Bacteria 4713
227 Ga0207679_10013031 3300025945 Bacteria 5441
228 Ga0207679_10090516 3300025945 Bacteria 2365
229 Ga0207667_10006779 3300025949 Bacteria 13834
230 Ga0207667_10047827 3300025949 Bacteria 4526
231 Ga0207667_10054220 3300025949 Bacteria 4217
232 Ga0207667_10178681 3300025949 Bacteria 2180
233 Ga0207667_10279726 3300025949 Bacteria 1705
234 Ga0207651_10000289 3300025960 Bacteria 21606
235 Ga0207651_10008652 3300025960 Bacteria 5512
236 Ga0207651_10017630 3300025960 Bacteria 4223
237 Ga0207651_10087413 3300025960 Bacteria 2269
238 Ga0207712_10118235 3300025961 Bacteria 2000
239 Ga0207640_10044139 3300025981 Bacteria 2854
240 Ga0207658_10005082 3300025986 Bacteria 9050
241 Ga0207658_10047319 3300025986 Bacteria 3147
242 Ga0207658_10129421 3300025986 Bacteria 2026
243 Ga0207677_10005629 3300026023 Bacteria 6809
244 Ga0207677_10124452 3300026023 Bacteria 1945
245 Ga0207703_10002884 3300026035 Bacteria 14642
246 Ga0207703_10074462 3300026035 Bacteria 2812
247 Ga0207639_10000355 3300026041 Bacteria 31674
248 Ga0207678_10012732 3300026067 Bacteria 7386
249 Ga0207678_10037178 3300026067 Bacteria 4237
250 Ga0207678_10055365 3300026067 Bacteria 3417
251 Ga0207678_10067527 3300026067 Bacteria 3069
252 Ga0207678_10090804 3300026067 Bacteria 2611
253 Ga0207678_10152460 3300026067 Bacteria 1974
254 Ga0207702_10091830 3300026078 Bacteria 2659
255 Ga0207641_10022117 3300026088 Bacteria 5232
256 Ga0207641_10077587 3300026088 Bacteria 2875
257 Ga0207641_10142618 3300026088 Bacteria 2163
258 Ga0207648_10011277 3300026089 Bacteria 8428
259 Ga0207648_10016924 3300026089 Bacteria 6645
260 Ga0207648_10051696 3300026089 Bacteria 3592
261 Ga0207648_10147578 3300026089 Bacteria 2075
262 Ga0207676_10046019 3300026095 Bacteria 3374
263 Ga0207674_10001496 3300026116 Bacteria 30156
264 Ga0207674_10032672 3300026116 Bacteria 5456
265 Ga0207674_10085815 3300026116 Bacteria 3142
266 Ga0207675_100049258 3300026118 Bacteria 3932
267 Ga0207675_100086537 3300026118 Bacteria 2943
268 Ga0207683_10003374 3300026121 Bacteria 13923
269 Ga0207683_10022964 3300026121 Bacteria 5362
270 Ga0207683_10044696 3300026121 Bacteria 3872
271 Ga0207683_10045488 3300026121 Bacteria 3839
272 Ga0207698_10000697 3300026142 Bacteria 19513
273 Ga0207698_10043497 3300026142 Bacteria 3365
274 Ga0207698_10048974 3300026142 Bacteria 3212
275 Ga0207698_10079427 3300026142 Bacteria 2639
276 Ga0207698_10292662 3300026142 Bacteria 1512
277 Ga0207698_10333873 3300026142 Bacteria 1425
278 Ga0209974_10001458 3300027876 Bacteria 8578
279 Ga0209974_10050848 3300027876 Bacteria 1392
280 Ga0307408_100007341 3300031548 Bacteria 7292
281 Ga0307408_100016651 3300031548 Bacteria 4912
282 Ga0307408_100050290 3300031548 Bacteria 2997
283 Ga0307405_10014694 3300031731 Bacteria 4218
284 Ga0307405_10038474 3300031731 Bacteria 2884
285 Ga0307405_10059904 3300031731 Bacteria 2401
286 Ga0307405_10215743 3300031731 Bacteria 1404
287 Ga0307413_10000677 3300031824 Bacteria 11596
288 Ga0307413_10016162 3300031824 Bacteria 3845
289 Ga0307413_10034974 3300031824 Bacteria 2878
290 Ga0307413_10039482 3300031824 Bacteria 2745
291 Ga0307413_10249791 3300031824 Bacteria 1315
292 Ga0307413_10257797 3300031824 Bacteria 1298
293 Ga0307410_10002266 3300031852 Bacteria 9208
294 Ga0307410_10004499 3300031852 Bacteria 7218
295 Ga0307410_10028004 3300031852 Bacteria 3567
296 Ga0307410_10126685 3300031852 Bacteria 1870
297 Ga0307410_10166359 3300031852 Bacteria 1657
298 Ga0307410_10231257 3300031852 Bacteria 1428
299 Ga0307406_10027877 3300031901 Bacteria 3407
300 Ga0307406_10057911 3300031901 Bacteria 2488
301 Ga0307406_10061317 3300031901 Bacteria 2429
302 Ga0307407_10002710 3300031903 Bacteria 7029
303 Ga0307407_10015433 3300031903 Bacteria 3776
304 Ga0307407_10161565 3300031903 Bacteria 1466
305 Ga0307412_10019157 3300031911 Bacteria 4136
306 Ga0307412_10051724 3300031911 Bacteria 2716
307 Ga0307412_10122258 3300031911 Bacteria 1876
308 Ga0307412_10258658 3300031911 Bacteria 1356
309 Ga0307409_100013807 3300031995 Bacteria 5220
310 Ga0307409_100045310 3300031995 Bacteria 3319
311 Ga0307409_100056336 3300031995 Bacteria 3039
312 Ga0307409_100085361 3300031995 Bacteria 2566
313 Ga0307409_100303176 3300031995 Bacteria 1487
314 Ga0307416_100045931 3300032002 Bacteria 3443
315 Ga0307416_100063760 3300032002 Bacteria 3019
316 Ga0307416_100115465 3300032002 Bacteria 2377
317 Ga0307416_100152871 3300032002 Bacteria 2120
318 Ga0307414_10003157 3300032004 Bacteria 8757
319 Ga0307414_10012232 3300032004 Bacteria 5065
320 Ga0307414_10040592 3300032004 Bacteria 3145
321 Ga0307414_10046903 3300032004 Bacteria 2970
322 Ga0307414_10078398 3300032004 Bacteria 2408
323 Ga0307414_10131663 3300032004 Bacteria 1942
324 Ga0307414_10211073 3300032004 Bacteria 1587
325 Ga0307411_10009395 3300032005 Bacteria 5137
326 Ga0307411_10015663 3300032005 Bacteria 4267
327 Ga0307411_10060915 3300032005 Bacteria 2509
328 Ga0307411_10067416 3300032005 Bacteria 2408
329 Ga0307415_100005573 3300032126 Bacteria 6700
330 Ga0307415_100052781 3300032126 Bacteria 2766
331 Ga0307415_100083332 3300032126 Bacteria 2291
332 Ga0307415_100130858 3300032126 Bacteria 1899
333 Ga0307415_100358219 3300032126 Bacteria 1231
334 Ga0373946_0123594 3300035171 Bacteria 1184
335 Ga0373935_0090683 3300035692 Bacteria 2001
336 Ga0395899_0000113 3300037312 Bacteria 136163
337 Ga0395899_0009305 3300037312 Bacteria 7544
338 Ga0395899_0014562 3300037312 Bacteria 6003
339 Ga0395899_0018526 3300037312 Bacteria 5291
340 Ga0395899_0059440 3300037312 Bacteria 2818
341 Ga0395899_0140527 3300037312 Bacteria 1718
342 Ga0395899_0183618 3300037312 Bacteria 1467
343 Ga0395900_0000583 3300037418 Bacteria 50178
344 Ga0395900_0002843 3300037418 Bacteria 18895
345 Ga0395900_0003841 3300037418 Bacteria 16057
346 Ga0395900_0006649 3300037418 Bacteria 12019
347 Ga0395900_0024755 3300037418 Bacteria 6144
348 Ga0395900_0055440 3300037418 Bacteria 4081
349 Ga0395900_0061203 3300037418 Bacteria 3871
350 Ga0395900_0081356 3300037418 Bacteria 3327
351 Ga0395900_0082085 3300037418 Bacteria 3312
352 Ga0395900_0117151 3300037418 Bacteria 2733
353 Ga0395900_0147247 3300037418 Bacteria 2407
354 Ga0395900_0170518 3300037418 Bacteria 2216
355 Ga0395900_0199878 3300037418 Bacteria 2023
356 Ga0395900_0238909 3300037418 Bacteria 1823
357 Ga0395900_0270979 3300037418 Bacteria 1692
358 Ga0395898_0001351 3300037466 Bacteria 35415
359 Ga0395898_0002186 3300037466 Bacteria 23900
360 Ga0395898_0002947 3300037466 Bacteria 19363
361 Ga0395898_0025148 3300037466 Bacteria 6004
362 Ga0395898_0029806 3300037466 Bacteria 5462
363 Ga0395898_0091703 3300037466 Bacteria 2923
364 Ga0395898_0102607 3300037466 Bacteria 2746
365 Ga0395898_0109605 3300037466 Bacteria 2646
366 Ga0395898_0144196 3300037466 Bacteria 2279
367 Ga0395898_0172962 3300037466 Bacteria 2064
368 Ga0395898_0184758 3300037466 Bacteria 1992
369 Ga0395898_0205906 3300037466 Bacteria 1877
370 Ga0395905_0000005 3300037471 Bacteria 557808
371 Ga0395905_0000342 3300037471 Bacteria 66255
372 Ga0395905_0001330 3300037471 Bacteria 30159
373 Ga0395905_0001508 3300037471 Bacteria 27850
374 Ga0395905_0002977 3300037471 Bacteria 18402
375 Ga0395905_0005166 3300037471 Bacteria 13389
376 Ga0395905_0010395 3300037471 Bacteria 9060
377 Ga0395905_0018813 3300037471 Bacteria 6551
378 Ga0395905_0059847 3300037471 Bacteria 3561
379 Ga0395905_0062933 3300037471 Bacteria 3470
380 Ga0395905_0142616 3300037471 Bacteria 2253
381 Ga0395905_0159423 3300037471 Bacteria 2121
382 Ga0395905_0216156 3300037471 Bacteria 1795
383 Ga0395905_0216269 3300037471 Bacteria 1794
384 Ga0395905_0263999 3300037471 Bacteria 1607
385 Ga0395905_0273382 3300037471 Bacteria 1575
386 Ga0395905_0397586 3300037471 Bacteria 1273
387 Ga0395901_0000486 3300038443 Bacteria 46185
388 Ga0395901_0001812 3300038443 Bacteria 22072
389 Ga0395901_0012439 3300038443 Bacteria 8635
390 Ga0395901_0024604 3300038443 Bacteria 6183
391 Ga0395901_0031068 3300038443 Bacteria 5506
392 Ga0395901_0031355 3300038443 Bacteria 5481
393 Ga0395901_0033824 3300038443 Bacteria 5278
394 Ga0395901_0044961 3300038443 Bacteria 4581
395 Ga0395901_0096274 3300038443 Bacteria 3102
396 Ga0395901_0107911 3300038443 Bacteria 2923
397 Ga0395901_0150354 3300038443 Bacteria 2447
398 Ga0395901_0187757 3300038443 Bacteria 2167
399 Ga0395901_0218095 3300038443 Bacteria 1994
400 Ga0395901_0242873 3300038443 Bacteria 1878
401 Ga0436365_0733310 3300039437 Bacteria 5597
402 Ga0436363_1301179 3300039450 Bacteria 2130
403 Ga0439432_029952 3300042006 Bacteria 1767
404 Ga0439462_0038154 3300042015 Bacteria 1281
405 Ga0439458_0000019 3300042157 Bacteria 25805
406 Ga0466961_0056567 3300044693 Bacteria 2500
407 Ga0466963_0027251 3300044694 Bacteria 3657
408 Ga0466964_0010935 3300044706 Bacteria 3429
409 Ga0466971_0004617 3300044719 Bacteria 5948
410 Ga0466968_0057481 3300044735 Bacteria 1672
411 Ga0466970_0066683 3300044765 Bacteria 1932
412 Ga0466957_0077941 3300044842 Bacteria 2059
413 Ga0466960_0005295 3300044901 Bacteria 5100
414 Ga0466959_0031284 3300045049 Bacteria 3938
415 Ga0466959_0040035 3300045049 Bacteria 3463
416 Ga0466959_0119634 3300045049 Bacteria 1873
417 Ga0466959_0134200 3300045049 Bacteria 1753
418 Ga0466958_0006522 3300045836 Bacteria 6360
419 Ga0466967_0027764 3300045976 Bacteria 4712
420 Ga0466967_0047341 3300045976 Bacteria 3748
421 Ga0466967_0292736 3300045976 Bacteria 1565
422 Ga0495629_0139961 3300046459 Bacteria 1684
423 Ga0495663_0000587 3300046525 Bacteria 12764
424 Ga0495663_0027251 3300046525 Bacteria 1676
425 Ga0495598_0000413 3300046537 Bacteria 7686
426 Ga0495598_0014211 3300046537 Bacteria 1987
427 Ga0495621_0010976 3300046539 Bacteria 2787
428 Ga0495633_0010142 3300046558 Bacteria 5158
429 Ga0495659_0012566 3300046664 Bacteria 2745
430 Ga0495669_0005956 3300046684 Bacteria 5085
431 Ga0495669_0008913 3300046684 Bacteria 4226
432 Ga0495670_0000957 3300046691 Bacteria 13971
433 Ga0496100_0001163 3300048903 Bacteria 12794
434 Ga0496101_0001522 3300048904 Bacteria 13884
435 Ga0496104_0029921 3300048907 Bacteria 5057
436 Ga0496106_0021414 3300048909 Bacteria 4801
437 Ga0496107_0049427 3300048910 Bacteria 3030
438 Ga0496107_0084256 3300048910 Bacteria 2319
439 Ga0496107_0101501 3300048910 Bacteria 2110
440 Ga0496107_0248253 3300048910 Bacteria 1324
441 Ga0496109_0027807 3300048912 Bacteria 5054
442 Ga0496109_0066501 3300048912 Bacteria 3301
443 Ga0496109_0134521 3300048912 Bacteria 2309
444 Ga0496109_0236704 3300048912 Bacteria 1718
445 Ga0496109_0261339 3300048912 Bacteria 1630
446 Ga0496110_0322978 3300048913 Bacteria 1406
447 Ga0496111_0004779 3300048914 Bacteria 8593
448 Ga0496111_0022858 3300048914 Bacteria 4383
449 Ga0496111_0099194 3300048914 Bacteria 2139
450 Ga0496112_0046485 3300048915 Bacteria 4257
451 Ga0496113_0022104 3300048916 Bacteria 4494
452 Ga0496113_0246934 3300048916 Bacteria 1424
453 Ga0496114_0000006 3300048917 Bacteria 472921
454 Ga0496115_0049517 3300048918 Bacteria 3364
455 Ga0501067_0093732 3300049583 Bacteria 1667
456 Ga0501068_0068725 3300049584 Bacteria 2159
457 Ga0501270_010283 3300049767 Bacteria 1229
458 nmdc:mga00v17_6035_c1 3300050491 Bacteria 6407
459 nmdc:mga06r32_27084_c1 3300050510 Bacteria 5350
460 Ga0466962_0026472 3300061719 Bacteria 2784

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0292736 Ga0466967_0292736_531_1547 313
2 3300031903 Ga0307407_10161565 Ga0307407_101615652 318
3 3300031995 Ga0307409_100045310 Ga0307409_1000453102 318
4 3300032004 Ga0307414_10040592 Ga0307414_100405922 318
5 3300049767 Ga0501270_010283 Ga0501270_010283_39_1136 318
6 3300049584 Ga0501068_0068725 Ga0501068_0068725_779_1876 319
7 3300025893 Ga0207682_10021935 Ga0207682_100219354 320
8 3300027876 Ga0209974_10001458 Ga0209974_100014589 320
9 3300031548 Ga0307408_100050290 Ga0307408_1000502903 320
10 3300031731 Ga0307405_10038474 Ga0307405_100384743 320
11 3300031824 Ga0307413_10016162 Ga0307413_100161622 320
12 3300031852 Ga0307410_10126685 Ga0307410_101266852 320
13 3300031903 Ga0307407_10015433 Ga0307407_100154332 320
14 3300031911 Ga0307412_10051724 Ga0307412_100517242 320
15 3300032002 Ga0307416_100063760 Ga0307416_1000637602 320
16 3300032004 Ga0307414_10046903 Ga0307414_100469032 320
17 3300032005 Ga0307411_10015663 Ga0307411_100156633 320
18 3300032005 Ga0307411_10060915 Ga0307411_100609152 320
19 3300032126 Ga0307415_100130858 Ga0307415_1001308582 320
20 3300042006 Ga0439432_029952 Ga0439432_029952_78_1175 320
21 3300005354 Ga0070675_100078966 Ga0070675_1000789661 322
22 3300005355 Ga0070671_100015012 Ga0070671_1000150123 322
23 3300005543 Ga0070672_100022445 Ga0070672_1000224453 322
24 3300005616 Ga0068852_100253859 Ga0068852_1002538592 322
25 3300006237 Ga0097621_100015473 Ga0097621_1000154734 322
26 3300009177 Ga0105248_10320133 Ga0105248_103201332 322
27 3300013104 Ga0157370_10162209 Ga0157370_101622091 322
28 3300013306 Ga0163162_10112104 Ga0163162_101121042 322
29 3300013308 Ga0157375_10004450 Ga0157375_100044508 322
30 3300017792 Ga0163161_10017595 Ga0163161_100175953 322
31 3300025940 Ga0207691_10103148 Ga0207691_101031481 322
32 3300026142 Ga0207698_10333873 Ga0207698_103338732 322
33 3300048910 Ga0496107_0084256 Ga0496107_0084256_1055_2152 322
34 3300048912 Ga0496109_0027807 Ga0496109_0027807_3262_4359 322
35 3300014326 Ga0157380_10014919 Ga0157380_100149196 323
36 3300005356 Ga0070674_100035667 Ga0070674_1000356674 325
37 3300005356 Ga0070674_100123110 Ga0070674_1001231103 325
38 3300014745 Ga0157377_10106144 Ga0157377_101061442 325
39 3300031548 Ga0307408_100016651 Ga0307408_1000166512 325
40 3300031731 Ga0307405_10059904 Ga0307405_100599042 325
41 3300031995 Ga0307409_100056336 Ga0307409_1000563362 325
42 3300032004 Ga0307414_10131663 Ga0307414_101316632 325
43 3300035171 Ga0373946_0123594 Ga0373946_0123594_42_1091 325
44 3300046537 Ga0495598_0000413 Ga0495598_0000413_257_1351 325
45 3300046539 Ga0495621_0010976 Ga0495621_0010976_1418_2512 325
46 3300046684 Ga0495669_0005956 Ga0495669_0005956_635_1729 325
47 3300046691 Ga0495670_0000957 Ga0495670_0000957_4618_5712 325
48 3300048910 Ga0496107_0248253 Ga0496107_0248253_250_1299 325
49 3300037471 Ga0395905_0216156 Ga0395905_0216156_293_1390 326
50 3300014326 Ga0157380_10027730 Ga0157380_100277302 327
51 3300039450 Ga0436363_1301179 Ga0436363_1301179_397_1491 327
52 3300044706 Ga0466964_0010935 Ga0466964_0010935_1141_2238 329
53 3300044719 Ga0466971_0004617 Ga0466971_0004617_2042_3139 329
54 3300044842 Ga0466957_0077941 Ga0466957_0077941_85_1182 329
55 3300045049 Ga0466959_0119634 Ga0466959_0119634_63_1160 329
56 3300061719 Ga0466962_0026472 Ga0466962_0026472_853_1950 329
57 3300005435 Ga0070714_100071127 Ga0070714_1000711272 330
58 3300032002 Ga0307416_100045931 Ga0307416_1000459313 330
59 3300032004 Ga0307414_10078398 Ga0307414_100783982 330
60 3300037471 Ga0395905_0263999 Ga0395905_0263999_226_1323 330
61 3300046525 Ga0495663_0027251 Ga0495663_0027251_520_1617 330
62 3300049583 Ga0501067_0093732 Ga0501067_0093732_520_1617 330
63 3300005457 Ga0070662_100060117 Ga0070662_1000601172 331
64 3300037418 Ga0395900_0006649 Ga0395900_0006649_6952_8049 331
65 3300037466 Ga0395898_0172962 Ga0395898_0172962_196_1293 331
66 3300037471 Ga0395905_0001508 Ga0395905_0001508_5056_6153 331
67 3300037418 Ga0395900_0024755 Ga0395900_0024755_861_1958 332
68 3300037466 Ga0395898_0184758 Ga0395898_0184758_170_1267 332
69 3300037471 Ga0395905_0000342 Ga0395905_0000342_9821_10918 333
70 3300001990 JGI24737J22298_10013612 JGI24737J22298_100136121 334
71 3300005366 Ga0070659_100096172 Ga0070659_1000961722 334
72 3300005435 Ga0070714_100032704 Ga0070714_1000327043 334
73 3300005436 Ga0070713_100006844 Ga0070713_1000068443 334
74 3300005577 Ga0068857_100018151 Ga0068857_1000181515 334
75 3300025903 Ga0207680_10130747 Ga0207680_101307472 334
76 3300025904 Ga0207647_10039478 Ga0207647_100394783 334
77 3300025926 Ga0207659_10365966 Ga0207659_103659661 334
78 3300025932 Ga0207690_10061728 Ga0207690_100617283 334
79 3300025961 Ga0207712_10118235 Ga0207712_101182352 334
80 3300026088 Ga0207641_10022117 Ga0207641_100221174 334
81 3300026116 Ga0207674_10001496 Ga0207674_1000149615 334
82 3300005578 Ga0068854_100170770 Ga0068854_1001707702 335
83 3300026118 Ga0207675_100086537 Ga0207675_1000865372 335
84 3300031548 Ga0307408_100007341 Ga0307408_1000073412 335
85 3300031731 Ga0307405_10014694 Ga0307405_100146942 335
86 3300031852 Ga0307410_10166359 Ga0307410_101663592 335
87 3300031901 Ga0307406_10027877 Ga0307406_100278774 335
88 3300031911 Ga0307412_10019157 Ga0307412_100191574 335
89 3300032002 Ga0307416_100115465 Ga0307416_1001154652 335
90 3300032004 Ga0307414_10012232 Ga0307414_100122322 335
91 3300032126 Ga0307415_100005573 Ga0307415_1000055733 335
92 3300037312 Ga0395899_0140527 Ga0395899_0140527_431_1588 335
93 3300037418 Ga0395900_0061203 Ga0395900_0061203_1070_2167 335
94 3300037418 Ga0395900_0199878 Ga0395900_0199878_161_1258 335
95 3300037466 Ga0395898_0205906 Ga0395898_0205906_336_1433 335
96 3300037471 Ga0395905_0018813 Ga0395905_0018813_5294_6391 335
97 3300037471 Ga0395905_0142616 Ga0395905_0142616_1139_2236 335
98 3300037471 Ga0395905_0273382 Ga0395905_0273382_319_1416 335
99 3300038443 Ga0395901_0031068 Ga0395901_0031068_2997_4094 335
100 3300038443 Ga0395901_0031355 Ga0395901_0031355_2089_3186 335
101 iso_pu_bacteria 2885427238 2885428898 338
102 3300002067 JGI24735J21928_10002483 JGI24735J21928_100024835 340
103 3300005327 Ga0070658_10026334 Ga0070658_100263342 340
104 3300005327 Ga0070658_10042892 Ga0070658_100428922 340
105 3300005327 Ga0070658_10134085 Ga0070658_101340852 340
106 3300005328 Ga0070676_10107385 Ga0070676_101073851 340
107 3300005331 Ga0070670_100023778 Ga0070670_1000237782 340
108 3300005331 Ga0070670_100056672 Ga0070670_1000566722 340
109 3300005333 Ga0070677_10012509 Ga0070677_100125093 340
110 3300005335 Ga0070666_10001550 Ga0070666_1000155016 340
111 3300005335 Ga0070666_10137139 Ga0070666_101371391 340
112 3300005335 Ga0070666_10234836 Ga0070666_102348362 340
113 3300005338 Ga0068868_100002343 Ga0068868_10000234311 340
114 3300005338 Ga0068868_100065915 Ga0068868_1000659151 340
115 3300005339 Ga0070660_100003460 Ga0070660_1000034605 340
116 3300005339 Ga0070660_100017135 Ga0070660_1000171352 340
117 3300005339 Ga0070660_100067179 Ga0070660_1000671795 340
118 3300005344 Ga0070661_100014219 Ga0070661_1000142195 340
119 3300005344 Ga0070661_100026078 Ga0070661_1000260783 340
120 3300005354 Ga0070675_100099351 Ga0070675_1000993512 340
121 3300005355 Ga0070671_100002863 Ga0070671_1000028638 340
122 3300005355 Ga0070671_100002968 Ga0070671_1000029688 340
123 3300005356 Ga0070674_100017574 Ga0070674_1000175743 340
124 3300005366 Ga0070659_100001753 Ga0070659_1000017537 340
125 3300005366 Ga0070659_100152904 Ga0070659_1001529041 340
126 3300005367 Ga0070667_100002750 Ga0070667_1000027504 340
127 3300005367 Ga0070667_100145155 Ga0070667_1001451552 340
128 3300005435 Ga0070714_100168462 Ga0070714_1001684622 340
129 3300005436 Ga0070713_100048894 Ga0070713_1000488942 340
130 3300005455 Ga0070663_100032971 Ga0070663_1000329712 340
131 3300005455 Ga0070663_100069420 Ga0070663_1000694203 340
132 3300005457 Ga0070662_100002965 Ga0070662_1000029656 340
133 3300005457 Ga0070662_100052037 Ga0070662_1000520373 340
134 3300005457 Ga0070662_100065899 Ga0070662_1000658993 340
135 3300005457 Ga0070662_100133404 Ga0070662_1001334042 340
136 3300005459 Ga0068867_100056646 Ga0068867_1000566463 340
137 3300005459 Ga0068867_100175235 Ga0068867_1001752352 340
138 3300005466 Ga0070685_10157710 Ga0070685_101577102 340
139 3300005539 Ga0068853_100413643 Ga0068853_1004136431 340
140 3300005543 Ga0070672_100020345 Ga0070672_1000203457 340
141 3300005543 Ga0070672_100100502 Ga0070672_1001005022 340
142 3300005543 Ga0070672_100249521 Ga0070672_1002495212 340
143 3300005548 Ga0070665_100023887 Ga0070665_10002388710 340
144 3300005563 Ga0068855_100193285 Ga0068855_1001932852 340
145 3300005564 Ga0070664_100003721 Ga0070664_1000037218 340
146 3300005564 Ga0070664_100004827 Ga0070664_10000482711 340
147 3300005564 Ga0070664_100038561 Ga0070664_1000385612 340
148 3300005564 Ga0070664_100086016 Ga0070664_1000860163 340
149 3300005577 Ga0068857_100089798 Ga0068857_1000897982 340
150 3300005578 Ga0068854_100004964 Ga0068854_1000049643 340
151 3300005578 Ga0068854_100243653 Ga0068854_1002436531 340
152 3300005616 Ga0068852_100029771 Ga0068852_1000297712 340
153 3300005616 Ga0068852_100110110 Ga0068852_1001101102 340
154 3300005617 Ga0068859_100059901 Ga0068859_1000599014 340
155 3300005618 Ga0068864_100008287 Ga0068864_1000082873 340
156 3300005718 Ga0068866_10015285 Ga0068866_100152854 340
157 3300005841 Ga0068863_100039885 Ga0068863_1000398854 340
158 3300005842 Ga0068858_100004720 Ga0068858_10000472015 340
159 3300005985 Ga0081539_10045601 Ga0081539_100456011 340
160 3300006173 Ga0070716_100222565 Ga0070716_1002225651 340
161 3300006175 Ga0070712_100046258 Ga0070712_1000462582 340
162 3300006358 Ga0068871_100181450 Ga0068871_1001814501 340
163 3300006931 Ga0097620_100059901 Ga0097620_1000599013 340
164 3300009098 Ga0105245_10030338 Ga0105245_100303384 340
165 3300009098 Ga0105245_10243605 Ga0105245_102436052 340
166 3300009098 Ga0105245_10288827 Ga0105245_102888272 340
167 3300009148 Ga0105243_10118396 Ga0105243_101183963 340
168 3300009174 Ga0105241_10107938 Ga0105241_101079382 340
169 3300009177 Ga0105248_10002097 Ga0105248_1000209715 340
170 3300009177 Ga0105248_10111250 Ga0105248_101112503 340
171 3300009177 Ga0105248_10145038 Ga0105248_101450382 340
172 3300009177 Ga0105248_10182023 Ga0105248_101820233 340
173 3300009545 Ga0105237_10175021 Ga0105237_101750212 340
174 3300013102 Ga0157371_10081885 Ga0157371_100818853 340
175 3300013104 Ga0157370_10003273 Ga0157370_100032735 340
176 3300013104 Ga0157370_10127249 Ga0157370_101272494 340
177 3300013105 Ga0157369_10001571 Ga0157369_1000157118 340
178 3300013105 Ga0157369_10338248 Ga0157369_103382482 340
179 3300013297 Ga0157378_10028456 Ga0157378_100284568 340
180 3300013297 Ga0157378_10232464 Ga0157378_102324641 340
181 3300013307 Ga0157372_10031759 Ga0157372_100317594 340
182 3300013307 Ga0157372_10158344 Ga0157372_101583444 340
183 3300014326 Ga0157380_10463310 Ga0157380_104633102 340
184 3300025893 Ga0207682_10003272 Ga0207682_100032724 340
185 3300025899 Ga0207642_10002708 Ga0207642_100027083 340
186 3300025899 Ga0207642_10052703 Ga0207642_100527032 340
187 3300025901 Ga0207688_10005472 Ga0207688_100054727 340
188 3300025903 Ga0207680_10011013 Ga0207680_100110132 340
189 3300025903 Ga0207680_10100039 Ga0207680_101000392 340
190 3300025907 Ga0207645_10022812 Ga0207645_100228122 340
191 3300025908 Ga0207643_10104384 Ga0207643_101043841 340
192 3300025909 Ga0207705_10002565 Ga0207705_100025659 340
193 3300025909 Ga0207705_10009543 Ga0207705_100095433 340
194 3300025913 Ga0207695_10201233 Ga0207695_102012332 340
195 3300025915 Ga0207693_10025441 Ga0207693_100254414 340
196 3300025919 Ga0207657_10002036 Ga0207657_1000203610 340
197 3300025919 Ga0207657_10007817 Ga0207657_100078179 340
198 3300025919 Ga0207657_10043044 Ga0207657_100430444 340
199 3300025920 Ga0207649_10007074 Ga0207649_100070746 340
200 3300025920 Ga0207649_10090845 Ga0207649_100908452 340
201 3300025925 Ga0207650_10013470 Ga0207650_100134705 340
202 3300025931 Ga0207644_10000960 Ga0207644_1000096022 340
203 3300025931 Ga0207644_10001058 Ga0207644_1000105813 340
204 3300025931 Ga0207644_10001995 Ga0207644_100019952 340
205 3300025931 Ga0207644_10005104 Ga0207644_100051047 340
206 3300025932 Ga0207690_10013257 Ga0207690_100132575 340
207 3300025932 Ga0207690_10164835 Ga0207690_101648351 340
208 3300025933 Ga0207706_10025601 Ga0207706_100256015 340
209 3300025933 Ga0207706_10032125 Ga0207706_100321254 340
210 3300025933 Ga0207706_10033418 Ga0207706_100334184 340
211 3300025933 Ga0207706_10046285 Ga0207706_100462852 340
212 3300025933 Ga0207706_10057998 Ga0207706_100579983 340
213 3300025933 Ga0207706_10078398 Ga0207706_100783982 340
214 3300025933 Ga0207706_10101701 Ga0207706_101017012 340
215 3300025933 Ga0207706_10107058 Ga0207706_101070582 340
216 3300025940 Ga0207691_10000954 Ga0207691_1000095423 340
217 3300025940 Ga0207691_10022747 Ga0207691_100227473 340
218 3300025940 Ga0207691_10036043 Ga0207691_100360432 340
219 3300025941 Ga0207711_10002646 Ga0207711_1000264617 340
220 3300025941 Ga0207711_10008690 Ga0207711_100086907 340
221 3300025942 Ga0207689_10028006 Ga0207689_100280064 340
222 3300025945 Ga0207679_10013031 Ga0207679_100130316 340
223 3300025949 Ga0207667_10279726 Ga0207667_102797262 340
224 3300025960 Ga0207651_10000289 Ga0207651_1000028913 340
225 3300025960 Ga0207651_10008652 Ga0207651_100086526 340
226 3300025960 Ga0207651_10017630 Ga0207651_100176304 340
227 3300025981 Ga0207640_10044139 Ga0207640_100441393 340
228 3300025986 Ga0207658_10005082 Ga0207658_100050829 340
229 3300025986 Ga0207658_10047319 Ga0207658_100473193 340
230 3300025986 Ga0207658_10129421 Ga0207658_101294213 340
231 3300026023 Ga0207677_10005629 Ga0207677_100056294 340
232 3300026023 Ga0207677_10124452 Ga0207677_101244521 340
233 3300026035 Ga0207703_10002884 Ga0207703_1000288416 340
234 3300026035 Ga0207703_10074462 Ga0207703_100744622 340
235 3300026067 Ga0207678_10012732 Ga0207678_100127322 340
236 3300026067 Ga0207678_10037178 Ga0207678_100371784 340
237 3300026067 Ga0207678_10055365 Ga0207678_100553652 340
238 3300026067 Ga0207678_10067527 Ga0207678_100675273 340
239 3300026067 Ga0207678_10090804 Ga0207678_100908043 340
240 3300026088 Ga0207641_10142618 Ga0207641_101426182 340
241 3300026089 Ga0207648_10011277 Ga0207648_100112773 340
242 3300026089 Ga0207648_10016924 Ga0207648_100169242 340
243 3300026089 Ga0207648_10147578 Ga0207648_101475781 340
244 3300026095 Ga0207676_10046019 Ga0207676_100460194 340
245 3300026116 Ga0207674_10032672 Ga0207674_100326724 340
246 3300026121 Ga0207683_10003374 Ga0207683_100033745 340
247 3300026121 Ga0207683_10022964 Ga0207683_100229645 340
248 3300026121 Ga0207683_10044696 Ga0207683_100446963 340
249 3300026142 Ga0207698_10048974 Ga0207698_100489742 340
250 3300026142 Ga0207698_10079427 Ga0207698_100794273 340
251 3300026142 Ga0207698_10292662 Ga0207698_102926622 340
252 3300031852 Ga0307410_10002266 Ga0307410_100022668 340
253 3300031852 Ga0307410_10028004 Ga0307410_100280043 340
254 3300031995 Ga0307409_100013807 Ga0307409_1000138074 340
255 3300032126 Ga0307415_100052781 Ga0307415_1000527813 340
256 3300032126 Ga0307415_100083332 Ga0307415_1000833322 340
257 3300035692 Ga0373935_0090683 Ga0373935_0090683_623_1717 340
258 3300037312 Ga0395899_0000113 Ga0395899_0000113_116936_118033 340
259 3300037312 Ga0395899_0009305 Ga0395899_0009305_564_1661 340
260 3300037312 Ga0395899_0014562 Ga0395899_0014562_35_1132 340
261 3300037312 Ga0395899_0018526 Ga0395899_0018526_3953_5050 340
262 3300037312 Ga0395899_0059440 Ga0395899_0059440_940_2037 340
263 3300037418 Ga0395900_0000583 Ga0395900_0000583_9509_10606 340
264 3300037418 Ga0395900_0003841 Ga0395900_0003841_11303_12400 340
265 3300037418 Ga0395900_0055440 Ga0395900_0055440_1465_2562 340
266 3300037418 Ga0395900_0081356 Ga0395900_0081356_242_1339 340
267 3300037418 Ga0395900_0082085 Ga0395900_0082085_1226_2323 340
268 3300037418 Ga0395900_0117151 Ga0395900_0117151_348_1445 340
269 3300037418 Ga0395900_0170518 Ga0395900_0170518_514_1611 340
270 3300037418 Ga0395900_0238909 Ga0395900_0238909_568_1665 340
271 3300037466 Ga0395898_0001351 Ga0395898_0001351_9880_10977 340
272 3300037466 Ga0395898_0002186 Ga0395898_0002186_7780_8877 340
273 3300037466 Ga0395898_0002947 Ga0395898_0002947_7764_8861 340
274 3300037466 Ga0395898_0025148 Ga0395898_0025148_3785_4882 340
275 3300037466 Ga0395898_0029806 Ga0395898_0029806_4225_5322 340
276 3300037466 Ga0395898_0091703 Ga0395898_0091703_1154_2251 340
277 3300037466 Ga0395898_0109605 Ga0395898_0109605_169_1266 340
278 3300037471 Ga0395905_0000005 Ga0395905_0000005_242869_243966 340
279 3300037471 Ga0395905_0002977 Ga0395905_0002977_16982_18079 340
280 3300037471 Ga0395905_0005166 Ga0395905_0005166_8427_9524 340
281 3300037471 Ga0395905_0010395 Ga0395905_0010395_5123_6220 340
282 3300037471 Ga0395905_0062933 Ga0395905_0062933_990_2087 340
283 3300037471 Ga0395905_0159423 Ga0395905_0159423_703_1800 340
284 3300037471 Ga0395905_0216269 Ga0395905_0216269_41_1138 340
285 3300038443 Ga0395901_0001812 Ga0395901_0001812_20281_21378 340
286 3300038443 Ga0395901_0012439 Ga0395901_0012439_2413_3510 340
287 3300038443 Ga0395901_0024604 Ga0395901_0024604_1377_2474 340
288 3300038443 Ga0395901_0033824 Ga0395901_0033824_1583_2680 340
289 3300038443 Ga0395901_0044961 Ga0395901_0044961_2874_3971 340
290 3300038443 Ga0395901_0187757 Ga0395901_0187757_242_1339 340
291 3300038443 Ga0395901_0218095 Ga0395901_0218095_344_1441 340
292 3300039437 Ga0436365_0733310 Ga0436365_0733310_970_2067 340
293 3300042157 Ga0439458_0000019 Ga0439458_0000019_18131_19228 340
294 3300044693 Ga0466961_0056567 Ga0466961_0056567_392_1489 340
295 3300044694 Ga0466963_0027251 Ga0466963_0027251_1143_2240 340
296 3300044735 Ga0466968_0057481 Ga0466968_0057481_402_1499 340
297 3300044765 Ga0466970_0066683 Ga0466970_0066683_368_1525 340
298 3300044901 Ga0466960_0005295 Ga0466960_0005295_3260_4354 340
299 3300045049 Ga0466959_0031284 Ga0466959_0031284_132_1229 340
300 3300045049 Ga0466959_0040035 Ga0466959_0040035_1331_2488 340
301 3300045049 Ga0466959_0134200 Ga0466959_0134200_55_1152 340
302 3300045836 Ga0466958_0006522 Ga0466958_0006522_1501_2658 340
303 3300046459 Ga0495629_0139961 Ga0495629_0139961_194_1291 340
304 3300048903 Ga0496100_0001163 Ga0496100_0001163_6216_7310 340
305 3300048904 Ga0496101_0001522 Ga0496101_0001522_4417_5511 340
306 3300048907 Ga0496104_0029921 Ga0496104_0029921_309_1403 340
307 3300048909 Ga0496106_0021414 Ga0496106_0021414_2709_3803 340
308 3300048910 Ga0496107_0049427 Ga0496107_0049427_1557_2654 340
309 3300048912 Ga0496109_0236704 Ga0496109_0236704_529_1629 340
310 3300048912 Ga0496109_0261339 Ga0496109_0261339_65_1162 340
311 3300048913 Ga0496110_0322978 Ga0496110_0322978_188_1285 340
312 3300048914 Ga0496111_0004779 Ga0496111_0004779_1058_2152 340
313 3300048914 Ga0496111_0022858 Ga0496111_0022858_80_1174 340
314 3300048915 Ga0496112_0046485 Ga0496112_0046485_2812_3909 340
315 3300048916 Ga0496113_0022104 Ga0496113_0022104_552_1649 340
316 3300048916 Ga0496113_0246934 Ga0496113_0246934_163_1260 340
317 3300048917 Ga0496114_0000006 Ga0496114_0000006_284969_286066 340
318 3300048918 Ga0496115_0049517 Ga0496115_0049517_171_1268 340
319 3300001979 JGI24740J21852_10036444 JGI24740J21852_100364442 342
320 3300002067 JGI24735J21928_10010719 JGI24735J21928_100107192 342
321 3300005295 Ga0065707_10158544 Ga0065707_101585441 342
322 3300005327 Ga0070658_10009142 Ga0070658_100091423 342
323 3300005327 Ga0070658_10011098 Ga0070658_100110988 342
324 3300005328 Ga0070676_10021355 Ga0070676_100213552 342
325 3300005331 Ga0070670_100124027 Ga0070670_1001240272 342
326 3300005335 Ga0070666_10012588 Ga0070666_100125882 342
327 3300005336 Ga0070680_100004527 Ga0070680_1000045279 342
328 3300005339 Ga0070660_100009551 Ga0070660_1000095513 342
329 3300005339 Ga0070660_100173800 Ga0070660_1001738002 342
330 3300005344 Ga0070661_100049220 Ga0070661_1000492202 342
331 3300005347 Ga0070668_100361393 Ga0070668_1003613931 342
332 3300005354 Ga0070675_100006027 Ga0070675_1000060275 342
333 3300005355 Ga0070671_100004366 Ga0070671_1000043665 342
334 3300005356 Ga0070674_100018834 Ga0070674_1000188343 342
335 3300005364 Ga0070673_100089700 Ga0070673_1000897002 342
336 3300005366 Ga0070659_100002004 Ga0070659_10000200411 342
337 3300005366 Ga0070659_100016450 Ga0070659_1000164502 342
338 3300005366 Ga0070659_100057081 Ga0070659_1000570812 342
339 3300005366 Ga0070659_100098578 Ga0070659_1000985782 342
340 3300005455 Ga0070663_100002833 Ga0070663_10000283310 342
341 3300005457 Ga0070662_100000513 Ga0070662_1000005139 342
342 3300005457 Ga0070662_100013967 Ga0070662_1000139673 342
343 3300005530 Ga0070679_100047584 Ga0070679_1000475844 342
344 3300005530 Ga0070679_100306342 Ga0070679_1003063421 342
345 3300005543 Ga0070672_100002918 Ga0070672_1000029189 342
346 3300005548 Ga0070665_100021002 Ga0070665_1000210023 342
347 3300005548 Ga0070665_100045231 Ga0070665_1000452312 342
348 3300005563 Ga0068855_100015155 Ga0068855_1000151554 342
349 3300005563 Ga0068855_100028359 Ga0068855_1000283592 342
350 3300005563 Ga0068855_100175876 Ga0068855_1001758762 342
351 3300005564 Ga0070664_100005219 Ga0070664_1000052198 342
352 3300005577 Ga0068857_100017400 Ga0068857_1000174003 342
353 3300005614 Ga0068856_100053048 Ga0068856_1000530482 342
354 3300005616 Ga0068852_100000873 Ga0068852_1000008732 342
355 3300005616 Ga0068852_100074550 Ga0068852_1000745502 342
356 3300005719 Ga0068861_100044450 Ga0068861_1000444502 342
357 3300005985 Ga0081539_10026310 Ga0081539_100263104 342
358 3300006847 Ga0075431_100011561 Ga0075431_1000115613 342
359 3300006881 Ga0068865_100205581 Ga0068865_1002055812 342
360 3300009177 Ga0105248_10019537 Ga0105248_100195373 342
361 3300009545 Ga0105237_10027818 Ga0105237_100278185 342
362 3300013100 Ga0157373_10009971 Ga0157373_100099713 342
363 3300013100 Ga0157373_10010407 Ga0157373_100104073 342
364 3300013100 Ga0157373_10040217 Ga0157373_100402172 342
365 3300013102 Ga0157371_10010504 Ga0157371_100105046 342
366 3300013102 Ga0157371_10027607 Ga0157371_100276072 342
367 3300013102 Ga0157371_10049670 Ga0157371_100496702 342
368 3300013105 Ga0157369_10053506 Ga0157369_100535062 342
369 3300013307 Ga0157372_10025167 Ga0157372_100251675 342
370 3300013307 Ga0157372_10064461 Ga0157372_100644614 342
371 3300014326 Ga0157380_10013211 Ga0157380_100132114 342
372 3300017792 Ga0163161_10042729 Ga0163161_100427291 342
373 3300025321 Ga0207656_10012002 Ga0207656_100120021 342
374 3300025903 Ga0207680_10009702 Ga0207680_100097022 342
375 3300025904 Ga0207647_10022826 Ga0207647_100228263 342
376 3300025907 Ga0207645_10011912 Ga0207645_100119125 342
377 3300025909 Ga0207705_10162072 Ga0207705_101620722 342
378 3300025917 Ga0207660_10000059 Ga0207660_1000005921 342
379 3300025919 Ga0207657_10001318 Ga0207657_1000131819 342
380 3300025919 Ga0207657_10037304 Ga0207657_100373043 342
381 3300025920 Ga0207649_10019851 Ga0207649_100198513 342
382 3300025921 Ga0207652_10027123 Ga0207652_100271232 342
383 3300025923 Ga0207681_10029297 Ga0207681_100292972 342
384 3300025924 Ga0207694_10002110 Ga0207694_100021103 342
385 3300025925 Ga0207650_10009574 Ga0207650_100095743 342
386 3300025925 Ga0207650_10091137 Ga0207650_100911372 342
387 3300025926 Ga0207659_10002600 Ga0207659_100026003 342
388 3300025931 Ga0207644_10003712 Ga0207644_100037127 342
389 3300025932 Ga0207690_10002468 Ga0207690_100024689 342
390 3300025932 Ga0207690_10096573 Ga0207690_100965732 342
391 3300025932 Ga0207690_10154936 Ga0207690_101549362 342
392 3300025933 Ga0207706_10001436 Ga0207706_100014364 342
393 3300025933 Ga0207706_10023100 Ga0207706_100231003 342
394 3300025940 Ga0207691_10006076 Ga0207691_100060765 342
395 3300025941 Ga0207711_10009269 Ga0207711_100092694 342
396 3300025945 Ga0207679_10090516 Ga0207679_100905162 342
397 3300025949 Ga0207667_10006779 Ga0207667_100067792 342
398 3300025949 Ga0207667_10047827 Ga0207667_100478274 342
399 3300025949 Ga0207667_10054220 Ga0207667_100542202 342
400 3300025949 Ga0207667_10178681 Ga0207667_101786812 342
401 3300025960 Ga0207651_10087413 Ga0207651_100874133 342
402 3300026041 Ga0207639_10000355 Ga0207639_1000035531 342
403 3300026067 Ga0207678_10152460 Ga0207678_101524603 342
404 3300026078 Ga0207702_10091830 Ga0207702_100918302 342
405 3300026088 Ga0207641_10077587 Ga0207641_100775872 342
406 3300026089 Ga0207648_10051696 Ga0207648_100516962 342
407 3300026116 Ga0207674_10085815 Ga0207674_100858152 342
408 3300026118 Ga0207675_100049258 Ga0207675_1000492582 342
409 3300026121 Ga0207683_10045488 Ga0207683_100454883 342
410 3300026142 Ga0207698_10000697 Ga0207698_1000069714 342
411 3300026142 Ga0207698_10043497 Ga0207698_100434972 342
412 3300027876 Ga0209974_10050848 Ga0209974_100508482 342
413 3300031731 Ga0307405_10215743 Ga0307405_102157432 342
414 3300031824 Ga0307413_10000677 Ga0307413_100006776 342
415 3300031824 Ga0307413_10034974 Ga0307413_100349742 342
416 3300031824 Ga0307413_10039482 Ga0307413_100394822 342
417 3300031824 Ga0307413_10249791 Ga0307413_102497912 342
418 3300031824 Ga0307413_10257797 Ga0307413_102577971 342
419 3300031852 Ga0307410_10004499 Ga0307410_100044998 342
420 3300031852 Ga0307410_10231257 Ga0307410_102312572 342
421 3300031901 Ga0307406_10057911 Ga0307406_100579112 342
422 3300031901 Ga0307406_10061317 Ga0307406_100613172 342
423 3300031903 Ga0307407_10002710 Ga0307407_100027103 342
424 3300031911 Ga0307412_10122258 Ga0307412_101222582 342
425 3300031911 Ga0307412_10258658 Ga0307412_102586582 342
426 3300031995 Ga0307409_100085361 Ga0307409_1000853613 342
427 3300031995 Ga0307409_100303176 Ga0307409_1003031762 342
428 3300032002 Ga0307416_100152871 Ga0307416_1001528712 342
429 3300032004 Ga0307414_10003157 Ga0307414_100031576 342
430 3300032004 Ga0307414_10211073 Ga0307414_102110732 342
431 3300032005 Ga0307411_10009395 Ga0307411_100093952 342
432 3300032005 Ga0307411_10067416 Ga0307411_100674162 342
433 3300032126 Ga0307415_100358219 Ga0307415_1003582191 342
434 3300037312 Ga0395899_0183618 Ga0395899_0183618_336_1433 342
435 3300037418 Ga0395900_0002843 Ga0395900_0002843_6545_7642 342
436 3300037418 Ga0395900_0147247 Ga0395900_0147247_221_1318 342
437 3300037418 Ga0395900_0270979 Ga0395900_0270979_125_1222 342
438 3300037466 Ga0395898_0102607 Ga0395898_0102607_980_2077 342
439 3300037466 Ga0395898_0144196 Ga0395898_0144196_93_1190 342
440 3300037471 Ga0395905_0001330 Ga0395905_0001330_27562_28659 342
441 3300037471 Ga0395905_0059847 Ga0395905_0059847_1833_2930 342
442 3300037471 Ga0395905_0397586 Ga0395905_0397586_12_1109 342
443 3300038443 Ga0395901_0000486 Ga0395901_0000486_20634_21731 342
444 3300038443 Ga0395901_0096274 Ga0395901_0096274_504_1601 342
445 3300038443 Ga0395901_0107911 Ga0395901_0107911_221_1318 342
446 3300038443 Ga0395901_0150354 Ga0395901_0150354_840_1937 342
447 3300038443 Ga0395901_0242873 Ga0395901_0242873_189_1286 342
448 3300042015 Ga0439462_0038154 Ga0439462_0038154_34_1131 342
449 3300045976 Ga0466967_0027764 Ga0466967_0027764_1261_2358 342
450 3300045976 Ga0466967_0047341 Ga0466967_0047341_1690_2793 342
451 3300046525 Ga0495663_0000587 Ga0495663_0000587_10225_11322 342
452 3300046537 Ga0495598_0014211 Ga0495598_0014211_70_1167 342
453 3300046558 Ga0495633_0010142 Ga0495633_0010142_3831_4928 342
454 3300046664 Ga0495659_0012566 Ga0495659_0012566_682_1779 342
455 3300046684 Ga0495669_0008913 Ga0495669_0008913_1926_3023 342
456 3300048910 Ga0496107_0101501 Ga0496107_0101501_311_1408 342
457 3300048912 Ga0496109_0066501 Ga0496109_0066501_273_1436 342
458 3300048912 Ga0496109_0134521 Ga0496109_0134521_827_1924 342
459 3300048914 Ga0496111_0099194 Ga0496111_0099194_310_1407 342
460 3300050491 nmdc:mga00v17_6035_c1 nmdc:mga00v17_6035_c1_2868_3965 342
461 3300050510 nmdc:mga06r32_27084_c1 nmdc:mga06r32_27084_c1_1402_2499 342

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03739

LptF_LptG

Lipopolysaccharide export system permease LptF/LptG

14

364

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6s8n-assembly1.cif.gz_G cryo-em structure of lptb2fgc in complex with lipopolysaccharide 0.7279 13 342
6s8n-assembly1.cif.gz_G cryo-em structure of lptb2fgc in complex with lipopolysaccharide 0.7192 13 342
6s8h-assembly1.cif.gz_G cryo-em structure of lptb2fg in complex with lps 0.7075 8 339
6s8h-assembly1.cif.gz_G cryo-em structure of lptb2fg in complex with lps 0.7014 8 339
6s8g-assembly1.cif.gz_G cryo-em structure of lptb2fgc in complex with amp-pnp 0.672 8 339
ID Description Score Start End Superfamily
af_A0A0G2KF42_95_272_1.20.900.10 Mainly Alpha;Up-down Bundle;Dbl Homology Domain; Chain A;Dbl homology (DH) domain 0.686 232 273 1.20.900.10
af_Q8I1Q3_26_106_2.30.30.100 Mainly Beta;Roll;SH3 type barrels.; 0.5866 151 204 2.30.30.100
4emhA00 Mainly Beta;Roll;SH3 type barrels.; 0.5612 159 204 2.30.30.100
af_Q8I0K2_88_203_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.4684 149 204 2.60.40.10
4emhA00 Mainly Beta;Roll;SH3 type barrels.; 0.4525 159 204 2.30.30.100
ID Description Score Start End GO Terms
AF-A0A522AD52-F1-model_v4 LptF/LptG family permease 0.8973 10 145 GO:0015920
GO:0043190
AF-A0A522AD52-F1-model_v4 LptF/LptG family permease 0.8513 10 145 GO:0015920
GO:0043190
AF-A0A3B0RYY7-F1-model_v4 Lipopolysaccharide export system permease protein LptG 0.8434 6 263 GO:0015920
GO:0043190
AF-A0A2D8X3Y1-F1-model_v4 LPS export ABC transporter permease LptG 0.8066 2 342 GO:0015920
GO:0043190
GO:0055085
AF-A0A2D8X3Y1-F1-model_v4 LPS export ABC transporter permease LptG 0.8019 2 342 GO:0015920
GO:0043190
GO:0055085

Feature Viewer

pLDDT pTM Quality
75.67 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map