F448787

General Info

Members Datasets Scaffolds Average Seq Length
461 259 922 137

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_1106206|Ga0451576_1106206_10_483
Length 157
Sequence MTMSYCIDSRGMRRIIIGAPMEALRSGPRKLVHVERIAIRWGDMDAMGHVNNTVYFRYMEQARISWFDALVPEDEAWKSTGIVIANASCNFKRAINYPGTVEVQVYVGPPGGSSVATYYELMIGGELHADGAATVVFIDMVRQKPVRIPQTIRERLP

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
130 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
138 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
139 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
140 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
142 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
143 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
144 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
145 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
146 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
151 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
156 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
157 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
158 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
159 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
160 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
161 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
162 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
163 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
164 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
165 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
166 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
167 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
168 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
169 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
170 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
171 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
172 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
173 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
174 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
175 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
176 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
179 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
180 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
181 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
182 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
183 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
184 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
185 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
186 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
187 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
188 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
189 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
190 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
191 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
192 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
193 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
194 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
195 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
196 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
197 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
198 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
199 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
200 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
201 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
207 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
223 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
224 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
225 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
226 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
227 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
228 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
229 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
230 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
231 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
232 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
233 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
234 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
235 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
236 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
237 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
238 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
239 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
240 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
241 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
244 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
245 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
246 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
247 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
251 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
252 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
253 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
254 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
255 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
256 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
257 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
258 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
259 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.87
Rhizosphere 98.92
Stem 0
Stem Tuber 0
Unclassified 0.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_1106206 3300045051 Bacteria 829
2 Ga0070690_100255583 3300005330 Bacteria 1241
3 Ga0070690_101184921 3300005330 Bacteria 609
4 Ga0068869_100053067 3300005334 Bacteria 2945
5 Ga0068869_100619337 3300005334 Bacteria 916
6 Ga0068868_100025091 3300005338 Bacteria 4528
7 Ga0070660_100206311 3300005339 Bacteria 1595
8 Ga0070660_101078590 3300005339 Bacteria 679
9 Ga0070689_100192945 3300005340 Bacteria 1659
10 Ga0070691_10095614 3300005341 Bacteria 1470
11 Ga0070687_100426574 3300005343 Bacteria 876
12 Ga0070692_10877004 3300005345 Bacteria 619
13 Ga0070675_100175202 3300005354 Bacteria 1852
14 Ga0070675_101528228 3300005354 Bacteria 616
15 Ga0070674_100059168 3300005356 Bacteria 2667
16 Ga0070673_100110603 3300005364 Bacteria 2278
17 Ga0070673_100611025 3300005364 Bacteria 995
18 Ga0070673_101074728 3300005364 Bacteria 751
19 Ga0070659_101095199 3300005366 Bacteria 702
20 Ga0070667_100310005 3300005367 Bacteria 1422
21 Ga0070709_10476540 3300005434 Bacteria 944
22 Ga0070714_100038810 3300005435 Bacteria 4006
23 Ga0070701_11022275 3300005438 Bacteria 578
24 Ga0070711_100235946 3300005439 Bacteria 1428
25 Ga0070705_100045975 3300005440 Bacteria 2515
26 Ga0070700_100791765 3300005441 Bacteria 763
27 Ga0070700_101186059 3300005441 Bacteria 637
28 Ga0070694_100491723 3300005444 Bacteria 975
29 Ga0070708_101286426 3300005445 Unclassified 683
30 Ga0070678_100266550 3300005456 Bacteria 1443
31 Ga0070662_100433375 3300005457 Bacteria 1089
32 Ga0070681_10012079 3300005458 Bacteria 8564
33 Ga0070681_10104717 3300005458 Bacteria 2771
34 Ga0068867_100166021 3300005459 Bacteria 1744
35 Ga0068867_100277745 3300005459 Bacteria 1372
36 Ga0070685_11408956 3300005466 Bacteria 535
37 Ga0070707_102141196 3300005468 Bacteria 527
38 Ga0070699_100066082 3300005518 Bacteria 3139
39 Ga0070679_100074560 3300005530 Bacteria 3384
40 Ga0070697_100005259 3300005536 Bacteria 9939
41 Ga0070686_100052994 3300005544 Bacteria 2589
42 Ga0070686_100385548 3300005544 Bacteria 1062
43 Ga0070695_100039795 3300005545 Bacteria 2973
44 Ga0070695_100136022 3300005545 Bacteria 1699
45 Ga0070695_100648191 3300005545 Bacteria 834
46 Ga0070695_100766000 3300005545 Bacteria 771
47 Ga0070696_100011601 3300005546 Bacteria 5903
48 Ga0070696_100288694 3300005546 Bacteria 1252
49 Ga0070696_100482924 3300005546 Bacteria 983
50 Ga0070696_101507819 3300005546 Bacteria 576
51 Ga0070693_101498950 3300005547 Bacteria 527
52 Ga0070665_100132810 3300005548 Bacteria 2491
53 Ga0070704_100320991 3300005549 Bacteria 1298
54 Ga0070704_100671062 3300005549 Bacteria 917
55 Ga0068855_100158119 3300005563 Bacteria 2574
56 Ga0068857_100004930 3300005577 Bacteria 11328
57 Ga0070702_100075233 3300005615 Bacteria 2006
58 Ga0070702_100463196 3300005615 Bacteria 922
59 Ga0070702_100740681 3300005615 Bacteria 754
60 Ga0068852_100011286 3300005616 Bacteria 6719
61 Ga0068859_100017154 3300005617 Bacteria 7272
62 Ga0068859_102976456 3300005617 Bacteria 518
63 Ga0068864_100047426 3300005618 Bacteria 3690
64 Ga0068864_100443930 3300005618 Bacteria 1240
65 Ga0068866_10130735 3300005718 Bacteria 1428
66 Ga0068861_100231942 3300005719 Bacteria 1566
67 Ga0068861_100330347 3300005719 Bacteria 1331
68 Ga0068861_100763886 3300005719 Bacteria 904
69 Ga0068851_10000705 3300005834 Bacteria 14267
70 Ga0068863_100270301 3300005841 Bacteria 1645
71 Ga0068858_100117310 3300005842 Bacteria 2488
72 Ga0068862_100097575 3300005844 Bacteria 2566
73 Ga0081539_10003810 3300005985 Bacteria 17734
74 Ga0070716_100447578 3300006173 Bacteria 941
75 Ga0097621_100031411 3300006237 Bacteria 4215
76 Ga0097621_100236399 3300006237 Bacteria 1596
77 Ga0097621_100238705 3300006237 Bacteria 1588
78 Ga0097621_100727468 3300006237 Bacteria 915
79 Ga0097621_101918171 3300006237 Bacteria 565
80 Ga0068871_100014080 3300006358 Bacteria 5948
81 Ga0068871_100046150 3300006358 Bacteria 3508
82 Ga0075428_100192887 3300006844 Bacteria 2203
83 Ga0075430_100014645 3300006846 Bacteria 6680
84 Ga0075430_100200255 3300006846 Bacteria 1658
85 Ga0075431_100108415 3300006847 Bacteria 2866
86 Ga0075431_100163562 3300006847 Bacteria 2288
87 Ga0075431_100244690 3300006847 Bacteria 1823
88 Ga0075431_100629808 3300006847 Bacteria 1054
89 Ga0075433_10078704 3300006852 Bacteria 2905
90 Ga0075433_10810136 3300006852 Bacteria 818
91 Ga0075433_10907073 3300006852 Bacteria 769
92 Ga0075434_100001924 3300006871 Bacteria 18003
93 Ga0075434_100018880 3300006871 Bacteria 6665
94 Ga0075434_100239462 3300006871 Bacteria 1835
95 Ga0075434_101845848 3300006871 Bacteria 611
96 Ga0075429_100056194 3300006880 Bacteria 3425
97 Ga0075429_100282425 3300006880 Bacteria 1454
98 Ga0075429_100328045 3300006880 Bacteria 1339
99 Ga0075429_101110954 3300006880 Bacteria 690
100 Ga0068865_100879890 3300006881 Bacteria 778
101 Ga0075436_100000364 3300006914 Bacteria 28914
102 Ga0075436_100025971 3300006914 Bacteria 4032
103 Ga0075436_100095688 3300006914 Bacteria 2066
104 Ga0097620_100017154 3300006931 Bacteria 7272
105 Ga0097620_102977893 3300006931 Bacteria 518
106 Ga0075435_100361068 3300007076 Bacteria 1246
107 Ga0075435_100811560 3300007076 Bacteria 815
108 Ga0075435_101011731 3300007076 Bacteria 726
109 Ga0099794_10152582 3300007265 Bacteria 1173
110 Ga0105240_10024263 3300009093 Bacteria 8002
111 Ga0111539_10103460 3300009094 Bacteria 3342
112 Ga0111539_12003295 3300009094 Bacteria 672
113 Ga0105245_10029283 3300009098 Bacteria 4863
114 Ga0105245_10447613 3300009098 Bacteria 1299
115 Ga0105247_10569028 3300009101 Viruses 836
116 Ga0114129_10073877 3300009147 Bacteria 4750
117 Ga0114129_10277972 3300009147 Bacteria 2238
118 Ga0114129_10449021 3300009147 Bacteria 1691
119 Ga0114129_10952988 3300009147 Bacteria 1084
120 Ga0105242_10024780 3300009176 Bacteria 4741
121 Ga0105242_11265736 3300009176 Bacteria 760
122 Ga0105242_11756764 3300009176 Bacteria 658
123 Ga0105248_10691294 3300009177 Bacteria 1151
124 Ga0105237_10449117 3300009545 Bacteria 1295
125 Ga0105237_11723948 3300009545 Unclassified 634
126 Ga0105238_10166570 3300009551 Bacteria 2179
127 Ga0105238_11033974 3300009551 Bacteria 843
128 Ga0105238_12522821 3300009551 Bacteria 550
129 Ga0105239_10431556 3300010375 Bacteria 1494
130 Ga0105239_12418564 3300010375 Bacteria 612
131 Ga0157370_10682654 3300013104 Bacteria 938
132 Ga0157374_10138540 3300013296 Bacteria 2360
133 Ga0157374_10806371 3300013296 Bacteria 955
134 Ga0157378_10734717 3300013297 Bacteria 1009
135 Ga0157378_11379023 3300013297 Bacteria 747
136 Ga0157378_11627825 3300013297 Bacteria 692
137 Ga0157375_10083637 3300013308 Bacteria 3237
138 Ga0157379_10160372 3300014968 Bacteria 2030
139 Ga0157379_10463689 3300014968 Bacteria 1171
140 Ga0157376_11348987 3300014969 Bacteria 744
141 Ga0163161_10454812 3300017792 Bacteria 1036
142 Ga0207656_10029353 3300025321 Bacteria 2264
143 Ga0207653_10048589 3300025885 Bacteria 1407
144 Ga0207642_10044545 3300025899 Bacteria 1964
145 Ga0207710_10193454 3300025900 Bacteria 1002
146 Ga0207685_10030447 3300025905 Bacteria 1921
147 Ga0207705_10029058 3300025909 Bacteria 3942
148 Ga0207654_10018249 3300025911 Bacteria 3678
149 Ga0207707_10001702 3300025912 Bacteria 20238
150 Ga0207707_10077821 3300025912 Bacteria 2895
151 Ga0207695_10285314 3300025913 Bacteria 1544
152 Ga0207660_10282021 3300025917 Bacteria 1319
153 Ga0207662_10123628 3300025918 Bacteria 1625
154 Ga0207662_10170441 3300025918 Bacteria 1396
155 Ga0207662_10218845 3300025918 Bacteria 1239
156 Ga0207662_10292600 3300025918 Bacteria 1080
157 Ga0207657_10136769 3300025919 Bacteria 2004
158 Ga0207657_10141584 3300025919 Bacteria 1965
159 Ga0207649_10836459 3300025920 Bacteria 720
160 Ga0207694_10130334 3300025924 Bacteria 2015
161 Ga0207687_10043929 3300025927 Bacteria 3081
162 Ga0207687_10619484 3300025927 Bacteria 913
163 Ga0207664_10065097 3300025929 Bacteria 2917
164 Ga0207706_10337683 3300025933 Bacteria 1311
165 Ga0207686_10026109 3300025934 Bacteria 3406
166 Ga0207670_10041032 3300025936 Bacteria 3041
167 Ga0207670_10296493 3300025936 Bacteria 1265
168 Ga0207704_10145511 3300025938 Bacteria 1664
169 Ga0207665_10049224 3300025939 Bacteria 2831
170 Ga0207665_10434652 3300025939 Bacteria 1005
171 Ga0207691_10937348 3300025940 Bacteria 724
172 Ga0207711_10233614 3300025941 Bacteria 1684
173 Ga0207711_10240811 3300025941 Bacteria 1659
174 Ga0207689_10012321 3300025942 Bacteria 7317
175 Ga0207689_10769766 3300025942 Bacteria 812
176 Ga0207651_10795547 3300025960 Bacteria 838
177 Ga0207658_10038238 3300025986 Bacteria 3455
178 Ga0207677_10004833 3300026023 Bacteria 7271
179 Ga0207677_10228431 3300026023 Bacteria 1497
180 Ga0207703_10315030 3300026035 Bacteria 1431
181 Ga0207703_11454822 3300026035 Bacteria 659
182 Ga0207708_10168603 3300026075 Bacteria 1732
183 Ga0207708_11033999 3300026075 Bacteria 715
184 Ga0207641_10084734 3300026088 Bacteria 2760
185 Ga0207648_10054802 3300026089 Bacteria 3482
186 Ga0207676_10094222 3300026095 Bacteria 2467
187 Ga0207674_10006165 3300026116 Bacteria 14155
188 Ga0207675_100697965 3300026118 Bacteria 1023
189 Ga0207675_101133394 3300026118 Bacteria 802
190 Ga0207683_10083414 3300026121 Bacteria 2840
191 Ga0207698_10043632 3300026142 Bacteria 3361
192 Ga0207698_11090647 3300026142 Bacteria 811
193 Ga0209967_1002364 3300027364 Bacteria 2440
194 Ga0209981_1000279 3300027378 Bacteria 6515
195 Ga0209996_1011189 3300027395 Bacteria 1196
196 Ga0209996_1013757 3300027395 Bacteria 1095
197 Ga0209984_1060093 3300027424 Bacteria 562
198 Ga0209968_1007750 3300027526 Bacteria 1628
199 Ga0209968_1017996 3300027526 Bacteria 1130
200 Ga0209999_1000757 3300027543 Bacteria 5274
201 Ga0209999_1024157 3300027543 Bacteria 1121
202 Ga0209999_1044873 3300027543 Bacteria 831
203 Ga0209974_10028692 3300027876 Bacteria 1843
204 Ga0207428_10309003 3300027907 Bacteria 1169
205 Ga0268265_10079648 3300028380 Bacteria 2581
206 Ga0268264_10214599 3300028381 Bacteria 1768
207 Ga0307408_100543326 3300031548 Bacteria 1024
208 Ga0307408_101172622 3300031548 Bacteria 715
209 Ga0307408_102019164 3300031548 Bacteria 555
210 Ga0316575_10004609 3300031665 Bacteria 4857
211 Ga0316578_10008886 3300031728 Bacteria 5137
212 Ga0307413_10192728 3300031824 Bacteria 1465
213 Ga0326468_10080960 3300031889 Bacteria 561
214 Ga0307412_10324543 3300031911 Bacteria 1226
215 Ga0307409_100180154 3300031995 Bacteria 1870
216 Ga0307416_100060369 3300032002 Bacteria 3088
217 Ga0307411_10164775 3300032005 Bacteria 1665
218 Ga0373938_0032012 3300034957 Bacteria 1131
219 Ga0373938_0107375 3300034957 Bacteria 707
220 Ga0373929_0046449 3300035085 Bacteria 981
221 Ga0373940_0133819 3300035088 Bacteria 778
222 Ga0373923_0013655 3300035111 Bacteria 3032
223 Ga0373936_0101947 3300035113 Bacteria 1211
224 Ga0373941_0186772 3300035115 Bacteria 781
225 Ga0373945_0001690 3300035116 Bacteria 6794
226 Ga0373953_0201334 3300035117 Bacteria 861
227 Ga0373954_0000099 3300035118 Bacteria 29105
228 Ga0373960_0009577 3300035121 Bacteria 2350
229 Ga0373955_0084276 3300035172 Bacteria 1802
230 Ga0373924_0033961 3300035410 Bacteria 2063
231 Ga0373931_0085418 3300035691 Bacteria 1749
232 Ga0373933_0333508 3300035724 Bacteria 984
233 Ga0373947_0223420 3300035725 Bacteria 1238
234 Ga0373947_0460219 3300035725 Bacteria 862
235 Ga0373947_0619667 3300035725 Bacteria 738
236 Ga0373937_0002109 3300036401 Bacteria 16624
237 Ga0373937_0009662 3300036401 Bacteria 8401
238 Ga0373937_0080690 3300036401 Bacteria 3009
239 Ga0373937_0106929 3300036401 Bacteria 2601
240 Ga0373937_0253727 3300036401 Bacteria 1658
241 Ga0373937_0449814 3300036401 Bacteria 1223
242 Ga0316582_0003077 3300036647 Bacteria 8060
243 Ga0373925_0047200 3300037068 Bacteria 3205
244 Ga0373925_1109561 3300037068 Bacteria 651
245 Ga0439453_0005500 3300041408 Bacteria 1932
246 Ga0451853_1251936 3300041512 Bacteria 692
247 Ga0439441_006010 3300042001 Bacteria 1908
248 Ga0439441_082433 3300042001 Bacteria 702
249 Ga0439443_005014 3300042003 Bacteria 1754
250 Ga0439443_009616 3300042003 Bacteria 1388
251 Ga0439446_0016639 3300042156 Bacteria 2049
252 Ga0439446_0051548 3300042156 Bacteria 1230
253 Ga0439434_0003026 3300042435 Bacteria 4928
254 Ga0439435_0000500 3300042436 Bacteria 6247
255 Ga0439435_0000597 3300042436 Bacteria 5854
256 Ga0439435_0006120 3300042436 Bacteria 2689
257 Ga0439444_0001523 3300042437 Bacteria 3034
258 Ga0439444_0007120 3300042437 Bacteria 1709
259 Ga0439460_0002156 3300042461 Bacteria 4722
260 Ga0439460_0029404 3300042461 Bacteria 1555
261 Ga0466965_0301815 3300044683 Bacteria 869
262 Ga0466963_0107451 3300044694 Bacteria 1914
263 Ga0466964_0304797 3300044706 Bacteria 804
264 Ga0451576_0003916 3300045051 Bacteria 19882
265 Ga0451576_0083318 3300045051 Bacteria 3327
266 Ga0466967_0009289 3300045976 Bacteria 7287
267 Ga0495592_0001157 3300046454 Bacteria 18304
268 Ga0495641_0127453 3300046461 Bacteria 1136
269 Ga0495653_0111984 3300046463 Bacteria 1960
270 Ga0495580_0028666 3300046472 Bacteria 4046
271 Ga0495639_0142149 3300046475 Bacteria 1154
272 Ga0495662_0011605 3300046476 Bacteria 4307
273 Ga0495662_0021202 3300046476 Bacteria 3142
274 Ga0495608_0005556 3300046511 Bacteria 9006
275 Ga0495608_0129166 3300046511 Bacteria 1618
276 Ga0495618_0044311 3300046514 Bacteria 2806
277 Ga0495628_0007135 3300046516 Bacteria 9676
278 Ga0495630_0081279 3300046517 Bacteria 2445
279 Ga0495630_0746240 3300046517 Bacteria 748
280 Ga0495666_0037503 3300046526 Bacteria 2357
281 Ga0495666_0106060 3300046526 Bacteria 1322
282 Ga0495642_0041623 3300046528 Bacteria 1869
283 Ga0495652_0104749 3300046529 Bacteria 2287
284 Ga0495665_0152204 3300046531 Bacteria 1207
285 Ga0495640_0002890 3300046533 Bacteria 13841
286 Ga0495586_0001095 3300046535 Bacteria 15316
287 Ga0495586_0003158 3300046535 Bacteria 8864
288 Ga0495587_0103967 3300046536 Bacteria 1635
289 Ga0495621_0471647 3300046539 Bacteria 539
290 Ga0495667_0003361 3300046559 Bacteria 10709
291 Ga0495634_0014760 3300046642 Bacteria 5620
292 Ga0495635_0057694 3300046663 Bacteria 2671
293 Ga0495659_0082232 3300046664 Bacteria 1224
294 Ga0495599_0036257 3300046678 Bacteria 3096
295 Ga0495647_0000806 3300046681 Bacteria 9366
296 Ga0495658_0007999 3300046683 Bacteria 5239
297 Ga0495658_0170391 3300046683 Bacteria 1347
298 Ga0495658_0223413 3300046683 Bacteria 1180
299 Ga0495669_0022373 3300046684 Bacteria 2745
300 Ga0495613_0009305 3300046689 Bacteria 7290
301 Ga0495624_0160200 3300046690 Bacteria 1375
302 Ga0495600_0001981 3300046809 Bacteria 11507
303 Ga0495581_0122437 3300047315 Bacteria 1514
304 Ga0495581_0909939 3300047315 Bacteria 502
305 Ga0495604_0020041 3300047317 Bacteria 5345
306 Ga0495604_0176037 3300047317 Bacteria 1500
307 Ga0495604_0313771 3300047317 Bacteria 1050
308 Ga0495636_0012862 3300047318 Bacteria 3317
309 Ga0495676_0320972 3300047321 Bacteria 1040
310 Ga0495680_0002897 3300047322 Bacteria 17243
311 Ga0496102_0592823 3300048905 Bacteria 1031
312 Ga0496104_0032427 3300048907 Bacteria 4862
313 Ga0496110_0124938 3300048913 Bacteria 2321
314 Ga0496115_0303009 3300048918 Bacteria 1309
315 Ga0501291_127668 3300049514 Bacteria 557
316 Ga0501031_0007844 3300049568 Bacteria 6950
317 Ga0501032_0016064 3300049569 Bacteria 5270
318 Ga0501033_0007030 3300049570 Bacteria 8791
319 Ga0501033_0201416 3300049570 Bacteria 1422
320 Ga0501034_0679636 3300049571 Bacteria 929
321 Ga0501036_0065931 3300049572 Bacteria 3063
322 Ga0501037_0175100 3300049573 Bacteria 1524
323 Ga0501037_0199975 3300049573 Bacteria 1412
324 Ga0501038_0000804 3300049574 Bacteria 27808
325 Ga0501038_0471732 3300049574 Bacteria 963
326 Ga0501038_1248613 3300049574 Bacteria 538
327 Ga0501039_0001661 3300049575 Bacteria 16380
328 Ga0501039_0455650 3300049575 Bacteria 1005
329 Ga0501039_0516133 3300049575 Bacteria 938
330 Ga0501040_0000269 3300049576 Bacteria 30300
331 Ga0501040_0365432 3300049576 Bacteria 1034
332 Ga0501040_0804871 3300049576 Bacteria 680
333 Ga0501041_0000179 3300049577 Bacteria 28614
334 Ga0501041_0066053 3300049577 Bacteria 2216
335 Ga0501041_0229985 3300049577 Bacteria 1164
336 Ga0501041_0456119 3300049577 Bacteria 812
337 Ga0501042_0024385 3300049578 Bacteria 4242
338 Ga0501042_0272768 3300049578 Bacteria 1221
339 Ga0501042_0454955 3300049578 Bacteria 928
340 Ga0501042_0812864 3300049578 Bacteria 680
341 Ga0501043_0093196 3300049579 Bacteria 2368
342 Ga0501043_0741202 3300049579 Bacteria 715
343 Ga0501046_0001666 3300049580 Bacteria 21235
344 Ga0501046_0282015 3300049580 Bacteria 1217
345 Ga0501046_0326625 3300049580 Bacteria 1117
346 Ga0501046_0435904 3300049580 Bacteria 943
347 Ga0501047_0217152 3300049581 Bacteria 1769
348 Ga0501048_0016248 3300049582 Bacteria 5487
349 Ga0501048_0087783 3300049582 Bacteria 2194
350 Ga0501048_0378335 3300049582 Bacteria 1011
351 Ga0501048_0656255 3300049582 Bacteria 753
352 Ga0501067_0114739 3300049583 Bacteria 1498
353 Ga0501068_0001985 3300049584 Bacteria 10890
354 Ga0501068_0105234 3300049584 Bacteria 1751
355 Ga0501069_0188573 3300049585 Bacteria 1193
356 Ga0501069_0198192 3300049585 Bacteria 1163
357 Ga0501070_0368734 3300049586 Bacteria 1164
358 Ga0501071_0000316 3300049587 Bacteria 23302
359 Ga0501071_0001058 3300049587 Bacteria 15247
360 Ga0501071_0094334 3300049587 Bacteria 2201
361 Ga0501071_0117225 3300049587 Bacteria 1972
362 Ga0501071_0211907 3300049587 Bacteria 1457
363 Ga0501071_0323223 3300049587 Bacteria 1172
364 Ga0501071_1556349 3300049587 Bacteria 510
365 Ga0501072_0002084 3300049588 Bacteria 14890
366 Ga0501072_0012332 3300049588 Bacteria 6531
367 Ga0501072_0024492 3300049588 Bacteria 4695
368 Ga0501072_0070379 3300049588 Bacteria 2763
369 Ga0501072_0795214 3300049588 Bacteria 741
370 Ga0501072_1252138 3300049588 Bacteria 576
371 Ga0501073_0073878 3300049589 Bacteria 2374
372 Ga0501073_0091090 3300049589 Bacteria 2119
373 Ga0501074_0003707 3300049590 Bacteria 10834
374 Ga0501074_0634440 3300049590 Bacteria 755
375 Ga0501075_0001370 3300049591 Bacteria 15838
376 Ga0501075_0004660 3300049591 Bacteria 9303
377 Ga0501075_0051943 3300049591 Bacteria 3082
378 Ga0501075_0092314 3300049591 Bacteria 2298
379 Ga0501075_0237877 3300049591 Bacteria 1388
380 Ga0501075_0503853 3300049591 Bacteria 924
381 Ga0501076_0045353 3300049592 Bacteria 3470
382 Ga0501076_0092041 3300049592 Bacteria 2439
383 Ga0501076_0104954 3300049592 Bacteria 2280
384 Ga0501076_0409298 3300049592 Bacteria 1116
385 Ga0501076_1185198 3300049592 Bacteria 629
386 Ga0501077_0079442 3300049593 Bacteria 2078
387 Ga0501077_0147094 3300049593 Bacteria 1495
388 Ga0501199_048838 3300049650 Bacteria 567
389 Ga0501216_053388 3300049660 Bacteria 799
390 Ga0501235_193211 3300049669 Bacteria 548
391 Ga0501229_062067 3300049706 Bacteria 571
392 Ga0501079_0000468 3300049741 Bacteria 26634
393 Ga0501079_0176258 3300049741 Bacteria 1667
394 Ga0501079_0190573 3300049741 Bacteria 1600
395 Ga0501079_0269378 3300049741 Bacteria 1331
396 Ga0501080_0005463 3300049742 Bacteria 11342
397 Ga0501080_0101228 3300049742 Bacteria 2673
398 Ga0501080_0139442 3300049742 Bacteria 2242
399 Ga0501080_0359106 3300049742 Bacteria 1315
400 Ga0501081_0000151 3300049743 Bacteria 31796
401 Ga0501081_0005633 3300049743 Bacteria 8096
402 Ga0501081_0104537 3300049743 Bacteria 2005
403 Ga0501081_0135321 3300049743 Bacteria 1764
404 Ga0501081_0227631 3300049743 Bacteria 1357
405 Ga0501081_0309965 3300049743 Bacteria 1159
406 Ga0501083_0426675 3300049744 Bacteria 863
407 Ga0501035_0018432 3300049822 Bacteria 6432
408 Ga0501044_0464256 3300049823 Bacteria 1171
409 Ga0501045_0000565 3300049824 Bacteria 23263
410 Ga0501045_0009186 3300049824 Bacteria 6907
411 Ga0501045_0020665 3300049824 Bacteria 4704
412 Ga0501045_0364054 3300049824 Bacteria 1076
413 Ga0501045_0368651 3300049824 Bacteria 1069
414 nmdc:mga05p37_1336318_c1 3300050507 Bacteria 727
415 nmdc:mga05p37_1783424_c1 3300050507 Bacteria 595
416 nmdc:mga05p37_2193696_c1 3300050507 Bacteria 513
417 nmdc:mga05p37_410765_c1 3300050507 Bacteria 1578
418 nmdc:mga05p37_60086_c1 3300050507 Bacteria 4680
419 nmdc:mga09592_127267_c1 3300050508 Bacteria 2190
420 nmdc:mga09592_437614_c1 3300050508 Bacteria 1129
421 nmdc:mga0qj67_112911_c1 3300050509 Bacteria 2194
422 nmdc:mga0qj67_218673_c1 3300050509 Bacteria 1547
423 nmdc:mga0qj67_32641_c1 3300050509 Bacteria 4062
424 nmdc:mga0qj67_805059_c1 3300050509 Bacteria 744
425 nmdc:mga06r32_100726_c1 3300050510 Bacteria 2834
426 nmdc:mga06r32_148366_c1 3300050510 Bacteria 2323
427 nmdc:mga06r32_234638_c1 3300050510 Bacteria 1822
428 nmdc:mga08y16_86681_c1 3300050511 Bacteria 3263
429 nmdc:mga0n895_2044168_c1 3300050512 Bacteria 530
430 nmdc:mga0n895_2368_c1 3300050512 Bacteria 14701
431 nmdc:mga0n895_314493_c1 3300050512 Bacteria 1587
432 nmdc:mga0rr50_260195_c1 3300050513 Bacteria 1444
433 nmdc:mga0rr50_336026_c1 3300050513 Bacteria 1269
434 nmdc:mga0rr50_629200_c1 3300050513 Bacteria 915
435 nmdc:mga0rr50_80156_c1 3300050513 Bacteria 2516
436 nmdc:mga08x19_169444_c1 3300050514 Bacteria 1487
437 nmdc:mga08x19_2872_c1 3300050514 Bacteria 10380
438 nmdc:mga0a205_336547_c1 3300050515 Bacteria 1378
439 nmdc:mga0a205_507312_c1 3300050515 Bacteria 1063
440 nmdc:mga0a205_84047_c1 3300050515 Bacteria 3074
441 Ga0495601_0099616 3300053077 Bacteria 1876
442 Ga0495619_0405067 3300053085 Bacteria 942
443 Ga0495619_0476761 3300053085 Bacteria 859
444 Ga0501084_0000587 3300054114 Bacteria 27867
445 Ga0501084_0174826 3300054114 Bacteria 1812
446 Ga0501084_0182442 3300054114 Bacteria 1772
447 Ga0501084_0251503 3300054114 Bacteria 1492
448 Ga0501084_0469418 3300054114 Bacteria 1064
449 Ga0590071_009503 3300059421 Bacteria 2284
450 Ga0590077_016581 3300059426 Bacteria 1547
451 Ga0501082_0002293 3300060353 Bacteria 16730
452 Ga0501082_0022612 3300060353 Bacteria 5416
453 Ga0501082_0167466 3300060353 Bacteria 1910
454 Ga0501082_0737024 3300060353 Bacteria 862
455 Ga0501082_0793020 3300060353 Bacteria 829
456 Ga0530510_0000977 3300061734 Bacteria 18901
457 Ga0530510_0025005 3300061734 Bacteria 4269
458 Ga0530510_0038496 3300061734 Bacteria 3452
459 Ga0530510_0099092 3300061734 Bacteria 2131
460 Ga0530510_0384965 3300061734 Bacteria 1056
461 Ga0530510_0454224 3300061734 Bacteria 969
462 Ga0451576_1106206
463 Ga0070690_100255583
464 Ga0070690_101184921
465 Ga0068869_100053067
466 Ga0068869_100619337
467 Ga0068868_100025091
468 Ga0070660_100206311
469 Ga0070660_101078590
470 Ga0070689_100192945
471 Ga0070691_10095614
472 Ga0070687_100426574
473 Ga0070692_10877004
474 Ga0070675_100175202
475 Ga0070675_101528228
476 Ga0070674_100059168
477 Ga0070673_100110603
478 Ga0070673_100611025
479 Ga0070673_101074728
480 Ga0070659_101095199
481 Ga0070667_100310005
482 Ga0070709_10476540
483 Ga0070714_100038810
484 Ga0070701_11022275
485 Ga0070711_100235946
486 Ga0070705_100045975
487 Ga0070700_100791765
488 Ga0070700_101186059
489 Ga0070694_100491723
490 Ga0070708_101286426
491 Ga0070678_100266550
492 Ga0070662_100433375
493 Ga0070681_10012079
494 Ga0070681_10104717
495 Ga0068867_100166021
496 Ga0068867_100277745
497 Ga0070685_11408956
498 Ga0070707_102141196
499 Ga0070699_100066082
500 Ga0070679_100074560
501 Ga0070697_100005259
502 Ga0070686_100052994
503 Ga0070686_100385548
504 Ga0070695_100039795
505 Ga0070695_100136022
506 Ga0070695_100648191
507 Ga0070695_100766000
508 Ga0070696_100011601
509 Ga0070696_100288694
510 Ga0070696_100482924
511 Ga0070696_101507819
512 Ga0070693_101498950
513 Ga0070665_100132810
514 Ga0070704_100320991
515 Ga0070704_100671062
516 Ga0068855_100158119
517 Ga0068857_100004930
518 Ga0070702_100075233
519 Ga0070702_100463196
520 Ga0070702_100740681
521 Ga0068852_100011286
522 Ga0068859_100017154
523 Ga0068859_102976456
524 Ga0068864_100047426
525 Ga0068864_100443930
526 Ga0068866_10130735
527 Ga0068861_100231942
528 Ga0068861_100330347
529 Ga0068861_100763886
530 Ga0068851_10000705
531 Ga0068863_100270301
532 Ga0068858_100117310
533 Ga0068862_100097575
534 Ga0081539_10003810
535 Ga0070716_100447578
536 Ga0097621_100031411
537 Ga0097621_100236399
538 Ga0097621_100238705
539 Ga0097621_100727468
540 Ga0097621_101918171
541 Ga0068871_100014080
542 Ga0068871_100046150
543 Ga0075428_100192887
544 Ga0075430_100014645
545 Ga0075430_100200255
546 Ga0075431_100108415
547 Ga0075431_100163562
548 Ga0075431_100244690
549 Ga0075431_100629808
550 Ga0075433_10078704
551 Ga0075433_10810136
552 Ga0075433_10907073
553 Ga0075434_100001924
554 Ga0075434_100018880
555 Ga0075434_100239462
556 Ga0075434_101845848
557 Ga0075429_100056194
558 Ga0075429_100282425
559 Ga0075429_100328045
560 Ga0075429_101110954
561 Ga0068865_100879890
562 Ga0075436_100000364
563 Ga0075436_100025971
564 Ga0075436_100095688
565 Ga0097620_100017154
566 Ga0097620_102977893
567 Ga0075435_100361068
568 Ga0075435_100811560
569 Ga0075435_101011731
570 Ga0099794_10152582
571 Ga0105240_10024263
572 Ga0111539_10103460
573 Ga0111539_12003295
574 Ga0105245_10029283
575 Ga0105245_10447613
576 Ga0105247_10569028
577 Ga0114129_10073877
578 Ga0114129_10277972
579 Ga0114129_10449021
580 Ga0114129_10952988
581 Ga0105242_10024780
582 Ga0105242_11265736
583 Ga0105242_11756764
584 Ga0105248_10691294
585 Ga0105237_10449117
586 Ga0105237_11723948
587 Ga0105238_10166570
588 Ga0105238_11033974
589 Ga0105238_12522821
590 Ga0105239_10431556
591 Ga0105239_12418564
592 Ga0157370_10682654
593 Ga0157374_10138540
594 Ga0157374_10806371
595 Ga0157378_10734717
596 Ga0157378_11379023
597 Ga0157378_11627825
598 Ga0157375_10083637
599 Ga0157379_10160372
600 Ga0157379_10463689
601 Ga0157376_11348987
602 Ga0163161_10454812
603 Ga0207656_10029353
604 Ga0207653_10048589
605 Ga0207642_10044545
606 Ga0207710_10193454
607 Ga0207685_10030447
608 Ga0207705_10029058
609 Ga0207654_10018249
610 Ga0207707_10001702
611 Ga0207707_10077821
612 Ga0207695_10285314
613 Ga0207660_10282021
614 Ga0207662_10123628
615 Ga0207662_10170441
616 Ga0207662_10218845
617 Ga0207662_10292600
618 Ga0207657_10136769
619 Ga0207657_10141584
620 Ga0207649_10836459
621 Ga0207694_10130334
622 Ga0207687_10043929
623 Ga0207687_10619484
624 Ga0207664_10065097
625 Ga0207706_10337683
626 Ga0207686_10026109
627 Ga0207670_10041032
628 Ga0207670_10296493
629 Ga0207704_10145511
630 Ga0207665_10049224
631 Ga0207665_10434652
632 Ga0207691_10937348
633 Ga0207711_10233614
634 Ga0207711_10240811
635 Ga0207689_10012321
636 Ga0207689_10769766
637 Ga0207651_10795547
638 Ga0207658_10038238
639 Ga0207677_10004833
640 Ga0207677_10228431
641 Ga0207703_10315030
642 Ga0207703_11454822
643 Ga0207708_10168603
644 Ga0207708_11033999
645 Ga0207641_10084734
646 Ga0207648_10054802
647 Ga0207676_10094222
648 Ga0207674_10006165
649 Ga0207675_100697965
650 Ga0207675_101133394
651 Ga0207683_10083414
652 Ga0207698_10043632
653 Ga0207698_11090647
654 Ga0209967_1002364
655 Ga0209981_1000279
656 Ga0209996_1011189
657 Ga0209996_1013757
658 Ga0209984_1060093
659 Ga0209968_1007750
660 Ga0209968_1017996
661 Ga0209999_1000757
662 Ga0209999_1024157
663 Ga0209999_1044873
664 Ga0209974_10028692
665 Ga0207428_10309003
666 Ga0268265_10079648
667 Ga0268264_10214599
668 Ga0307408_100543326
669 Ga0307408_101172622
670 Ga0307408_102019164
671 Ga0316575_10004609
672 Ga0316578_10008886
673 Ga0307413_10192728
674 Ga0326468_10080960
675 Ga0307412_10324543
676 Ga0307409_100180154
677 Ga0307416_100060369
678 Ga0307411_10164775
679 Ga0373938_0032012
680 Ga0373938_0107375
681 Ga0373929_0046449
682 Ga0373940_0133819
683 Ga0373923_0013655
684 Ga0373936_0101947
685 Ga0373941_0186772
686 Ga0373945_0001690
687 Ga0373953_0201334
688 Ga0373954_0000099
689 Ga0373960_0009577
690 Ga0373955_0084276
691 Ga0373924_0033961
692 Ga0373931_0085418
693 Ga0373933_0333508
694 Ga0373947_0223420
695 Ga0373947_0460219
696 Ga0373947_0619667
697 Ga0373937_0002109
698 Ga0373937_0009662
699 Ga0373937_0080690
700 Ga0373937_0106929
701 Ga0373937_0253727
702 Ga0373937_0449814
703 Ga0316582_0003077
704 Ga0373925_0047200
705 Ga0373925_1109561
706 Ga0439453_0005500
707 Ga0451853_1251936
708 Ga0439441_006010
709 Ga0439441_082433
710 Ga0439443_005014
711 Ga0439443_009616
712 Ga0439446_0016639
713 Ga0439446_0051548
714 Ga0439434_0003026
715 Ga0439435_0000500
716 Ga0439435_0000597
717 Ga0439435_0006120
718 Ga0439444_0001523
719 Ga0439444_0007120
720 Ga0439460_0002156
721 Ga0439460_0029404
722 Ga0466965_0301815
723 Ga0466963_0107451
724 Ga0466964_0304797
725 Ga0451576_0003916
726 Ga0451576_0083318
727 Ga0466967_0009289
728 Ga0495592_0001157
729 Ga0495641_0127453
730 Ga0495653_0111984
731 Ga0495580_0028666
732 Ga0495639_0142149
733 Ga0495662_0011605
734 Ga0495662_0021202
735 Ga0495608_0005556
736 Ga0495608_0129166
737 Ga0495618_0044311
738 Ga0495628_0007135
739 Ga0495630_0081279
740 Ga0495630_0746240
741 Ga0495666_0037503
742 Ga0495666_0106060
743 Ga0495642_0041623
744 Ga0495652_0104749
745 Ga0495665_0152204
746 Ga0495640_0002890
747 Ga0495586_0001095
748 Ga0495586_0003158
749 Ga0495587_0103967
750 Ga0495621_0471647
751 Ga0495667_0003361
752 Ga0495634_0014760
753 Ga0495635_0057694
754 Ga0495659_0082232
755 Ga0495599_0036257
756 Ga0495647_0000806
757 Ga0495658_0007999
758 Ga0495658_0170391
759 Ga0495658_0223413
760 Ga0495669_0022373
761 Ga0495613_0009305
762 Ga0495624_0160200
763 Ga0495600_0001981
764 Ga0495581_0122437
765 Ga0495581_0909939
766 Ga0495604_0020041
767 Ga0495604_0176037
768 Ga0495604_0313771
769 Ga0495636_0012862
770 Ga0495676_0320972
771 Ga0495680_0002897
772 Ga0496102_0592823
773 Ga0496104_0032427
774 Ga0496110_0124938
775 Ga0496115_0303009
776 Ga0501291_127668
777 Ga0501031_0007844
778 Ga0501032_0016064
779 Ga0501033_0007030
780 Ga0501033_0201416
781 Ga0501034_0679636
782 Ga0501036_0065931
783 Ga0501037_0175100
784 Ga0501037_0199975
785 Ga0501038_0000804
786 Ga0501038_0471732
787 Ga0501038_1248613
788 Ga0501039_0001661
789 Ga0501039_0455650
790 Ga0501039_0516133
791 Ga0501040_0000269
792 Ga0501040_0365432
793 Ga0501040_0804871
794 Ga0501041_0000179
795 Ga0501041_0066053
796 Ga0501041_0229985
797 Ga0501041_0456119
798 Ga0501042_0024385
799 Ga0501042_0272768
800 Ga0501042_0454955
801 Ga0501042_0812864
802 Ga0501043_0093196
803 Ga0501043_0741202
804 Ga0501046_0001666
805 Ga0501046_0282015
806 Ga0501046_0326625
807 Ga0501046_0435904
808 Ga0501047_0217152
809 Ga0501048_0016248
810 Ga0501048_0087783
811 Ga0501048_0378335
812 Ga0501048_0656255
813 Ga0501067_0114739
814 Ga0501068_0001985
815 Ga0501068_0105234
816 Ga0501069_0188573
817 Ga0501069_0198192
818 Ga0501070_0368734
819 Ga0501071_0000316
820 Ga0501071_0001058
821 Ga0501071_0094334
822 Ga0501071_0117225
823 Ga0501071_0211907
824 Ga0501071_0323223
825 Ga0501071_1556349
826 Ga0501072_0002084
827 Ga0501072_0012332
828 Ga0501072_0024492
829 Ga0501072_0070379
830 Ga0501072_0795214
831 Ga0501072_1252138
832 Ga0501073_0073878
833 Ga0501073_0091090
834 Ga0501074_0003707
835 Ga0501074_0634440
836 Ga0501075_0001370
837 Ga0501075_0004660
838 Ga0501075_0051943
839 Ga0501075_0092314
840 Ga0501075_0237877
841 Ga0501075_0503853
842 Ga0501076_0045353
843 Ga0501076_0092041
844 Ga0501076_0104954
845 Ga0501076_0409298
846 Ga0501076_1185198
847 Ga0501077_0079442
848 Ga0501077_0147094
849 Ga0501199_048838
850 Ga0501216_053388
851 Ga0501235_193211
852 Ga0501229_062067
853 Ga0501079_0000468
854 Ga0501079_0176258
855 Ga0501079_0190573
856 Ga0501079_0269378
857 Ga0501080_0005463
858 Ga0501080_0101228
859 Ga0501080_0139442
860 Ga0501080_0359106
861 Ga0501081_0000151
862 Ga0501081_0005633
863 Ga0501081_0104537
864 Ga0501081_0135321
865 Ga0501081_0227631
866 Ga0501081_0309965
867 Ga0501083_0426675
868 Ga0501035_0018432
869 Ga0501044_0464256
870 Ga0501045_0000565
871 Ga0501045_0009186
872 Ga0501045_0020665
873 Ga0501045_0364054
874 Ga0501045_0368651
875 nmdc:mga05p37_1336318_c1
876 nmdc:mga05p37_1783424_c1
877 nmdc:mga05p37_2193696_c1
878 nmdc:mga05p37_410765_c1
879 nmdc:mga05p37_60086_c1
880 nmdc:mga09592_127267_c1
881 nmdc:mga09592_437614_c1
882 nmdc:mga0qj67_112911_c1
883 nmdc:mga0qj67_218673_c1
884 nmdc:mga0qj67_32641_c1
885 nmdc:mga0qj67_805059_c1
886 nmdc:mga06r32_100726_c1
887 nmdc:mga06r32_148366_c1
888 nmdc:mga06r32_234638_c1
889 nmdc:mga08y16_86681_c1
890 nmdc:mga0n895_2044168_c1
891 nmdc:mga0n895_2368_c1
892 nmdc:mga0n895_314493_c1
893 nmdc:mga0rr50_260195_c1
894 nmdc:mga0rr50_336026_c1
895 nmdc:mga0rr50_629200_c1
896 nmdc:mga0rr50_80156_c1
897 nmdc:mga08x19_169444_c1
898 nmdc:mga08x19_2872_c1
899 nmdc:mga0a205_336547_c1
900 nmdc:mga0a205_507312_c1
901 nmdc:mga0a205_84047_c1
902 Ga0495601_0099616
903 Ga0495619_0405067
904 Ga0495619_0476761
905 Ga0501084_0000587
906 Ga0501084_0174826
907 Ga0501084_0182442
908 Ga0501084_0251503
909 Ga0501084_0469418
910 Ga0590071_009503
911 Ga0590077_016581
912 Ga0501082_0002293
913 Ga0501082_0022612
914 Ga0501082_0167466
915 Ga0501082_0737024
916 Ga0501082_0793020
917 Ga0530510_0000977
918 Ga0530510_0025005
919 Ga0530510_0038496
920 Ga0530510_0099092
921 Ga0530510_0384965
922 Ga0530510_0454224

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

47

129

0.95

PF13279

4HBT_2

Thioesterase-like superfamily

39

156

0.93

PF20791

Acyl-ACP_TE_C

Acyl-ACP thioesterase C-terminal domain

28

70

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dio-assembly1.cif.gz_A-2 crystal structure of unnamed thioesterase lpg2867 from legionella pneumophila, the d21a mutant 0.951 9 134
3cjy-assembly1.cif.gz_A-2 crystal structure of putative thioesterase (yp_496845.1) from novosphingobium aromaticivorans dsm 12444 at 1.70 a resolution 0.9476 64 116
2egi-assembly2.cif.gz_I crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus 0.9404 13 115
5dio-assembly1.cif.gz_B-2 crystal structure of unnamed thioesterase lpg2867 from legionella pneumophila, the d21a mutant 0.9391 12 134
2egi-assembly1.cif.gz_H crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus 0.9352 14 119
ID Description Score Start End Superfamily
3cjyA00 Mainly Beta;Beta Barrel;Porin;Acyl-CoA thioesterase, double hotdog domain 0.9476 64 116 2.40.160.210
5dioB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9391 12 134 3.10.129.10
2egiH00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9352 14 119 3.10.129.10
5v10B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9338 14 137 3.10.129.10
af_Q2FV88_6_135_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9329 10 134 3.10.129.10
ID Description Score Start End GO Terms
AF-E4RSJ8-F1-model_v4 Thioesterase superfamily protein 0.9626 13 136 GO:0006633
GO:0047617
AF-A0A238VGU3-F1-model_v4 Acyl-CoA thioester hydrolase 0.962 14 137 GO:0006633
GO:0047617
AF-A0A4Q1IPD6-F1-model_v4 Acyl-CoA thioesterase 0.9608 14 137 GO:0006633
GO:0047617
AF-A0A1Z9WTZ5-F1-model_v4 Thioesterase domain-containing protein 0.9598 11 136 GO:0047617
AF-A0A537A3Y3-F1-model_v4 Acyl-CoA thioesterase 0.9572 9 137 GO:0047617

Map