F448691

General Info

Members Datasets Scaffolds Average Seq Length
461 198 922 424

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100100728|Ga0070697_1001007282
Length 450
Sequence MIQAFGQTLKSPGRPGLIPVFFEVQLMSLKSKFTLIVLSASLAVYTIAGAWLATRAQQPANDPGAQQKIFESVLQHIQNDYVDEPNMEKVRAGALRGLAYGLDPYSTYLTPEQVKDYRAGNKGEQLGIGAELSQVASFLYVVAPVKGAPADQAGVRAGDVIEYIDGKATRDISLYDARQLLNGAAGTEVKLRILRTNSRPLTLTVKRGSFRSPAAEARMDAGRVGILRINSLDSGEAVDAKSRLQELLKQGAQKIVLDLRSVAGGEIQEGAAVANFFIRDGIIAKTIGREQKVLKTFEADPKNVLFNGPVVALIDNGTAGAAEIIASAFLEQKRGDVVGEKSFGAGAEQELFTLRDGDGLLLTTVKWAAASGKPFLGEDRAHSGLAPSVEVKRPENGDSADVEDLSGNDDETKPNQSQPVAPRPQPEDTQLKKALELLRDKPAASAPRAA

Samples

Sample ID Description Type Environment
1 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
103 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
162 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
163 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
164 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
165 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
166 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
167 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
168 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
169 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
170 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
180 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
181 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
182 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
183 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
184 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
185 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
186 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
187 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
188 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
189 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
190 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
193 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
194 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
195 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
196 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
197 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
198 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.95
Rhizosphere 96.75
Stem 0
Stem Tuber 0
Unclassified 24.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070697_100100728 3300005536 Bacteria 2400
2 JGI24748J21848_1000003 3300002074 Bacteria 323921
3 JGI24034J26672_10000005 3300002239 Bacteria 404185
4 JGI24751J29686_10000163 3300002459 Bacteria 31505
5 JGI25406J46586_10006121 3300003203 Bacteria 5558
6 Ga0058861_11870344 3300004800 Unclassified 1751
7 Ga0058862_12292120 3300004803 Unclassified 1810
8 Ga0065714_10064444 3300005288 Bacteria 94227
9 Ga0065704_10080483 3300005289 Unclassified 3938
10 Ga0065704_10138849 3300005289 Unclassified 1539
11 Ga0065712_10067736 3300005290 Bacteria 94196
12 Ga0065712_10081038 3300005290 Bacteria 3044
13 Ga0065712_10114188 3300005290 Viruses 1771
14 Ga0065715_10013632 3300005293 Bacteria 2091
15 Ga0065715_10093680 3300005293 Unclassified 4599
16 Ga0065715_10099714 3300005293 Bacteria 3379
17 Ga0065715_10112369 3300005293 Viruses 2525
18 Ga0065715_10125752 3300005293 Unclassified 2123
19 Ga0065707_10006476 3300005295 Bacteria 3703
20 Ga0065707_10085840 3300005295 Bacteria 5859
21 Ga0065707_10091956 3300005295 Unclassified 3853
22 Ga0065707_10106707 3300005295 Bacteria 2585
23 Ga0065707_10120416 3300005295 Bacteria 2135
24 Ga0070683_100035428 3300005329 Unclassified 4562
25 Ga0070690_100000641 3300005330 Bacteria 17773
26 Ga0070690_100003833 3300005330 Archaea 8280
27 Ga0070670_100000142 3300005331 Bacteria 67444
28 Ga0070670_100000793 3300005331 Bacteria 24611
29 Ga0068869_100011765 3300005334 Bacteria 5754
30 Ga0068869_100063376 3300005334 Bacteria 2716
31 Ga0068869_100070883 3300005334 Bacteria 2579
32 Ga0068869_100075377 3300005334 Bacteria 2506
33 Ga0068869_100098054 3300005334 Bacteria 2214
34 Ga0070680_100000578 3300005336 Bacteria 25221
35 Ga0070680_100172429 3300005336 Bacteria 1821
36 Ga0070682_100023891 3300005337 Bacteria 3633
37 Ga0070682_100086669 3300005337 Unclassified 2040
38 Ga0068868_100035529 3300005338 Viruses 3853
39 Ga0068868_100080492 3300005338 Bacteria 2611
40 Ga0068868_100151978 3300005338 Viruses 1907
41 Ga0070689_100000482 3300005340 Bacteria 23530
42 Ga0070689_100014136 3300005340 Bacteria 5793
43 Ga0070687_100059509 3300005343 Unclassified 2012
44 Ga0070692_10030466 3300005345 Bacteria 2698
45 Ga0070668_100012707 3300005347 Bacteria 6267
46 Ga0070669_100015180 3300005353 Bacteria 5486
47 Ga0070669_100058960 3300005353 Bacteria 2818
48 Ga0070669_100141388 3300005353 Unclassified 1856
49 Ga0070675_100045982 3300005354 Viruses 3574
50 Ga0070671_100068313 3300005355 Unclassified 2964
51 Ga0070671_100075091 3300005355 Unclassified 2823
52 Ga0070673_100236357 3300005364 Bacteria 1587
53 Ga0070688_100057535 3300005365 Bacteria 2444
54 Ga0070703_10000145 3300005406 Bacteria 36771
55 Ga0070703_10004915 3300005406 Unclassified 3732
56 Ga0070701_10021627 3300005438 Bacteria 3073
57 Ga0070701_10066014 3300005438 Viruses 1922
58 Ga0070701_10114333 3300005438 Bacteria 1512
59 Ga0070705_100017183 3300005440 Bacteria 3772
60 Ga0070700_100072743 3300005441 Unclassified 2198
61 Ga0070700_100082761 3300005441 Bacteria 2076
62 Ga0070700_100096969 3300005441 Bacteria 1936
63 Ga0070694_100000939 3300005444 Bacteria 16478
64 Ga0070694_100047680 3300005444 Bacteria 2880
65 Ga0070694_100077505 3300005444 Unclassified 2303
66 Ga0070708_100000002 3300005445 Bacteria 195857
67 Ga0070708_100074692 3300005445 Unclassified 3058
68 Ga0070708_100080793 3300005445 Bacteria 2942
69 Ga0070708_100126150 3300005445 Bacteria 2366
70 Ga0070678_100174723 3300005456 Unclassified 1753
71 Ga0070662_100057364 3300005457 Bacteria 2830
72 Ga0070681_10000041 3300005458 Bacteria 89178
73 Ga0070681_10011651 3300005458 Archaea 8706
74 Ga0068867_100028829 3300005459 Unclassified 3997
75 Ga0068867_100048174 3300005459 Bacteria 3135
76 Ga0070706_100000002 3300005467 Bacteria 326510
77 Ga0070706_100003333 3300005467 Bacteria 15858
78 Ga0070706_100006226 3300005467 Bacteria 11284
79 Ga0070707_100001389 3300005468 Bacteria 23809
80 Ga0070707_100026482 3300005468 Bacteria 5506
81 Ga0070707_100121492 3300005468 Bacteria 2536
82 Ga0070707_100157424 3300005468 Unclassified 2213
83 Ga0070698_100000916 3300005471 Bacteria 32268
84 Ga0070698_100000948 3300005471 Bacteria 31720
85 Ga0070698_100002314 3300005471 Bacteria 21075
86 Ga0070698_100018448 3300005471 Archaea 7347
87 Ga0070698_100022603 3300005471 Bacteria 6576
88 Ga0070698_100057808 3300005471 Unclassified 3923
89 Ga0070698_100077841 3300005471 Unclassified 3315
90 Ga0070699_100000169 3300005518 Bacteria 63052
91 Ga0070699_100000980 3300005518 Bacteria 26618
92 Ga0070699_100016671 3300005518 Archaea 6306
93 Ga0070699_100032311 3300005518 Bacteria 4518
94 Ga0070699_100081515 3300005518 Unclassified 2820
95 Ga0070679_100000074 3300005530 Bacteria 74890
96 Ga0070697_100000845 3300005536 Bacteria 23024
97 Ga0070697_100002506 3300005536 Bacteria 14122
98 Ga0070697_100011505 3300005536 Bacteria 6917
99 Ga0070697_100024420 3300005536 Bacteria 4811
100 Ga0070697_100063245 3300005536 Bacteria 3022
101 Ga0070672_100011287 3300005543 Bacteria 6230
102 Ga0070686_100006671 3300005544 Bacteria 6427
103 Ga0070686_100038478 3300005544 Bacteria 2974
104 Ga0070686_100044906 3300005544 Unclassified 2781
105 Ga0070696_100051596 3300005546 Bacteria 2861
106 Ga0070696_100127673 3300005546 Bacteria 1847
107 Ga0070696_100186771 3300005546 Bacteria 1540
108 Ga0070693_100004745 3300005547 Bacteria 6468
109 Ga0070693_100006421 3300005547 Archaea 5699
110 Ga0070693_100019275 3300005547 Bacteria 3573
111 Ga0070693_100043300 3300005547 Bacteria 2542
112 Ga0070704_100010221 3300005549 Bacteria 5709
113 Ga0070704_100142410 3300005549 Unclassified 1874
114 Ga0070704_100160060 3300005549 Bacteria 1780
115 Ga0068857_100139411 3300005577 Bacteria 2192
116 Ga0068857_100156774 3300005577 Viruses 2065
117 Ga0068854_100122183 3300005578 Bacteria 1979
118 Ga0068856_100130468 3300005614 Archaea 2518
119 Ga0070702_100012419 3300005615 Bacteria 4267
120 Ga0068852_100139581 3300005616 Viruses 2241
121 Ga0068852_100151417 3300005616 Unclassified 2157
122 Ga0068852_100291041 3300005616 Bacteria 1578
123 Ga0068859_100006282 3300005617 Bacteria 12056
124 Ga0068859_100008269 3300005617 Bacteria 10550
125 Ga0068859_100013105 3300005617 Bacteria 8330
126 Ga0068859_100068828 3300005617 Bacteria 3574
127 Ga0068859_100069129 3300005617 Bacteria 3566
128 Ga0068859_100148148 3300005617 Unclassified 2422
129 Ga0068859_100171553 3300005617 Unclassified 2250
130 Ga0068859_100303533 3300005617 Unclassified 1690
131 Ga0068859_100323951 3300005617 Viruses 1635
132 Ga0068859_100347630 3300005617 Bacteria 1578
133 Ga0068864_100010185 3300005618 Bacteria 7761
134 Ga0068864_100021591 3300005618 Bacteria 5391
135 Ga0068864_100027354 3300005618 Archaea 4816
136 Ga0068864_100045859 3300005618 Unclassified 3750
137 Ga0068864_100123464 3300005618 Bacteria 2318
138 Ga0068864_100265905 3300005618 Unclassified 1596
139 Ga0068866_10016470 3300005718 Unclassified 3305
140 Ga0068861_100010788 3300005719 Archaea 6351
141 Ga0068861_100021710 3300005719 Unclassified 4616
142 Ga0068861_100034730 3300005719 Bacteria 3730
143 Ga0068861_100049120 3300005719 Bacteria 3193
144 Ga0068851_10000508 3300005834 Bacteria 17031
145 Ga0068863_100005423 3300005841 Bacteria 12562
146 Ga0068863_100159934 3300005841 Bacteria 2157
147 Ga0068863_100186995 3300005841 Unclassified 1990
148 Ga0068858_100000134 3300005842 Bacteria 77566
149 Ga0068858_100087042 3300005842 Unclassified 2905
150 Ga0068858_100224519 3300005842 Bacteria 1780
151 Ga0068860_100041359 3300005843 Bacteria 4403
152 Ga0068860_100065109 3300005843 Viruses 3462
153 Ga0068860_100080436 3300005843 Bacteria 3099
154 Ga0068860_100117813 3300005843 Bacteria 2541
155 Ga0068860_100139374 3300005843 Unclassified 2330
156 Ga0068860_100217252 3300005843 Bacteria 1856
157 Ga0068862_100009243 3300005844 Bacteria 8160
158 Ga0068862_100067227 3300005844 Bacteria 3089
159 Ga0068862_100087693 3300005844 Unclassified 2706
160 Ga0068862_100125171 3300005844 Bacteria 2269
161 Ga0081539_10000110 3300005985 Bacteria 190555
162 Ga0081539_10002562 3300005985 Bacteria 25196
163 Ga0081539_10004741 3300005985 Archaea 14708
164 Ga0070715_10000062 3300006163 Bacteria 36134
165 Ga0070716_100000012 3300006173 Bacteria 104713
166 Ga0070716_100106279 3300006173 Bacteria 1731
167 Ga0097621_100005483 3300006237 Archaea 8935
168 Ga0097621_100081067 3300006237 Viruses 2700
169 Ga0068871_100001575 3300006358 Archaea 15332
170 Ga0068871_100014452 3300006358 Viruses 5889
171 Ga0068871_100017101 3300006358 Bacteria 5480
172 Ga0075428_100017539 3300006844 Bacteria 7909
173 Ga0075428_100290287 3300006844 Bacteria 1759
174 Ga0075428_100290891 3300006844 Unclassified 1757
175 Ga0075430_100013075 3300006846 Archaea 7072
176 Ga0075433_10024569 3300006852 Bacteria 5088
177 Ga0075433_10039068 3300006852 Bacteria 4101
178 Ga0075433_10111265 3300006852 Bacteria 2429
179 Ga0075434_100034413 3300006871 Bacteria 5002
180 Ga0075434_100058904 3300006871 Bacteria 3818
181 Ga0075434_100083857 3300006871 Bacteria 3185
182 Ga0075434_100147119 3300006871 Bacteria 2376
183 Ga0075434_100250451 3300006871 Bacteria 1791
184 Ga0075429_100056999 3300006880 Bacteria 3401
185 Ga0068865_100019695 3300006881 Bacteria 4368
186 Ga0075436_100000008 3300006914 Bacteria 279288
187 Ga0097620_100006282 3300006931 Bacteria 12056
188 Ga0097620_100008269 3300006931 Bacteria 10550
189 Ga0097620_100013105 3300006931 Bacteria 8330
190 Ga0097620_100068826 3300006931 Bacteria 3574
191 Ga0097620_100069128 3300006931 Bacteria 3566
192 Ga0097620_100148156 3300006931 Unclassified 2422
193 Ga0097620_100171543 3300006931 Unclassified 2250
194 Ga0097620_100303539 3300006931 Unclassified 1690
195 Ga0097620_100323953 3300006931 Viruses 1635
196 Ga0097620_100347629 3300006931 Bacteria 1578
197 Ga0075435_100003331 3300007076 Bacteria 10900
198 Ga0075435_100085298 3300007076 Bacteria 2599
199 Ga0099794_10004418 3300007265 Bacteria 5522
200 Ga0105240_10038541 3300009093 Bacteria 6130
201 Ga0105240_10046640 3300009093 Bacteria 5490
202 Ga0111539_10029702 3300009094 Bacteria 6654
203 Ga0111539_10047532 3300009094 Bacteria 5128
204 Ga0111539_10061058 3300009094 Unclassified 4466
205 Ga0111539_10103051 3300009094 Unclassified 3349
206 Ga0111539_10162887 3300009094 Bacteria 2609
207 Ga0105247_10000022 3300009101 Bacteria 219796
208 Ga0105247_10003775 3300009101 Bacteria 9825
209 Ga0114129_10029985 3300009147 Bacteria 7702
210 Ga0114129_10049580 3300009147 Archaea 5898
211 Ga0114129_10062021 3300009147 Bacteria 5224
212 Ga0114129_10068916 3300009147 Bacteria 4931
213 Ga0114129_10095076 3300009147 Bacteria 4127
214 Ga0114129_10129074 3300009147 Bacteria 3474
215 Ga0105243_10001661 3300009148 Bacteria 19272
216 Ga0105243_10002315 3300009148 Bacteria 15951
217 Ga0105243_10004429 3300009148 Bacteria 11108
218 Ga0105243_10019275 3300009148 Archaea 5171
219 Ga0105242_10001403 3300009176 Bacteria 18963
220 Ga0105242_10003871 3300009176 Bacteria 11634
221 Ga0105242_10004145 3300009176 Bacteria 11283
222 Ga0105242_10004526 3300009176 Bacteria 10799
223 Ga0105248_10002562 3300009177 Bacteria 20234
224 Ga0105248_10055362 3300009177 Bacteria 4449
225 Ga0105248_10059048 3300009177 Bacteria 4308
226 Ga0105248_10077974 3300009177 Bacteria 3726
227 Ga0105248_10082305 3300009177 Bacteria 3619
228 Ga0105248_10099840 3300009177 Bacteria 3271
229 Ga0105248_10165995 3300009177 Unclassified 2489
230 Ga0105248_10225674 3300009177 Unclassified 2108
231 Ga0105237_10002331 3300009545 Bacteria 23574
232 Ga0105237_10028133 3300009545 Bacteria 5728
233 Ga0105237_10096848 3300009545 Unclassified 2941
234 Ga0105238_10014212 3300009551 Archaea 8050
235 Ga0105238_10027429 3300009551 Bacteria 5803
236 Ga0105238_10299855 3300009551 Unclassified 1590
237 Ga0105249_10000142 3300009553 Bacteria 92745
238 Ga0105249_10021878 3300009553 Bacteria 5727
239 Ga0105249_10046650 3300009553 Unclassified 3944
240 Ga0105249_10067303 3300009553 Bacteria 3300
241 Ga0105249_10086945 3300009553 Bacteria 2916
242 Ga0105249_10095503 3300009553 Unclassified 2787
243 Ga0105249_10226784 3300009553 Bacteria 1841
244 Ga0105239_10138598 3300010375 Archaea 2710
245 Ga0105239_10268426 3300010375 Bacteria 1919
246 Ga0105246_10059509 3300011119 Unclassified 2650
247 Ga0105246_10075671 3300011119 Bacteria 2384
248 Ga0105246_10169071 3300011119 Unclassified 1673
249 Ga0157373_10035892 3300013100 Bacteria 3558
250 Ga0157370_10102892 3300013104 Archaea 2674
251 Ga0157370_10157433 3300013104 Bacteria 2113
252 Ga0157369_10120799 3300013105 Archaea 2780
253 Ga0157374_10028352 3300013296 Bacteria 5059
254 Ga0157374_10150744 3300013296 Bacteria 2261
255 Ga0157378_10000051 3300013297 Bacteria 102008
256 Ga0157378_10002250 3300013297 Bacteria 17136
257 Ga0157378_10042407 3300013297 Bacteria 4039
258 Ga0157378_10052893 3300013297 Unclassified 3613
259 Ga0157378_10138557 3300013297 Bacteria 2258
260 Ga0163162_10000553 3300013306 Bacteria 34596
261 Ga0163162_10022683 3300013306 Bacteria 6189
262 Ga0163162_10046569 3300013306 Bacteria 4347
263 Ga0163162_10060827 3300013306 Unclassified 3813
264 Ga0163162_10066132 3300013306 Bacteria 3664
265 Ga0163162_10259619 3300013306 Viruses 1869
266 Ga0163162_10284047 3300013306 Unclassified 1787
267 Ga0157372_10009453 3300013307 Bacteria 10371
268 Ga0157375_10008487 3300013308 Archaea 8998
269 Ga0157375_10022551 3300013308 Bacteria 5796
270 Ga0157375_10036442 3300013308 Bacteria 4706
271 Ga0157375_10110444 3300013308 Unclassified 2847
272 Ga0157375_10184360 3300013308 Bacteria 2240
273 Ga0163163_10005092 3300014325 Bacteria 11327
274 Ga0163163_10007408 3300014325 Bacteria 9688
275 Ga0163163_10031782 3300014325 Bacteria 5097
276 Ga0163163_10052765 3300014325 Unclassified 4012
277 Ga0163163_10130532 3300014325 Bacteria 2552
278 Ga0157380_10008605 3300014326 Bacteria 7295
279 Ga0157380_10014764 3300014326 Bacteria 5719
280 Ga0157380_10023544 3300014326 Archaea 4647
281 Ga0157377_10056550 3300014745 Unclassified 2228
282 Ga0163161_10002085 3300017792 Bacteria 14490
283 Ga0163161_10013864 3300017792 Bacteria 5615
284 Ga0163161_10027426 3300017792 Bacteria 4040
285 Ga0163161_10149563 3300017792 Bacteria 1774
286 Ga0213876_10000043 3300021384 Bacteria 162257
287 Ga0213876_10000228 3300021384 Bacteria 55016
288 Ga0213876_10078181 3300021384 Unclassified 1748
289 Ga0207672_1000219 3300025223 Bacteria 8091
290 Ga0207656_10002553 3300025321 Archaea 6159
291 Ga0207653_10000008 3300025885 Bacteria 197323
292 Ga0207653_10003853 3300025885 Bacteria 4722
293 Ga0207710_10000001 3300025900 Bacteria 1797433
294 Ga0207710_10000741 3300025900 Archaea 18016
295 Ga0207680_10031105 3300025903 Unclassified 3020
296 Ga0207647_10004551 3300025904 Archaea 10277
297 Ga0207685_10000053 3300025905 Bacteria 37895
298 Ga0207643_10001142 3300025908 Archaea 15745
299 Ga0207684_10000076 3300025910 Bacteria 183107
300 Ga0207684_10004457 3300025910 Bacteria 13177
301 Ga0207684_10012260 3300025910 Bacteria 7463
302 Ga0207684_10015621 3300025910 Bacteria 6535
303 Ga0207684_10026441 3300025910 Unclassified 4947
304 Ga0207684_10198846 3300025910 Bacteria 1729
305 Ga0207707_10000077 3300025912 Bacteria 100255
306 Ga0207707_10002316 3300025912 Bacteria 17171
307 Ga0207707_10018210 3300025912 Archaea 6121
308 Ga0207660_10004374 3300025917 Bacteria 9212
309 Ga0207660_10147771 3300025917 Unclassified 1803
310 Ga0207662_10009066 3300025918 Bacteria 5464
311 Ga0207662_10031132 3300025918 Bacteria 3099
312 Ga0207662_10034909 3300025918 Unclassified 2936
313 Ga0207652_10000096 3300025921 Bacteria 96047
314 Ga0207646_10005556 3300025922 Bacteria 13240
315 Ga0207646_10011271 3300025922 Bacteria 8681
316 Ga0207646_10056486 3300025922 Unclassified 3508
317 Ga0207646_10095226 3300025922 Bacteria 2667
318 Ga0207646_10134023 3300025922 Unclassified 2231
319 Ga0207681_10003291 3300025923 Bacteria 10119
320 Ga0207694_10013538 3300025924 Archaea 6145
321 Ga0207650_10000046 3300025925 Bacteria 178190
322 Ga0207650_10004011 3300025925 Bacteria 10069
323 Ga0207650_10122016 3300025925 Unclassified 2030
324 Ga0207659_10094224 3300025926 Unclassified 2243
325 Ga0207687_10115110 3300025927 Unclassified 2003
326 Ga0207644_10022855 3300025931 Bacteria 4275
327 Ga0207644_10058984 3300025931 Unclassified 2775
328 Ga0207706_10177842 3300025933 Bacteria 1869
329 Ga0207686_10000060 3300025934 Bacteria 99241
330 Ga0207686_10002857 3300025934 Bacteria 9313
331 Ga0207686_10004062 3300025934 Bacteria 7855
332 Ga0207686_10010425 3300025934 Bacteria 5061
333 Ga0207709_10000108 3300025935 Bacteria 129013
334 Ga0207709_10107685 3300025935 Bacteria 1857
335 Ga0207665_10000083 3300025939 Bacteria 61629
336 Ga0207665_10020729 3300025939 Unclassified 4322
337 Ga0207691_10001740 3300025940 Bacteria 21468
338 Ga0207691_10017628 3300025940 Bacteria 6766
339 Ga0207691_10251471 3300025940 Unclassified 1526
340 Ga0207711_10028676 3300025941 Bacteria 4687
341 Ga0207711_10041818 3300025941 Bacteria 3903
342 Ga0207711_10120872 3300025941 Unclassified 2338
343 Ga0207689_10001656 3300025942 Archaea 21117
344 Ga0207689_10007298 3300025942 Bacteria 9703
345 Ga0207689_10131281 3300025942 Bacteria 2062
346 Ga0207689_10157503 3300025942 Bacteria 1872
347 Ga0207661_10138973 3300025944 Unclassified 2089
348 Ga0207679_10066972 3300025945 Unclassified 2693
349 Ga0207712_10000106 3300025961 Bacteria 94950
350 Ga0207712_10056794 3300025961 Bacteria 2759
351 Ga0207640_10019856 3300025981 Bacteria 3978
352 Ga0207677_10176800 3300026023 Viruses 1675
353 Ga0207703_10000024 3300026035 Bacteria 217968
354 Ga0207703_10078755 3300026035 Bacteria 2739
355 Ga0207703_10083333 3300026035 Bacteria 2671
356 Ga0207703_10210386 3300026035 Bacteria 1734
357 Ga0207703_10265633 3300026035 Bacteria 1553
358 Ga0207708_10084296 3300026075 Unclassified 2444
359 Ga0207708_10134202 3300026075 Bacteria 1937
360 Ga0207641_10157887 3300026088 Unclassified 2059
361 Ga0207648_10012395 3300026089 Archaea 7981
362 Ga0207676_10010092 3300026095 Bacteria 6719
363 Ga0207676_10249938 3300026095 Bacteria 1596
364 Ga0207674_10083771 3300026116 Unclassified 3188
365 Ga0207674_10087735 3300026116 Unclassified 3104
366 Ga0207674_10161555 3300026116 Unclassified 2194
367 Ga0207674_10169324 3300026116 Bacteria 2138
368 Ga0207674_10254108 3300026116 Unclassified 1704
369 Ga0207675_100002078 3300026118 Bacteria 19905
370 Ga0207675_100002918 3300026118 Bacteria 16820
371 Ga0207675_100004127 3300026118 Bacteria 14063
372 Ga0207675_100016859 3300026118 Archaea 6824
373 Ga0207675_100018312 3300026118 Bacteria 6531
374 Ga0207675_100073492 3300026118 Bacteria 3200
375 Ga0207698_10067101 3300026142 Unclassified 2828
376 Ga0207698_10260391 3300026142 Bacteria 1593
377 Ga0207698_10274219 3300026142 Bacteria 1556
378 Ga0207428_10022720 3300027907 Bacteria 5288
379 Ga0207428_10031241 3300027907 Bacteria 4398
380 Ga0268265_10019503 3300028380 Unclassified 4716
381 Ga0268265_10043078 3300028380 Bacteria 3353
382 Ga0268265_10061206 3300028380 Unclassified 2888
383 Ga0268264_10038349 3300028381 Bacteria 3954
384 Ga0268264_10050460 3300028381 Viruses 3464
385 Ga0268264_10077724 3300028381 Unclassified 2828
386 Ga0268264_10082480 3300028381 Bacteria 2751
387 Ga0268264_10144811 3300028381 Bacteria 2123
388 Ga0307408_100125387 3300031548 Unclassified 1996
389 Ga0307405_10115728 3300031731 Unclassified 1825
390 Ga0307410_10067808 3300031852 Bacteria 2462
391 Ga0307406_10014035 3300031901 Bacteria 4602
392 Ga0307412_10016743 3300031911 Unclassified 4374
393 Ga0307409_100205689 3300031995 Bacteria 1765
394 Ga0307416_100008466 3300032002 Bacteria 6642
395 Ga0307416_100061871 3300032002 Bacteria 3058
396 Ga0307416_100179619 3300032002 Bacteria 1982
397 Ga0307416_100250797 3300032002 Unclassified 1722
398 Ga0307411_10022104 3300032005 Unclassified 3738
399 Ga0307415_100034896 3300032126 Bacteria 3280
400 Ga0373951_0009289 3300035091 Bacteria 2215
401 Ga0373937_0075337 3300036401 Bacteria 3115
402 Ga0395900_0125424 3300037418 Unclassified 2633
403 Ga0395898_0179190 3300037466 Unclassified 2025
404 Ga0395905_0176602 3300037471 Archaea 2005
405 Ga0395901_0390763 3300038443 Unclassified 1430
406 Ga0242420_006871 3300038996 Bacteria 1813
407 Ga0436365_0013216 3300039437 Bacteria 44926
408 Ga0436365_0421852 3300039437 Bacteria 162876
409 Ga0436365_0442133 3300039437 Bacteria 7512
410 Ga0453683_0039420 3300044673 Bacteria 2969
411 Ga0495662_0096352 3300046476 Bacteria 1446
412 Ga0495663_0000713 3300046525 Bacteria 11429
413 Ga0495586_0083981 3300046535 Bacteria 1753
414 Ga0495586_0140003 3300046535 Unclassified 1358
415 Ga0495598_0040561 3300046537 Unclassified 1358
416 Ga0495621_0052422 3300046539 Bacteria 1462
417 Ga0495645_0047425 3300046543 Unclassified 3130
418 Ga0495668_0073071 3300046616 Bacteria 1884
419 Ga0496102_0368330 3300048905 Unclassified 1352
420 Ga0496103_0126783 3300048906 Unclassified 1628
421 Ga0496104_0323979 3300048907 Unclassified 1454
422 Ga0496106_0007575 3300048909 Bacteria 8031
423 Ga0496106_0029388 3300048909 Unclassified 4096
424 Ga0496108_0034512 3300048911 Bacteria 4204
425 Ga0496109_0126285 3300048912 Unclassified 2385
426 Ga0496110_0085042 3300048913 Unclassified 2824
427 Ga0496112_0176010 3300048915 Unclassified 2105
428 Ga0501291_000929 3300049514 Unclassified 3351
429 Ga0501296_003049 3300049519 Unclassified 1777
430 Ga0501298_003867 3300049521 Unclassified 2338
431 Ga0501299_002210 3300049522 Unclassified 2670
432 Ga0501202_006654 3300049652 Unclassified 2073
433 Ga0501223_004815 3300049663 Unclassified 2867
434 Ga0501249_014103 3300049679 Bacteria 1701
435 Ga0501079_0232870 3300049741 Unclassified 1439
436 nmdc:mga05p37_156451_c1 3300050507 Bacteria 2785
437 nmdc:mga05p37_204864_c1 3300050507 Bacteria 2387
438 nmdc:mga05p37_33571_c1 3300050507 Bacteria 6285
439 nmdc:mga05p37_83278_c1 3300050507 Bacteria 3940
440 nmdc:mga05p37_93180_c1 3300050507 Bacteria 3712
441 nmdc:mga09592_205749_c1 3300050508 Bacteria 1705
442 nmdc:mga09592_44471_c1 3300050508 Bacteria 3738
443 nmdc:mga09592_99032_c1 3300050508 Unclassified 2496
444 nmdc:mga0qj67_11222_c1 3300050509 Bacteria 6709
445 nmdc:mga06r32_47749_c1 3300050510 Bacteria 4090
446 nmdc:mga08y16_18467_c1 3300050511 Bacteria 7348
447 nmdc:mga08y16_9457_c1 3300050511 Bacteria 10227
448 nmdc:mga0n895_153277_c1 3300050512 Unclassified 2335
449 nmdc:mga0n895_230406_c1 3300050512 Bacteria 1880
450 nmdc:mga0n895_243235_c1 3300050512 Bacteria 1826
451 nmdc:mga0n895_272751_c1 3300050512 Bacteria 1716
452 nmdc:mga0n895_336001_c1 3300050512 Bacteria 1530
453 nmdc:mga0n895_82727_c1 3300050512 Bacteria 3200
454 nmdc:mga0rr50_4090_c1 3300050513 Bacteria 8516
455 nmdc:mga08x19_16_c1 3300050514 Bacteria 348119
456 nmdc:mga0a205_131657_c1 3300050515 Bacteria 2401
457 nmdc:mga0a205_58190_c1 3300050515 Bacteria 3733
458 nmdc:mga0a205_66628_c1 3300050515 Bacteria 3479
459 Ga0495601_0050743 3300053077 Bacteria 2617
460 Ga0501084_0150937 3300054114 Unclassified 1959
461 Ga0530510_0040256 3300061734 Unclassified 3373
462 Ga0070697_100100728
463 JGI24748J21848_1000003
464 JGI24034J26672_10000005
465 JGI24751J29686_10000163
466 JGI25406J46586_10006121
467 Ga0058861_11870344
468 Ga0058862_12292120
469 Ga0065714_10064444
470 Ga0065704_10080483
471 Ga0065704_10138849
472 Ga0065712_10067736
473 Ga0065712_10081038
474 Ga0065712_10114188
475 Ga0065715_10013632
476 Ga0065715_10093680
477 Ga0065715_10099714
478 Ga0065715_10112369
479 Ga0065715_10125752
480 Ga0065707_10006476
481 Ga0065707_10085840
482 Ga0065707_10091956
483 Ga0065707_10106707
484 Ga0065707_10120416
485 Ga0070683_100035428
486 Ga0070690_100000641
487 Ga0070690_100003833
488 Ga0070670_100000142
489 Ga0070670_100000793
490 Ga0068869_100011765
491 Ga0068869_100063376
492 Ga0068869_100070883
493 Ga0068869_100075377
494 Ga0068869_100098054
495 Ga0070680_100000578
496 Ga0070680_100172429
497 Ga0070682_100023891
498 Ga0070682_100086669
499 Ga0068868_100035529
500 Ga0068868_100080492
501 Ga0068868_100151978
502 Ga0070689_100000482
503 Ga0070689_100014136
504 Ga0070687_100059509
505 Ga0070692_10030466
506 Ga0070668_100012707
507 Ga0070669_100015180
508 Ga0070669_100058960
509 Ga0070669_100141388
510 Ga0070675_100045982
511 Ga0070671_100068313
512 Ga0070671_100075091
513 Ga0070673_100236357
514 Ga0070688_100057535
515 Ga0070703_10000145
516 Ga0070703_10004915
517 Ga0070701_10021627
518 Ga0070701_10066014
519 Ga0070701_10114333
520 Ga0070705_100017183
521 Ga0070700_100072743
522 Ga0070700_100082761
523 Ga0070700_100096969
524 Ga0070694_100000939
525 Ga0070694_100047680
526 Ga0070694_100077505
527 Ga0070708_100000002
528 Ga0070708_100074692
529 Ga0070708_100080793
530 Ga0070708_100126150
531 Ga0070678_100174723
532 Ga0070662_100057364
533 Ga0070681_10000041
534 Ga0070681_10011651
535 Ga0068867_100028829
536 Ga0068867_100048174
537 Ga0070706_100000002
538 Ga0070706_100003333
539 Ga0070706_100006226
540 Ga0070707_100001389
541 Ga0070707_100026482
542 Ga0070707_100121492
543 Ga0070707_100157424
544 Ga0070698_100000916
545 Ga0070698_100000948
546 Ga0070698_100002314
547 Ga0070698_100018448
548 Ga0070698_100022603
549 Ga0070698_100057808
550 Ga0070698_100077841
551 Ga0070699_100000169
552 Ga0070699_100000980
553 Ga0070699_100016671
554 Ga0070699_100032311
555 Ga0070699_100081515
556 Ga0070679_100000074
557 Ga0070697_100000845
558 Ga0070697_100002506
559 Ga0070697_100011505
560 Ga0070697_100024420
561 Ga0070697_100063245
562 Ga0070672_100011287
563 Ga0070686_100006671
564 Ga0070686_100038478
565 Ga0070686_100044906
566 Ga0070696_100051596
567 Ga0070696_100127673
568 Ga0070696_100186771
569 Ga0070693_100004745
570 Ga0070693_100006421
571 Ga0070693_100019275
572 Ga0070693_100043300
573 Ga0070704_100010221
574 Ga0070704_100142410
575 Ga0070704_100160060
576 Ga0068857_100139411
577 Ga0068857_100156774
578 Ga0068854_100122183
579 Ga0068856_100130468
580 Ga0070702_100012419
581 Ga0068852_100139581
582 Ga0068852_100151417
583 Ga0068852_100291041
584 Ga0068859_100006282
585 Ga0068859_100008269
586 Ga0068859_100013105
587 Ga0068859_100068828
588 Ga0068859_100069129
589 Ga0068859_100148148
590 Ga0068859_100171553
591 Ga0068859_100303533
592 Ga0068859_100323951
593 Ga0068859_100347630
594 Ga0068864_100010185
595 Ga0068864_100021591
596 Ga0068864_100027354
597 Ga0068864_100045859
598 Ga0068864_100123464
599 Ga0068864_100265905
600 Ga0068866_10016470
601 Ga0068861_100010788
602 Ga0068861_100021710
603 Ga0068861_100034730
604 Ga0068861_100049120
605 Ga0068851_10000508
606 Ga0068863_100005423
607 Ga0068863_100159934
608 Ga0068863_100186995
609 Ga0068858_100000134
610 Ga0068858_100087042
611 Ga0068858_100224519
612 Ga0068860_100041359
613 Ga0068860_100065109
614 Ga0068860_100080436
615 Ga0068860_100117813
616 Ga0068860_100139374
617 Ga0068860_100217252
618 Ga0068862_100009243
619 Ga0068862_100067227
620 Ga0068862_100087693
621 Ga0068862_100125171
622 Ga0081539_10000110
623 Ga0081539_10002562
624 Ga0081539_10004741
625 Ga0070715_10000062
626 Ga0070716_100000012
627 Ga0070716_100106279
628 Ga0097621_100005483
629 Ga0097621_100081067
630 Ga0068871_100001575
631 Ga0068871_100014452
632 Ga0068871_100017101
633 Ga0075428_100017539
634 Ga0075428_100290287
635 Ga0075428_100290891
636 Ga0075430_100013075
637 Ga0075433_10024569
638 Ga0075433_10039068
639 Ga0075433_10111265
640 Ga0075434_100034413
641 Ga0075434_100058904
642 Ga0075434_100083857
643 Ga0075434_100147119
644 Ga0075434_100250451
645 Ga0075429_100056999
646 Ga0068865_100019695
647 Ga0075436_100000008
648 Ga0097620_100006282
649 Ga0097620_100008269
650 Ga0097620_100013105
651 Ga0097620_100068826
652 Ga0097620_100069128
653 Ga0097620_100148156
654 Ga0097620_100171543
655 Ga0097620_100303539
656 Ga0097620_100323953
657 Ga0097620_100347629
658 Ga0075435_100003331
659 Ga0075435_100085298
660 Ga0099794_10004418
661 Ga0105240_10038541
662 Ga0105240_10046640
663 Ga0111539_10029702
664 Ga0111539_10047532
665 Ga0111539_10061058
666 Ga0111539_10103051
667 Ga0111539_10162887
668 Ga0105247_10000022
669 Ga0105247_10003775
670 Ga0114129_10029985
671 Ga0114129_10049580
672 Ga0114129_10062021
673 Ga0114129_10068916
674 Ga0114129_10095076
675 Ga0114129_10129074
676 Ga0105243_10001661
677 Ga0105243_10002315
678 Ga0105243_10004429
679 Ga0105243_10019275
680 Ga0105242_10001403
681 Ga0105242_10003871
682 Ga0105242_10004145
683 Ga0105242_10004526
684 Ga0105248_10002562
685 Ga0105248_10055362
686 Ga0105248_10059048
687 Ga0105248_10077974
688 Ga0105248_10082305
689 Ga0105248_10099840
690 Ga0105248_10165995
691 Ga0105248_10225674
692 Ga0105237_10002331
693 Ga0105237_10028133
694 Ga0105237_10096848
695 Ga0105238_10014212
696 Ga0105238_10027429
697 Ga0105238_10299855
698 Ga0105249_10000142
699 Ga0105249_10021878
700 Ga0105249_10046650
701 Ga0105249_10067303
702 Ga0105249_10086945
703 Ga0105249_10095503
704 Ga0105249_10226784
705 Ga0105239_10138598
706 Ga0105239_10268426
707 Ga0105246_10059509
708 Ga0105246_10075671
709 Ga0105246_10169071
710 Ga0157373_10035892
711 Ga0157370_10102892
712 Ga0157370_10157433
713 Ga0157369_10120799
714 Ga0157374_10028352
715 Ga0157374_10150744
716 Ga0157378_10000051
717 Ga0157378_10002250
718 Ga0157378_10042407
719 Ga0157378_10052893
720 Ga0157378_10138557
721 Ga0163162_10000553
722 Ga0163162_10022683
723 Ga0163162_10046569
724 Ga0163162_10060827
725 Ga0163162_10066132
726 Ga0163162_10259619
727 Ga0163162_10284047
728 Ga0157372_10009453
729 Ga0157375_10008487
730 Ga0157375_10022551
731 Ga0157375_10036442
732 Ga0157375_10110444
733 Ga0157375_10184360
734 Ga0163163_10005092
735 Ga0163163_10007408
736 Ga0163163_10031782
737 Ga0163163_10052765
738 Ga0163163_10130532
739 Ga0157380_10008605
740 Ga0157380_10014764
741 Ga0157380_10023544
742 Ga0157377_10056550
743 Ga0163161_10002085
744 Ga0163161_10013864
745 Ga0163161_10027426
746 Ga0163161_10149563
747 Ga0213876_10000043
748 Ga0213876_10000228
749 Ga0213876_10078181
750 Ga0207672_1000219
751 Ga0207656_10002553
752 Ga0207653_10000008
753 Ga0207653_10003853
754 Ga0207710_10000001
755 Ga0207710_10000741
756 Ga0207680_10031105
757 Ga0207647_10004551
758 Ga0207685_10000053
759 Ga0207643_10001142
760 Ga0207684_10000076
761 Ga0207684_10004457
762 Ga0207684_10012260
763 Ga0207684_10015621
764 Ga0207684_10026441
765 Ga0207684_10198846
766 Ga0207707_10000077
767 Ga0207707_10002316
768 Ga0207707_10018210
769 Ga0207660_10004374
770 Ga0207660_10147771
771 Ga0207662_10009066
772 Ga0207662_10031132
773 Ga0207662_10034909
774 Ga0207652_10000096
775 Ga0207646_10005556
776 Ga0207646_10011271
777 Ga0207646_10056486
778 Ga0207646_10095226
779 Ga0207646_10134023
780 Ga0207681_10003291
781 Ga0207694_10013538
782 Ga0207650_10000046
783 Ga0207650_10004011
784 Ga0207650_10122016
785 Ga0207659_10094224
786 Ga0207687_10115110
787 Ga0207644_10022855
788 Ga0207644_10058984
789 Ga0207706_10177842
790 Ga0207686_10000060
791 Ga0207686_10002857
792 Ga0207686_10004062
793 Ga0207686_10010425
794 Ga0207709_10000108
795 Ga0207709_10107685
796 Ga0207665_10000083
797 Ga0207665_10020729
798 Ga0207691_10001740
799 Ga0207691_10017628
800 Ga0207691_10251471
801 Ga0207711_10028676
802 Ga0207711_10041818
803 Ga0207711_10120872
804 Ga0207689_10001656
805 Ga0207689_10007298
806 Ga0207689_10131281
807 Ga0207689_10157503
808 Ga0207661_10138973
809 Ga0207679_10066972
810 Ga0207712_10000106
811 Ga0207712_10056794
812 Ga0207640_10019856
813 Ga0207677_10176800
814 Ga0207703_10000024
815 Ga0207703_10078755
816 Ga0207703_10083333
817 Ga0207703_10210386
818 Ga0207703_10265633
819 Ga0207708_10084296
820 Ga0207708_10134202
821 Ga0207641_10157887
822 Ga0207648_10012395
823 Ga0207676_10010092
824 Ga0207676_10249938
825 Ga0207674_10083771
826 Ga0207674_10087735
827 Ga0207674_10161555
828 Ga0207674_10169324
829 Ga0207674_10254108
830 Ga0207675_100002078
831 Ga0207675_100002918
832 Ga0207675_100004127
833 Ga0207675_100016859
834 Ga0207675_100018312
835 Ga0207675_100073492
836 Ga0207698_10067101
837 Ga0207698_10260391
838 Ga0207698_10274219
839 Ga0207428_10022720
840 Ga0207428_10031241
841 Ga0268265_10019503
842 Ga0268265_10043078
843 Ga0268265_10061206
844 Ga0268264_10038349
845 Ga0268264_10050460
846 Ga0268264_10077724
847 Ga0268264_10082480
848 Ga0268264_10144811
849 Ga0307408_100125387
850 Ga0307405_10115728
851 Ga0307410_10067808
852 Ga0307406_10014035
853 Ga0307412_10016743
854 Ga0307409_100205689
855 Ga0307416_100008466
856 Ga0307416_100061871
857 Ga0307416_100179619
858 Ga0307416_100250797
859 Ga0307411_10022104
860 Ga0307415_100034896
861 Ga0373951_0009289
862 Ga0373937_0075337
863 Ga0395900_0125424
864 Ga0395898_0179190
865 Ga0395905_0176602
866 Ga0395901_0390763
867 Ga0242420_006871
868 Ga0436365_0013216
869 Ga0436365_0421852
870 Ga0436365_0442133
871 Ga0453683_0039420
872 Ga0495662_0096352
873 Ga0495663_0000713
874 Ga0495586_0083981
875 Ga0495586_0140003
876 Ga0495598_0040561
877 Ga0495621_0052422
878 Ga0495645_0047425
879 Ga0495668_0073071
880 Ga0496102_0368330
881 Ga0496103_0126783
882 Ga0496104_0323979
883 Ga0496106_0007575
884 Ga0496106_0029388
885 Ga0496108_0034512
886 Ga0496109_0126285
887 Ga0496110_0085042
888 Ga0496112_0176010
889 Ga0501291_000929
890 Ga0501296_003049
891 Ga0501298_003867
892 Ga0501299_002210
893 Ga0501202_006654
894 Ga0501223_004815
895 Ga0501249_014103
896 Ga0501079_0232870
897 nmdc:mga05p37_156451_c1
898 nmdc:mga05p37_204864_c1
899 nmdc:mga05p37_33571_c1
900 nmdc:mga05p37_83278_c1
901 nmdc:mga05p37_93180_c1
902 nmdc:mga09592_205749_c1
903 nmdc:mga09592_44471_c1
904 nmdc:mga09592_99032_c1
905 nmdc:mga0qj67_11222_c1
906 nmdc:mga06r32_47749_c1
907 nmdc:mga08y16_18467_c1
908 nmdc:mga08y16_9457_c1
909 nmdc:mga0n895_153277_c1
910 nmdc:mga0n895_230406_c1
911 nmdc:mga0n895_243235_c1
912 nmdc:mga0n895_272751_c1
913 nmdc:mga0n895_336001_c1
914 nmdc:mga0n895_82727_c1
915 nmdc:mga0rr50_4090_c1
916 nmdc:mga08x19_16_c1
917 nmdc:mga0a205_131657_c1
918 nmdc:mga0a205_58190_c1
919 nmdc:mga0a205_66628_c1
920 Ga0495601_0050743
921 Ga0501084_0150937
922 Ga0530510_0040256

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17820

PDZ_6

PDZ domain

140

195

0.95

PF03572

Peptidase_S41

Peptidase family S41

223

391

0.93

PF13180

PDZ_2

PDZ domain

126

206

0.88

PF00595

PDZ

PDZ domain

113

194

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4c2h-assembly1.cif.gz_B crystal structure of the ctpb(v118y) mutant 0.8264 32 368
7rpq-assembly1.cif.gz_A crystal structure of carboxyl-terminal processing protease a, ctpa, of pseudomonas aeruginosa 0.8259 37 396
7rqh-assembly1.cif.gz_A crystal structure of carboxyl-terminal processing protease a mutant s302a, ctpa_s302a, of pseudomonas aeruginosa 0.8259 37 396
4c2e-assembly1.cif.gz_B crystal structure of the protease ctpb(s309a) present in a resting state 0.8256 32 368
7rpq-assembly1.cif.gz_B-4 crystal structure of carboxyl-terminal processing protease a, ctpa, of pseudomonas aeruginosa 0.8097 37 396
ID Description Score Start End Superfamily
af_O23614_210_301_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.8946 101 186 2.30.42.10
1fc6A02 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.8938 101 185 2.30.42.10
af_Q5ZA08_147_239_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.8905 101 184 2.30.42.10
af_I1NHY3_318_500_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8634 187 365 3.90.226.10
af_F4KHG6_292_467_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8463 189 362 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A7V1QB00-F1-model_v4 PDZ domain-containing protein 0.9203 106 398 GO:0004175
GO:0006508
GO:0007165
GO:0008236
GO:0030288
AF-A0A2V8QFA2-F1-model_v4 Tail specific protease domain-containing protein 0.9145 202 403 GO:0004175
GO:0006508
GO:0007165
GO:0008236
GO:0030288
AF-A0A2H0DLI1-F1-model_v4 PDZ domain-containing protein 0.884 94 182
AF-A0A7V1QB00-F1-model_v4 PDZ domain-containing protein 0.8763 106 398 GO:0004175
GO:0006508
GO:0007165
GO:0008236
GO:0030288
AF-A0A7C5H8Q7-F1-model_v4 Peptidase S41 0.8748 211 369 GO:0004175
GO:0006508
GO:0007165
GO:0008236
GO:0030288

Map