F448592

General Info

Members Datasets Scaffolds Average Seq Length
460 270 454 129

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0018161|Ga0466969_0018161_2075_2473
Length 132
Sequence MALRVVRLGTERQRDEGTRIGTVRRPPRGVPKSEFASQNWYDVWFPNLAPSLDLTKFALQSKGDAAQWKVFVRKYKAEMAQPDASHAIELLATLSQHADFSVGCYCEDEAWCHRSVLRELLADRGAKLAEHR

Samples

Sample ID Description Type Environment
1 2643221559 Lysobacter sp. Root559 Isolate Unclassified
2 2643221586 Lysobacter sp. Root667 Isolate Unclassified
3 2643221612 Lysobacter sp. Root76 Isolate Unclassified
4 2643221727 Lysobacter sp. Root96 Isolate Unclassified
5 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
67 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
138 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
141 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
142 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
143 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
144 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
152 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
153 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
154 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
155 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
156 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
157 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
158 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
159 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
160 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
167 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
168 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
169 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
170 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
171 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
172 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
173 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
174 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
175 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
176 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
177 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
178 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
182 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
183 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
184 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
185 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
186 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
187 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
188 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
189 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
190 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
191 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
192 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
193 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
194 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
195 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
196 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
197 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
198 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
199 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
200 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
201 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
202 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
203 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
204 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
205 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
206 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
207 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
208 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
209 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
210 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
211 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
223 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
224 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
225 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
226 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
233 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
234 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
235 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
236 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
237 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
238 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
239 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
240 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
241 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
242 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
243 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
244 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
245 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
246 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
247 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
248 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
249 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
250 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
251 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
252 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
253 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
254 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
255 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
256 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
257 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
258 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
259 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
260 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
261 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
262 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
263 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
264 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
265 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
266 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
267 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
268 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
269 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
270 642555112 Paraburkholderia phymatum STM815 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.7
Metatranscriptomes 0
Isolates 1.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.04
Nodule 0.65
Rhizoplane 2.61
Rhizosphere 85.43
Stem 0
Stem Tuber 0
Unclassified 3.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10170785 3300003323 Bacteria 6105
2 Ga0065715_10129151 3300005293 Bacteria 2051
3 Ga0070676_10207221 3300005328 Bacteria 1288
4 Ga0070677_10004666 3300005333 Bacteria 4484
5 Ga0068869_100061399 3300005334 Unclassified 2757
6 Ga0068869_100072884 3300005334 Bacteria 2545
7 Ga0068869_100296523 3300005334 Bacteria 1304
8 Ga0068869_100380109 3300005334 Bacteria 1157
9 Ga0070666_10004385 3300005335 Bacteria 8596
10 Ga0070666_10013781 3300005335 Bacteria 5135
11 Ga0070666_10785047 3300005335 Bacteria 701
12 Ga0070680_100375561 3300005336 Bacteria 1210
13 Ga0068868_100004933 3300005338 Bacteria 9373
14 Ga0068868_100008290 3300005338 Bacteria 7442
15 Ga0068868_100011587 3300005338 Bacteria 6422
16 Ga0070689_100027465 3300005340 Bacteria 4291
17 Ga0070689_100140067 3300005340 Bacteria 1945
18 Ga0070689_100553996 3300005340 Bacteria 991
19 Ga0070668_100003653 3300005347 Bacteria 11348
20 Ga0070668_100025295 3300005347 Bacteria 4500
21 Ga0070669_100187494 3300005353 Bacteria 1621
22 Ga0070669_100298271 3300005353 Bacteria 1295
23 Ga0070675_100008171 3300005354 Bacteria 8111
24 Ga0070675_100008971 3300005354 Bacteria 7768
25 Ga0070671_100002283 3300005355 Bacteria 14795
26 Ga0070674_100001737 3300005356 Bacteria 11801
27 Ga0070674_100042754 3300005356 Bacteria 3080
28 Ga0070673_100000414 3300005364 Bacteria 22528
29 Ga0070673_100024254 3300005364 Bacteria 4445
30 Ga0070673_100052622 3300005364 Bacteria 3196
31 Ga0070673_100075977 3300005364 Bacteria 2711
32 Ga0070688_100007290 3300005365 Bacteria 5957
33 Ga0070688_100734963 3300005365 Bacteria 767
34 Ga0070659_101417061 3300005366 Unclassified 618
35 Ga0070667_100004577 3300005367 Bacteria 11619
36 Ga0070667_100112213 3300005367 Bacteria 2365
37 Ga0070667_100268791 3300005367 Bacteria 1528
38 Ga0070667_101020152 3300005367 Bacteria 772
39 Ga0070700_100473709 3300005441 Bacteria 958
40 Ga0070700_100706468 3300005441 Bacteria 802
41 Ga0070708_100355629 3300005445 Bacteria 1380
42 Ga0070663_100040669 3300005455 Bacteria 3257
43 Ga0070678_100034195 3300005456 Bacteria 3538
44 Ga0070678_100039661 3300005456 Bacteria 3325
45 Ga0070678_100326234 3300005456 Bacteria 1312
46 Ga0070662_100048909 3300005457 Bacteria 3048
47 Ga0068867_100004322 3300005459 Bacteria 10002
48 Ga0068867_100005598 3300005459 Bacteria 8900
49 Ga0070685_10077459 3300005466 Bacteria 1985
50 Ga0070685_10316219 3300005466 Bacteria 1057
51 Ga0068853_100005722 3300005539 Bacteria 9783
52 Ga0068853_100393387 3300005539 Bacteria 1296
53 Ga0068853_101317664 3300005539 Bacteria 698
54 Ga0070672_100009932 3300005543 Bacteria 6582
55 Ga0070672_100218937 3300005543 Bacteria 1596
56 Ga0070695_100290450 3300005545 Bacteria 1205
57 Ga0070696_100309538 3300005546 Bacteria 1212
58 Ga0070665_100042494 3300005548 Bacteria 4569
59 Ga0070665_100060912 3300005548 Bacteria 3783
60 Ga0070665_100124742 3300005548 Bacteria 2577
61 Ga0070665_100341078 3300005548 Unclassified 1503
62 Ga0070704_100768538 3300005549 Unclassified 859
63 Ga0070704_100898897 3300005549 Bacteria 796
64 Ga0068857_100425098 3300005577 Bacteria 1239
65 Ga0070702_101155614 3300005615 Bacteria 621
66 Ga0068852_100156332 3300005616 Bacteria 2124
67 Ga0068859_100025433 3300005617 Bacteria 5938
68 Ga0068859_100648383 3300005617 Bacteria 1148
69 Ga0068859_101042424 3300005617 Bacteria 899
70 Ga0068864_100000046 3300005618 Bacteria 151661
71 Ga0068864_100003522 3300005618 Bacteria 12945
72 Ga0068864_100004730 3300005618 Bacteria 11150
73 Ga0068864_100143009 3300005618 Unclassified 2160
74 Ga0068861_100020784 3300005719 Bacteria 4708
75 Ga0068861_100031275 3300005719 Bacteria 3909
76 Ga0068861_100090966 3300005719 Bacteria 2408
77 Ga0068861_100152102 3300005719 Bacteria 1900
78 Ga0068861_100352945 3300005719 Unclassified 1291
79 Ga0068861_101272997 3300005719 Unclassified 714
80 Ga0068851_10000963 3300005834 Bacteria 12458
81 Ga0068870_10029085 3300005840 Bacteria 2781
82 Ga0068870_10224121 3300005840 Bacteria 1152
83 Ga0068870_10337103 3300005840 Bacteria 963
84 Ga0068863_100003538 3300005841 Bacteria 15417
85 Ga0068863_100014047 3300005841 Bacteria 7716
86 Ga0068863_101538988 3300005841 Bacteria 674
87 Ga0068863_101577344 3300005841 Bacteria 665
88 Ga0068858_100056047 3300005842 Bacteria 3643
89 Ga0068858_100057670 3300005842 Bacteria 3589
90 Ga0068858_100649057 3300005842 Bacteria 1025
91 Ga0068860_100002164 3300005843 Bacteria 20700
92 Ga0068860_100515606 3300005843 Bacteria 1195
93 Ga0068860_102570797 3300005843 Bacteria 528
94 Ga0068862_100380708 3300005844 Bacteria 1316
95 Ga0075368_10327983 3300006042 Bacteria 664
96 Ga0075363_100011486 3300006048 Bacteria 4242
97 Ga0075364_10322441 3300006051 Unclassified 1052
98 Ga0075362_10020687 3300006177 Bacteria 2752
99 Ga0075367_10003340 3300006178 Bacteria 7625
100 Ga0075367_10593146 3300006178 Bacteria 704
101 Ga0075369_10013614 3300006186 Bacteria 3234
102 Ga0075369_10068668 3300006186 Unclassified 1558
103 Ga0075427_10041461 3300006194 Bacteria 777
104 Ga0075366_10072882 3300006195 Bacteria 2047
105 Ga0075366_10101992 3300006195 Bacteria 1722
106 Ga0075366_10127633 3300006195 Bacteria 1534
107 Ga0075366_10246569 3300006195 Bacteria 1089
108 Ga0075366_10843438 3300006195 Bacteria 570
109 Ga0075366_11074172 3300006195 Bacteria 503
110 Ga0097621_100071436 3300006237 Bacteria 2868
111 Ga0097621_100258906 3300006237 Bacteria 1526
112 Ga0097621_100269370 3300006237 Unclassified 1496
113 Ga0097621_101868698 3300006237 Unclassified 573
114 Ga0075370_10002789 3300006353 Bacteria 8190
115 Ga0075370_10027526 3300006353 Bacteria 3155
116 Ga0075370_10039911 3300006353 Bacteria 2646
117 Ga0075370_10074024 3300006353 Bacteria 1952
118 Ga0075370_10892543 3300006353 Bacteria 543
119 Ga0068871_100110972 3300006358 Bacteria 2307
120 Ga0068871_100117282 3300006358 Bacteria 2245
121 Ga0068871_100300819 3300006358 Bacteria 1408
122 Ga0068871_100565308 3300006358 Bacteria 1031
123 Ga0075428_100000133 3300006844 Bacteria 65398
124 Ga0075428_100051798 3300006844 Bacteria 4501
125 Ga0075428_100114848 3300006844 Bacteria 2933
126 Ga0075428_100965143 3300006844 Bacteria 903
127 Ga0075430_100141658 3300006846 Bacteria 2002
128 Ga0075430_101425893 3300006846 Bacteria 569
129 Ga0075431_100244486 3300006847 Bacteria 1824
130 Ga0075429_101054404 3300006880 Bacteria 710
131 Ga0068865_100101685 3300006881 Bacteria 2105
132 Ga0068865_100131619 3300006881 Bacteria 1875
133 Ga0068865_101085519 3300006881 Bacteria 704
134 Ga0097620_100025432 3300006931 Bacteria 5938
135 Ga0097620_100155782 3300006931 Bacteria 2362
136 Ga0097620_100648525 3300006931 Bacteria 1148
137 Ga0097620_101042312 3300006931 Bacteria 899
138 Ga0099826_10457401 3300006948 Bacteria 606
139 Ga0105251_10158598 3300009011 Bacteria 1020
140 Ga0105240_10130469 3300009093 Bacteria 3015
141 Ga0105240_12173381 3300009093 Bacteria 576
142 Ga0111539_10000654 3300009094 Bacteria 44760
143 Ga0111539_10322958 3300009094 Unclassified 1796
144 Ga0105245_10247432 3300009098 Bacteria 1731
145 Ga0105245_10339284 3300009098 Bacteria 1485
146 Ga0105245_11082615 3300009098 Bacteria 847
147 Ga0105247_10021490 3300009101 Bacteria 3884
148 Ga0114129_11061071 3300009147 Bacteria 1017
149 Ga0105243_10024169 3300009148 Bacteria 4634
150 Ga0105243_10478819 3300009148 Bacteria 1174
151 Ga0105248_10003651 3300009177 Bacteria 17086
152 Ga0105248_10019374 3300009177 Bacteria 7530
153 Ga0105248_10078334 3300009177 Bacteria 3715
154 Ga0105248_10555988 3300009177 Bacteria 1295
155 Ga0105237_10057642 3300009545 Bacteria 3887
156 Ga0105249_10047847 3300009553 Bacteria 3898
157 Ga0105239_10040126 3300010375 Bacteria 5129
158 Ga0105239_11167124 3300010375 Bacteria 887
159 Ga0157374_10015238 3300013296 Bacteria 6742
160 Ga0157374_10034007 3300013296 Bacteria 4654
161 Ga0157378_10024746 3300013297 Bacteria 5286
162 Ga0157378_10072118 3300013297 Bacteria 3103
163 Ga0157378_10519654 3300013297 Bacteria 1192
164 Ga0163162_10060010 3300013306 Bacteria 3837
165 Ga0163162_10068114 3300013306 Bacteria 3610
166 Ga0157375_10000991 3300013308 Bacteria 24533
167 Ga0157375_10382621 3300013308 Bacteria 1574
168 Ga0157375_10501963 3300013308 Bacteria 1377
169 Ga0163163_10029012 3300014325 Bacteria 5320
170 Ga0163163_10479608 3300014325 Unclassified 1305
171 Ga0157380_10036291 3300014326 Bacteria 3813
172 Ga0157380_10177359 3300014326 Bacteria 1869
173 Ga0157380_10271386 3300014326 Bacteria 1547
174 Ga0157380_10308298 3300014326 Bacteria 1462
175 Ga0157380_10665009 3300014326 Bacteria 1041
176 Ga0157380_11052233 3300014326 Bacteria 850
177 Ga0157377_10555550 3300014745 Bacteria 812
178 Ga0157379_10004507 3300014968 Bacteria 11946
179 Ga0157376_10050766 3300014969 Bacteria 3443
180 Ga0183360_10001 3300015689 Bacteria 3943671
181 Ga0163161_10087328 3300017792 Bacteria 2303
182 Ga0163161_10224674 3300017792 Bacteria 1455
183 Ga0209565_1002300 3300025263 Bacteria 7018
184 Ga0207697_10006798 3300025315 Bacteria 5144
185 Ga0207697_10030017 3300025315 Bacteria 2225
186 Ga0207656_10002949 3300025321 Bacteria 5803
187 Ga0207682_10001173 3300025893 Bacteria 12153
188 Ga0207682_10025400 3300025893 Bacteria 2349
189 Ga0207710_10010257 3300025900 Bacteria 3942
190 Ga0207680_10002438 3300025903 Bacteria 8673
191 Ga0207645_10001033 3300025907 Bacteria 22978
192 Ga0207645_10091588 3300025907 Bacteria 1955
193 Ga0207645_10094272 3300025907 Bacteria 1926
194 Ga0207643_10081182 3300025908 Unclassified 1879
195 Ga0207643_10213078 3300025908 Bacteria 1180
196 Ga0207654_10661615 3300025911 Bacteria 749
197 Ga0207695_10167703 3300025913 Bacteria 2123
198 Ga0207671_10018695 3300025914 Bacteria 5310
199 Ga0207660_10866612 3300025917 Bacteria 737
200 Ga0207662_10556988 3300025918 Bacteria 794
201 Ga0207681_10173270 3300025923 Bacteria 1637
202 Ga0207681_10246218 3300025923 Bacteria 1394
203 Ga0207681_10329552 3300025923 Bacteria 1217
204 Ga0207694_10775699 3300025924 Bacteria 809
205 Ga0207650_10174178 3300025925 Bacteria 1712
206 Ga0207650_11483572 3300025925 Unclassified 576
207 Ga0207659_10003127 3300025926 Bacteria 9890
208 Ga0207659_10167779 3300025926 Bacteria 1729
209 Ga0207687_10189273 3300025927 Bacteria 1600
210 Ga0207687_10401813 3300025927 Unclassified 1127
211 Ga0207700_10389005 3300025928 Unclassified 1221
212 Ga0207644_10008533 3300025931 Bacteria 6704
213 Ga0207690_11129996 3300025932 Unclassified 653
214 Ga0207706_10140717 3300025933 Bacteria 2123
215 Ga0207670_10458748 3300025936 Bacteria 1028
216 Ga0207670_10573266 3300025936 Bacteria 924
217 Ga0207669_10001098 3300025937 Bacteria 11563
218 Ga0207669_10017530 3300025937 Bacteria 3676
219 Ga0207704_10001647 3300025938 Bacteria 10023
220 Ga0207704_10016422 3300025938 Bacteria 3804
221 Ga0207691_10000006 3300025940 Bacteria 161922
222 Ga0207691_10001055 3300025940 Bacteria 27382
223 Ga0207691_10002769 3300025940 Bacteria 17084
224 Ga0207691_10230191 3300025940 Bacteria 1605
225 Ga0207711_10171912 3300025941 Bacteria 1966
226 Ga0207711_10176985 3300025941 Bacteria 1938
227 Ga0207711_10306614 3300025941 Bacteria 1465
228 Ga0207711_10353491 3300025941 Bacteria 1361
229 Ga0207689_10001598 3300025942 Bacteria 21447
230 Ga0207689_10055677 3300025942 Bacteria 3255
231 Ga0207689_10247606 3300025942 Bacteria 1474
232 Ga0207689_10294111 3300025942 Bacteria 1345
233 Ga0207689_10383675 3300025942 Bacteria 1170
234 Ga0207689_10910751 3300025942 Bacteria 742
235 Ga0207689_11770871 3300025942 Bacteria 510
236 Ga0207651_10074667 3300025960 Bacteria 2415
237 Ga0207651_10093255 3300025960 Bacteria 2210
238 Ga0207651_10137611 3300025960 Bacteria 1881
239 Ga0207668_10005508 3300025972 Bacteria 7463
240 Ga0207640_10203493 3300025981 Bacteria 1502
241 Ga0207640_10328064 3300025981 Bacteria 1221
242 Ga0207658_10046027 3300025986 Bacteria 3183
243 Ga0207658_10263501 3300025986 Bacteria 1470
244 Ga0207658_10411556 3300025986 Bacteria 1190
245 Ga0207677_10000069 3300026023 Bacteria 85177
246 Ga0207677_10023297 3300026023 Bacteria 3822
247 Ga0207703_10012059 3300026035 Bacteria 6734
248 Ga0207703_10364321 3300026035 Bacteria 1334
249 Ga0207703_10402062 3300026035 Bacteria 1271
250 Ga0207703_10531454 3300026035 Bacteria 1107
251 Ga0207639_10005406 3300026041 Bacteria 8640
252 Ga0207639_10143158 3300026041 Bacteria 1994
253 Ga0207639_10343845 3300026041 Bacteria 1331
254 Ga0207708_10069939 3300026075 Bacteria 2688
255 Ga0207641_10001705 3300026088 Bacteria 21390
256 Ga0207641_10024731 3300026088 Bacteria 4951
257 Ga0207641_10800363 3300026088 Bacteria 932
258 Ga0207641_11242138 3300026088 Bacteria 745
259 Ga0207648_10003315 3300026089 Bacteria 16908
260 Ga0207648_10121092 3300026089 Bacteria 2301
261 Ga0207648_10125362 3300026089 Bacteria 2259
262 Ga0207676_10000008 3300026095 Bacteria 588913
263 Ga0207676_10002144 3300026095 Bacteria 14263
264 Ga0207676_10021291 3300026095 Bacteria 4756
265 Ga0207676_10541961 3300026095 Bacteria 1110
266 Ga0207676_12544277 3300026095 Bacteria 508
267 Ga0207674_10054186 3300026116 Bacteria 4084
268 Ga0207674_10088969 3300026116 Bacteria 3080
269 Ga0207675_100001670 3300026118 Bacteria 22199
270 Ga0207675_100104972 3300026118 Bacteria 2663
271 Ga0207675_100124979 3300026118 Bacteria 2436
272 Ga0207675_100148786 3300026118 Bacteria 2228
273 Ga0207675_100158126 3300026118 Bacteria 2160
274 Ga0207675_102351720 3300026118 Bacteria 546
275 Ga0207683_10000250 3300026121 Bacteria 48026
276 Ga0207683_10000853 3300026121 Bacteria 27981
277 Ga0207683_10057077 3300026121 Bacteria 3427
278 Ga0207698_10003568 3300026142 Bacteria 9386
279 Ga0209282_1375077 3300027666 Bacteria 570
280 Ga0207428_10089355 3300027907 Bacteria 2394
281 Ga0207428_10299392 3300027907 Unclassified 1190
282 Ga0268266_10060333 3300028379 Bacteria 3269
283 Ga0268266_10202235 3300028379 Bacteria 1818
284 Ga0268266_10853862 3300028379 Bacteria 880
285 Ga0268265_10230416 3300028380 Bacteria 1628
286 Ga0268264_10879234 3300028381 Bacteria 898
287 Ga0268264_12507292 3300028381 Bacteria 521
288 Ga0307517_10101294 3300028786 Bacteria 2268
289 Ga0307517_10117953 3300028786 Bacteria 1978
290 Ga0307517_10164912 3300028786 Bacteria 1475
291 Ga0307513_10117936 3300031456 Bacteria 2630
292 Ga0307513_10217539 3300031456 Bacteria 1735
293 Ga0307513_10352818 3300031456 Unclassified 1218
294 Ga0307408_100188519 3300031548 Bacteria 1659
295 Ga0316575_10019694 3300031665 Bacteria 2583
296 Ga0316579_10316602 3300031691 Bacteria 754
297 Ga0316578_10484401 3300031728 Bacteria 729
298 Ga0307516_10022871 3300031730 Bacteria 6415
299 Ga0307516_10777577 3300031730 Bacteria 618
300 Ga0316577_10256301 3300031733 Bacteria 990
301 Ga0307413_11034812 3300031824 Bacteria 706
302 Ga0307409_100466734 3300031995 Bacteria 1222
303 Ga0307409_101964980 3300031995 Bacteria 614
304 Ga0307416_102055419 3300032002 Bacteria 674
305 Ga0307416_102369666 3300032002 Bacteria 631
306 Ga0307414_10983780 3300032004 Bacteria 776
307 Ga0307411_10717821 3300032005 Bacteria 872
308 Ga0307415_100965271 3300032126 Bacteria 790
309 Ga0307510_10218187 3300033180 Bacteria 1422
310 Ga0373948_0008567 3300034817 Bacteria 1743
311 Ga0373950_0003111 3300034818 Bacteria 2345
312 Ga0373940_0018466 3300035088 Bacteria 1750
313 Ga0373951_0010198 3300035091 Bacteria 2109
314 Ga0373939_0000090 3300035114 Bacteria 29085
315 Ga0373945_0323885 3300035116 Bacteria 664
316 Ga0373960_0001231 3300035121 Bacteria 5606
317 Ga0373946_0527707 3300035171 Bacteria 607
318 Ga0373961_0063068 3300035241 Bacteria 1129
319 Ga0373931_0000516 3300035691 Bacteria 15816
320 Ga0373937_0254405 3300036401 Bacteria 1656
321 Ga0373937_0478882 3300036401 Bacteria 1182
322 Ga0316582_0020819 3300036647 Bacteria 3864
323 Ga0395900_0814271 3300037418 Bacteria 861
324 Ga0395905_0287921 3300037471 Bacteria 1529
325 Ga0316581_0004793 3300037588 Bacteria 3481
326 Ga0450897_036166 3300042128 Bacteria 572
327 Ga0451577_0094867 3300042876 Unclassified 2664
328 Ga0451577_1676020 3300042876 Bacteria 560
329 Ga0466969_0018161 3300044656 Bacteria 3667
330 Ga0453683_0585936 3300044673 Unclassified 727
331 Ga0466965_0130400 3300044683 Bacteria 1303
332 Ga0466966_0222488 3300044684 Bacteria 1139
333 Ga0466961_0145275 3300044693 Bacteria 1483
334 Ga0466971_0025669 3300044719 Bacteria 2631
335 Ga0466968_0266167 3300044735 Bacteria 817
336 Ga0466968_0393391 3300044735 Bacteria 678
337 Ga0466957_0040153 3300044842 Bacteria 2826
338 Ga0466960_0006870 3300044901 Bacteria 4589
339 Ga0466959_0031417 3300045049 Bacteria 3928
340 Ga0451576_1771352 3300045051 Bacteria 639
341 Ga0466967_1786487 3300045976 Bacteria 612
342 Ga0495629_0073366 3300046459 Bacteria 2390
343 Ga0495582_0285287 3300046473 Bacteria 948
344 Ga0495605_0029015 3300046474 Bacteria 2852
345 Ga0495594_0090716 3300046499 Unclassified 1712
346 Ga0495583_0228919 3300046506 Bacteria 750
347 Ga0495608_0630071 3300046511 Bacteria 642
348 Ga0495610_0088163 3300046512 Bacteria 1411
349 Ga0495620_0088133 3300046515 Bacteria 1248
350 Ga0495628_0437154 3300046516 Bacteria 952
351 Ga0495630_0326271 3300046517 Bacteria 1174
352 Ga0495630_0708580 3300046517 Bacteria 770
353 Ga0495631_0054785 3300046518 Bacteria 1738
354 Ga0495632_0003106 3300046519 Bacteria 12035
355 Ga0495642_0424659 3300046528 Bacteria 587
356 Ga0495598_0015034 3300046537 Bacteria 1945
357 Ga0495609_0044876 3300046538 Bacteria 1982
358 Ga0495621_0015517 3300046539 Bacteria 2430
359 Ga0495597_0059365 3300046542 Bacteria 1670
360 Ga0495597_0187811 3300046542 Bacteria 832
361 Ga0495645_0087358 3300046543 Bacteria 2231
362 Ga0495668_0052296 3300046616 Bacteria 2260
363 Ga0495611_0067112 3300046648 Bacteria 1637
364 Ga0495625_0023869 3300046660 Bacteria 4665
365 Ga0495647_0393362 3300046681 Bacteria 636
366 Ga0495658_0000385 3300046683 Bacteria 24814
367 Ga0495658_0132765 3300046683 Bacteria 1517
368 Ga0495658_0470861 3300046683 Bacteria 803
369 Ga0495671_0180926 3300046692 Bacteria 1024
370 Ga0495649_0008052 3300046694 Bacteria 6366
371 Ga0495660_0043232 3300046810 Bacteria 2486
372 Ga0495581_0247038 3300047315 Bacteria 1043
373 Ga0495674_1426102 3300047319 Bacteria 515
374 Ga0495672_0183233 3300047320 Bacteria 1059
375 Ga0495687_001446 3300047443 Bacteria 21795
376 Ga0495626_0205376 3300048091 Bacteria 806
377 Ga0496100_0282514 3300048903 Bacteria 1238
378 Ga0496104_0025922 3300048907 Bacteria 5407
379 Ga0496106_0785255 3300048909 Bacteria 756
380 Ga0496107_0077713 3300048910 Bacteria 2418
381 Ga0496107_0485869 3300048910 Unclassified 916
382 Ga0496108_1418325 3300048911 Bacteria 580
383 Ga0496109_0853975 3300048912 Bacteria 848
384 Ga0496109_1337561 3300048912 Bacteria 652
385 Ga0496112_0139084 3300048915 Bacteria 2397
386 Ga0496113_0985216 3300048916 Bacteria 664
387 Ga0496114_0163829 3300048917 Bacteria 1935
388 Ga0496115_0194295 3300048918 Bacteria 1677
389 Ga0495678_188748 3300049459 Bacteria 642
390 Ga0501291_014467 3300049514 Bacteria 1181
391 Ga0501298_113555 3300049521 Bacteria 631
392 Ga0501300_000731 3300049523 Bacteria 4932
393 Ga0501032_0387269 3300049569 Bacteria 899
394 Ga0501033_0000565 3300049570 Bacteria 34468
395 Ga0501034_0000641 3300049571 Bacteria 54300
396 Ga0501034_0093094 3300049571 Bacteria 3010
397 Ga0501034_0173008 3300049571 Bacteria 2126
398 Ga0501042_0504105 3300049578 Bacteria 879
399 Ga0501043_0287146 3300049579 Bacteria 1260
400 Ga0501046_0652436 3300049580 Unclassified 744
401 Ga0501067_0015456 3300049583 Bacteria 4226
402 Ga0501068_0043891 3300049584 Bacteria 2690
403 Ga0501069_0916437 3300049585 Bacteria 533
404 Ga0501071_0001676 3300049587 Bacteria 12997
405 Ga0501071_0270049 3300049587 Bacteria 1286
406 Ga0501072_0002048 3300049588 Bacteria 14991
407 Ga0501072_0024636 3300049588 Bacteria 4684
408 Ga0501072_0112710 3300049588 Bacteria 2165
409 Ga0501073_0170098 3300049589 Bacteria 1508
410 Ga0501074_0032109 3300049590 Bacteria 3805
411 Ga0501074_0206226 3300049590 Bacteria 1401
412 Ga0501075_0043235 3300049591 Bacteria 3379
413 Ga0501077_0002804 3300049593 Bacteria 10456
414 Ga0501249_043842 3300049679 Bacteria 1018
415 Ga0501079_0000604 3300049741 Bacteria 23816
416 Ga0501080_0015536 3300049742 Bacteria 7020
417 Ga0501080_0365859 3300049742 Bacteria 1301
418 Ga0501080_0370346 3300049742 Bacteria 1292
419 Ga0501081_0223917 3300049743 Bacteria 1368
420 Ga0501081_0784888 3300049743 Bacteria 717
421 Ga0501267_000112 3300049764 Bacteria 5182
422 Ga0501272_068161 3300049769 Bacteria 517
423 nmdc:mga03683_155105_c1 3300050489 Unclassified 1035
424 nmdc:mga03683_3760_c2 3300050489 Bacteria 2804
425 nmdc:mga03n38_3563_c1 3300050490 Bacteria 5026
426 nmdc:mga0yw44_649312_c1 3300050492 Unclassified 717
427 nmdc:mga0k408_3106_c1 3300050493 Bacteria 8801
428 nmdc:mga0k408_737755_c1 3300050493 Bacteria 576
429 nmdc:mga06z11_113893_c1 3300050494 Bacteria 1501
430 nmdc:mga06z11_11937_c1 3300050494 Bacteria 2903
431 nmdc:mga07m45_1462_c1 3300050496 Bacteria 10840
432 nmdc:mga07m45_31227_c1 3300050496 Bacteria 2952
433 nmdc:mga05p37_1235464_c1 3300050507 Unclassified 768
434 nmdc:mga09592_224899_c1 3300050508 Unclassified 1626
435 nmdc:mga0qj67_113690_c1 3300050509 Bacteria 2186
436 nmdc:mga0qj67_1183511_c1 3300050509 Bacteria 595
437 nmdc:mga06r32_334030_c1 3300050510 Bacteria 1500
438 nmdc:mga08y16_1739212_c1 3300050511 Bacteria 578
439 nmdc:mga08y16_180307_c1 3300050511 Unclassified 2193
440 nmdc:mga08y16_1859_c1 3300050511 Bacteria 21453
441 nmdc:mga0rr50_116593_c1 3300050513 Bacteria 2120
442 nmdc:mga0a205_1537993_c1 3300050515 Bacteria 513
443 nmdc:mga0sz30_42222_c2 3300050516 Bacteria 989
444 nmdc:mga0sz30_6858_c1 3300050516 Bacteria 4251
445 Ga0500578_0464471 3300053086 Bacteria 718
446 Ga0500650_0247802 3300053098 Bacteria 800
447 Ga0500658_0002629 3300053134 Bacteria 6916
448 Ga0500568_0025639 3300053139 Bacteria 2484
449 Ga0500577_0392122 3300053142 Unclassified 607
450 Ga0501084_0023787 3300054114 Bacteria 5109
451 Ga0501082_0117575 3300060353 Bacteria 2303
452 Ga0466962_0003292 3300061719 Bacteria 7676
453 Ga0466962_0111224 3300061719 Bacteria 1319
454 Ga0530510_0366055 3300061734 Bacteria 1084

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044735 Ga0466968_0266167 Ga0466968_0266167_411_755 113
2 3300046683 Ga0495658_0000385 Ga0495658_0000385_24104_24490 115
3 3300028380 Ga0268265_10230416 Ga0268265_102304163 116
4 3300046511 Ga0495608_0630071 Ga0495608_0630071_193_582 116
5 3300046517 Ga0495630_0708580 Ga0495630_0708580_109_498 116
6 3300005617 Ga0068859_101042424 Ga0068859_1010424242 117
7 3300005840 Ga0068870_10224121 Ga0068870_102241212 117
8 3300006931 Ga0097620_101042312 Ga0097620_1010423122 117
9 3300014326 Ga0157380_10665009 Ga0157380_106650092 117
10 3300049743 Ga0501081_0784888 Ga0501081_0784888_112_501 118
11 3300049588 Ga0501072_0024636 Ga0501072_0024636_1409_1795 119
12 3300049590 Ga0501074_0206226 Ga0501074_0206226_584_970 119
13 3300049591 Ga0501075_0043235 Ga0501075_0043235_1035_1421 119
14 3300049742 Ga0501080_0370346 Ga0501080_0370346_768_1154 119
15 3300050509 nmdc:mga0qj67_113690_c1 nmdc:mga0qj67_113690_c1_1759_2118 119
16 3300046660 Ga0495625_0023869 Ga0495625_0023869_2640_3008 121
17 3300005293 Ga0065715_10129151 Ga0065715_101291512 123
18 3300005618 Ga0068864_100000046 Ga0068864_10000004657 123
19 3300026095 Ga0207676_10000008 Ga0207676_10000008251 123
20 3300046459 Ga0495629_0073366 Ga0495629_0073366_1876_2247 123
21 3300046683 Ga0495658_0132765 Ga0495658_0132765_764_1135 123
22 iso_pu_bacteria 2643221559 2643815737 124
23 iso_pu_bacteria 2643221586 2643940758 124
24 iso_pu_bacteria 2643221612 2644080195 124
25 iso_pu_bacteria 2643221727 2644695791 124
26 iso_pu_bacteria 2904615490 2904622589 124
27 iso_pu_bacteria 642555112 642597120 124
28 3300014326 Ga0157380_11052233 Ga0157380_110522332 127
29 3300025936 Ga0207670_10573266 Ga0207670_105732662 127
30 3300003323 rootH1_10170785 rootH1_101707855 128
31 3300005328 Ga0070676_10207221 Ga0070676_102072212 128
32 3300005333 Ga0070677_10004666 Ga0070677_100046662 128
33 3300005334 Ga0068869_100061399 Ga0068869_1000613993 128
34 3300005334 Ga0068869_100072884 Ga0068869_1000728845 128
35 3300005334 Ga0068869_100296523 Ga0068869_1002965231 128
36 3300005334 Ga0068869_100380109 Ga0068869_1003801092 128
37 3300005335 Ga0070666_10004385 Ga0070666_1000438513 128
38 3300005335 Ga0070666_10013781 Ga0070666_100137815 128
39 3300005335 Ga0070666_10785047 Ga0070666_107850472 128
40 3300005336 Ga0070680_100375561 Ga0070680_1003755612 128
41 3300005338 Ga0068868_100004933 Ga0068868_1000049334 128
42 3300005338 Ga0068868_100008290 Ga0068868_1000082904 128
43 3300005338 Ga0068868_100011587 Ga0068868_1000115879 128
44 3300005340 Ga0070689_100027465 Ga0070689_1000274654 128
45 3300005340 Ga0070689_100140067 Ga0070689_1001400672 128
46 3300005340 Ga0070689_100553996 Ga0070689_1005539962 128
47 3300005347 Ga0070668_100003653 Ga0070668_1000036536 128
48 3300005347 Ga0070668_100025295 Ga0070668_1000252955 128
49 3300005353 Ga0070669_100187494 Ga0070669_1001874942 128
50 3300005353 Ga0070669_100298271 Ga0070669_1002982713 128
51 3300005354 Ga0070675_100008171 Ga0070675_10000817112 128
52 3300005354 Ga0070675_100008971 Ga0070675_1000089714 128
53 3300005355 Ga0070671_100002283 Ga0070671_1000022835 128
54 3300005356 Ga0070674_100001737 Ga0070674_1000017372 128
55 3300005356 Ga0070674_100042754 Ga0070674_1000427543 128
56 3300005364 Ga0070673_100000414 Ga0070673_1000004147 128
57 3300005364 Ga0070673_100024254 Ga0070673_1000242542 128
58 3300005364 Ga0070673_100052622 Ga0070673_1000526225 128
59 3300005364 Ga0070673_100075977 Ga0070673_1000759774 128
60 3300005365 Ga0070688_100007290 Ga0070688_1000072904 128
61 3300005365 Ga0070688_100734963 Ga0070688_1007349631 128
62 3300005366 Ga0070659_101417061 Ga0070659_1014170612 128
63 3300005367 Ga0070667_100004577 Ga0070667_10000457721 128
64 3300005367 Ga0070667_100112213 Ga0070667_1001122133 128
65 3300005367 Ga0070667_100268791 Ga0070667_1002687912 128
66 3300005367 Ga0070667_101020152 Ga0070667_1010201522 128
67 3300005441 Ga0070700_100473709 Ga0070700_1004737092 128
68 3300005441 Ga0070700_100706468 Ga0070700_1007064681 128
69 3300005445 Ga0070708_100355629 Ga0070708_1003556293 128
70 3300005455 Ga0070663_100040669 Ga0070663_1000406694 128
71 3300005456 Ga0070678_100034195 Ga0070678_1000341953 128
72 3300005456 Ga0070678_100039661 Ga0070678_1000396614 128
73 3300005456 Ga0070678_100326234 Ga0070678_1003262342 128
74 3300005457 Ga0070662_100048909 Ga0070662_1000489095 128
75 3300005459 Ga0068867_100004322 Ga0068867_10000432213 128
76 3300005459 Ga0068867_100005598 Ga0068867_10000559815 128
77 3300005466 Ga0070685_10077459 Ga0070685_100774592 128
78 3300005466 Ga0070685_10316219 Ga0070685_103162191 128
79 3300005539 Ga0068853_100005722 Ga0068853_1000057222 128
80 3300005539 Ga0068853_100393387 Ga0068853_1003933872 128
81 3300005539 Ga0068853_101317664 Ga0068853_1013176642 128
82 3300005543 Ga0070672_100009932 Ga0070672_1000099328 128
83 3300005543 Ga0070672_100218937 Ga0070672_1002189372 128
84 3300005545 Ga0070695_100290450 Ga0070695_1002904503 128
85 3300005546 Ga0070696_100309538 Ga0070696_1003095382 128
86 3300005548 Ga0070665_100042494 Ga0070665_1000424946 128
87 3300005548 Ga0070665_100060912 Ga0070665_1000609123 128
88 3300005548 Ga0070665_100124742 Ga0070665_1001247422 128
89 3300005548 Ga0070665_100341078 Ga0070665_1003410782 128
90 3300005549 Ga0070704_100768538 Ga0070704_1007685382 128
91 3300005549 Ga0070704_100898897 Ga0070704_1008988972 128
92 3300005577 Ga0068857_100425098 Ga0068857_1004250982 128
93 3300005615 Ga0070702_101155614 Ga0070702_1011556141 128
94 3300005616 Ga0068852_100156332 Ga0068852_1001563323 128
95 3300005617 Ga0068859_100025433 Ga0068859_1000254332 128
96 3300005617 Ga0068859_100648383 Ga0068859_1006483832 128
97 3300005618 Ga0068864_100003522 Ga0068864_10000352217 128
98 3300005618 Ga0068864_100004730 Ga0068864_10000473011 128
99 3300005618 Ga0068864_100143009 Ga0068864_1001430092 128
100 3300005719 Ga0068861_100020784 Ga0068861_1000207842 128
101 3300005719 Ga0068861_100031275 Ga0068861_1000312754 128
102 3300005719 Ga0068861_100090966 Ga0068861_1000909662 128
103 3300005719 Ga0068861_100152102 Ga0068861_1001521025 128
104 3300005719 Ga0068861_100352945 Ga0068861_1003529454 128
105 3300005719 Ga0068861_101272997 Ga0068861_1012729972 128
106 3300005834 Ga0068851_10000963 Ga0068851_1000096313 128
107 3300005840 Ga0068870_10029085 Ga0068870_100290853 128
108 3300005840 Ga0068870_10337103 Ga0068870_103371032 128
109 3300005841 Ga0068863_100003538 Ga0068863_10000353819 128
110 3300005841 Ga0068863_100014047 Ga0068863_10001404712 128
111 3300005841 Ga0068863_101538988 Ga0068863_1015389881 128
112 3300005841 Ga0068863_101577344 Ga0068863_1015773442 128
113 3300005842 Ga0068858_100056047 Ga0068858_1000560473 128
114 3300005842 Ga0068858_100057670 Ga0068858_1000576704 128
115 3300005842 Ga0068858_100649057 Ga0068858_1006490571 128
116 3300005843 Ga0068860_100002164 Ga0068860_10000216423 128
117 3300005843 Ga0068860_100515606 Ga0068860_1005156061 128
118 3300005843 Ga0068860_102570797 Ga0068860_1025707971 128
119 3300005844 Ga0068862_100380708 Ga0068862_1003807083 128
120 3300006042 Ga0075368_10327983 Ga0075368_103279831 128
121 3300006048 Ga0075363_100011486 Ga0075363_1000114866 128
122 3300006051 Ga0075364_10322441 Ga0075364_103224412 128
123 3300006177 Ga0075362_10020687 Ga0075362_100206872 128
124 3300006178 Ga0075367_10003340 Ga0075367_1000334011 128
125 3300006178 Ga0075367_10593146 Ga0075367_105931462 128
126 3300006186 Ga0075369_10013614 Ga0075369_100136141 128
127 3300006186 Ga0075369_10068668 Ga0075369_100686682 128
128 3300006194 Ga0075427_10041461 Ga0075427_100414611 128
129 3300006195 Ga0075366_10072882 Ga0075366_100728823 128
130 3300006195 Ga0075366_10101992 Ga0075366_101019922 128
131 3300006195 Ga0075366_10127633 Ga0075366_101276333 128
132 3300006195 Ga0075366_10246569 Ga0075366_102465692 128
133 3300006195 Ga0075366_10843438 Ga0075366_108434382 128
134 3300006195 Ga0075366_11074172 Ga0075366_110741721 128
135 3300006237 Ga0097621_100071436 Ga0097621_1000714363 128
136 3300006237 Ga0097621_100258906 Ga0097621_1002589062 128
137 3300006237 Ga0097621_100269370 Ga0097621_1002693702 128
138 3300006237 Ga0097621_101868698 Ga0097621_1018686982 128
139 3300006353 Ga0075370_10002789 Ga0075370_100027898 128
140 3300006353 Ga0075370_10027526 Ga0075370_100275264 128
141 3300006353 Ga0075370_10039911 Ga0075370_100399113 128
142 3300006353 Ga0075370_10074024 Ga0075370_100740244 128
143 3300006353 Ga0075370_10892543 Ga0075370_108925432 128
144 3300006358 Ga0068871_100110972 Ga0068871_1001109722 128
145 3300006358 Ga0068871_100117282 Ga0068871_1001172823 128
146 3300006358 Ga0068871_100300819 Ga0068871_1003008192 128
147 3300006358 Ga0068871_100565308 Ga0068871_1005653082 128
148 3300006844 Ga0075428_100000133 Ga0075428_10000013339 128
149 3300006844 Ga0075428_100051798 Ga0075428_1000517982 128
150 3300006844 Ga0075428_100114848 Ga0075428_1001148484 128
151 3300006844 Ga0075428_100965143 Ga0075428_1009651432 128
152 3300006846 Ga0075430_100141658 Ga0075430_1001416582 128
153 3300006846 Ga0075430_101425893 Ga0075430_1014258932 128
154 3300006847 Ga0075431_100244486 Ga0075431_1002444862 128
155 3300006880 Ga0075429_101054404 Ga0075429_1010544042 128
156 3300006881 Ga0068865_100101685 Ga0068865_1001016853 128
157 3300006881 Ga0068865_100131619 Ga0068865_1001316194 128
158 3300006881 Ga0068865_101085519 Ga0068865_1010855191 128
159 3300006931 Ga0097620_100025432 Ga0097620_10002543211 128
160 3300006931 Ga0097620_100155782 Ga0097620_1001557825 128
161 3300006931 Ga0097620_100648525 Ga0097620_1006485252 128
162 3300006948 Ga0099826_10457401 Ga0099826_104574011 128
163 3300009011 Ga0105251_10158598 Ga0105251_101585981 128
164 3300009093 Ga0105240_10130469 Ga0105240_101304692 128
165 3300009093 Ga0105240_12173381 Ga0105240_121733811 128
166 3300009094 Ga0111539_10000654 Ga0111539_1000065439 128
167 3300009094 Ga0111539_10322958 Ga0111539_103229584 128
168 3300009098 Ga0105245_10247432 Ga0105245_102474325 128
169 3300009098 Ga0105245_10339284 Ga0105245_103392842 128
170 3300009098 Ga0105245_11082615 Ga0105245_110826151 128
171 3300009101 Ga0105247_10021490 Ga0105247_100214902 128
172 3300009147 Ga0114129_11061071 Ga0114129_110610712 128
173 3300009148 Ga0105243_10024169 Ga0105243_100241693 128
174 3300009148 Ga0105243_10478819 Ga0105243_104788193 128
175 3300009177 Ga0105248_10003651 Ga0105248_100036514 128
176 3300009177 Ga0105248_10019374 Ga0105248_100193746 128
177 3300009177 Ga0105248_10078334 Ga0105248_100783342 128
178 3300009177 Ga0105248_10555988 Ga0105248_105559882 128
179 3300009545 Ga0105237_10057642 Ga0105237_100576425 128
180 3300009553 Ga0105249_10047847 Ga0105249_100478474 128
181 3300010375 Ga0105239_10040126 Ga0105239_100401267 128
182 3300010375 Ga0105239_11167124 Ga0105239_111671241 128
183 3300013296 Ga0157374_10015238 Ga0157374_100152382 128
184 3300013296 Ga0157374_10034007 Ga0157374_100340072 128
185 3300013297 Ga0157378_10024746 Ga0157378_1002474610 128
186 3300013297 Ga0157378_10072118 Ga0157378_100721182 128
187 3300013297 Ga0157378_10519654 Ga0157378_105196542 128
188 3300013306 Ga0163162_10060010 Ga0163162_100600109 128
189 3300013306 Ga0163162_10068114 Ga0163162_100681144 128
190 3300013308 Ga0157375_10000991 Ga0157375_1000099119 128
191 3300013308 Ga0157375_10382621 Ga0157375_103826212 128
192 3300013308 Ga0157375_10501963 Ga0157375_105019632 128
193 3300014325 Ga0163163_10029012 Ga0163163_100290128 128
194 3300014325 Ga0163163_10479608 Ga0163163_104796083 128
195 3300014326 Ga0157380_10036291 Ga0157380_100362915 128
196 3300014326 Ga0157380_10177359 Ga0157380_101773593 128
197 3300014326 Ga0157380_10271386 Ga0157380_102713863 128
198 3300014326 Ga0157380_10308298 Ga0157380_103082983 128
199 3300014745 Ga0157377_10555550 Ga0157377_105555502 128
200 3300014968 Ga0157379_10004507 Ga0157379_1000450717 128
201 3300014969 Ga0157376_10050766 Ga0157376_100507663 128
202 3300015689 Ga0183360_10001 Ga0183360_10001525 128
203 3300017792 Ga0163161_10087328 Ga0163161_100873283 128
204 3300017792 Ga0163161_10224674 Ga0163161_102246743 128
205 3300025263 Ga0209565_1002300 Ga0209565_10023008 128
206 3300025315 Ga0207697_10006798 Ga0207697_100067982 128
207 3300025315 Ga0207697_10030017 Ga0207697_100300172 128
208 3300025321 Ga0207656_10002949 Ga0207656_100029492 128
209 3300025893 Ga0207682_10001173 Ga0207682_100011734 128
210 3300025893 Ga0207682_10025400 Ga0207682_100254004 128
211 3300025900 Ga0207710_10010257 Ga0207710_100102576 128
212 3300025903 Ga0207680_10002438 Ga0207680_1000243813 128
213 3300025907 Ga0207645_10001033 Ga0207645_100010335 128
214 3300025907 Ga0207645_10091588 Ga0207645_100915884 128
215 3300025907 Ga0207645_10094272 Ga0207645_100942724 128
216 3300025908 Ga0207643_10081182 Ga0207643_100811823 128
217 3300025908 Ga0207643_10213078 Ga0207643_102130783 128
218 3300025911 Ga0207654_10661615 Ga0207654_106616151 128
219 3300025913 Ga0207695_10167703 Ga0207695_101677032 128
220 3300025914 Ga0207671_10018695 Ga0207671_100186952 128
221 3300025917 Ga0207660_10866612 Ga0207660_108666122 128
222 3300025918 Ga0207662_10556988 Ga0207662_105569882 128
223 3300025923 Ga0207681_10173270 Ga0207681_101732702 128
224 3300025923 Ga0207681_10246218 Ga0207681_102462184 128
225 3300025923 Ga0207681_10329552 Ga0207681_103295522 128
226 3300025924 Ga0207694_10775699 Ga0207694_107756992 128
227 3300025925 Ga0207650_10174178 Ga0207650_101741783 128
228 3300025925 Ga0207650_11483572 Ga0207650_114835721 128
229 3300025926 Ga0207659_10003127 Ga0207659_1000312717 128
230 3300025926 Ga0207659_10167779 Ga0207659_101677792 128
231 3300025927 Ga0207687_10189273 Ga0207687_101892732 128
232 3300025927 Ga0207687_10401813 Ga0207687_104018132 128
233 3300025928 Ga0207700_10389005 Ga0207700_103890052 128
234 3300025931 Ga0207644_10008533 Ga0207644_100085338 128
235 3300025932 Ga0207690_11129996 Ga0207690_111299962 128
236 3300025933 Ga0207706_10140717 Ga0207706_101407173 128
237 3300025936 Ga0207670_10458748 Ga0207670_104587481 128
238 3300025937 Ga0207669_10001098 Ga0207669_100010985 128
239 3300025937 Ga0207669_10017530 Ga0207669_100175303 128
240 3300025938 Ga0207704_10001647 Ga0207704_1000164717 128
241 3300025938 Ga0207704_10016422 Ga0207704_100164225 128
242 3300025940 Ga0207691_10000006 Ga0207691_1000000636 128
243 3300025940 Ga0207691_10001055 Ga0207691_100010558 128
244 3300025940 Ga0207691_10002769 Ga0207691_100027696 128
245 3300025940 Ga0207691_10230191 Ga0207691_102301911 128
246 3300025941 Ga0207711_10171912 Ga0207711_101719124 128
247 3300025941 Ga0207711_10176985 Ga0207711_101769852 128
248 3300025941 Ga0207711_10306614 Ga0207711_103066142 128
249 3300025941 Ga0207711_10353491 Ga0207711_103534913 128
250 3300025942 Ga0207689_10001598 Ga0207689_1000159824 128
251 3300025942 Ga0207689_10055677 Ga0207689_100556776 128
252 3300025942 Ga0207689_10247606 Ga0207689_102476062 128
253 3300025942 Ga0207689_10294111 Ga0207689_102941112 128
254 3300025942 Ga0207689_10383675 Ga0207689_103836753 128
255 3300025942 Ga0207689_10910751 Ga0207689_109107512 128
256 3300025942 Ga0207689_11770871 Ga0207689_117708711 128
257 3300025960 Ga0207651_10074667 Ga0207651_100746673 128
258 3300025960 Ga0207651_10093255 Ga0207651_100932554 128
259 3300025960 Ga0207651_10137611 Ga0207651_101376112 128
260 3300025972 Ga0207668_10005508 Ga0207668_100055085 128
261 3300025981 Ga0207640_10203493 Ga0207640_102034934 128
262 3300025981 Ga0207640_10328064 Ga0207640_103280642 128
263 3300025986 Ga0207658_10046027 Ga0207658_100460272 128
264 3300025986 Ga0207658_10263501 Ga0207658_102635011 128
265 3300025986 Ga0207658_10411556 Ga0207658_104115562 128
266 3300026023 Ga0207677_10000069 Ga0207677_1000006947 128
267 3300026023 Ga0207677_10023297 Ga0207677_100232977 128
268 3300026035 Ga0207703_10012059 Ga0207703_100120597 128
269 3300026035 Ga0207703_10364321 Ga0207703_103643212 128
270 3300026035 Ga0207703_10402062 Ga0207703_104020622 128
271 3300026035 Ga0207703_10531454 Ga0207703_105314542 128
272 3300026041 Ga0207639_10005406 Ga0207639_1000540612 128
273 3300026041 Ga0207639_10143158 Ga0207639_101431584 128
274 3300026041 Ga0207639_10343845 Ga0207639_103438452 128
275 3300026075 Ga0207708_10069939 Ga0207708_100699396 128
276 3300026088 Ga0207641_10001705 Ga0207641_1000170526 128
277 3300026088 Ga0207641_10024731 Ga0207641_100247312 128
278 3300026088 Ga0207641_10800363 Ga0207641_108003632 128
279 3300026088 Ga0207641_11242138 Ga0207641_112421382 128
280 3300026089 Ga0207648_10003315 Ga0207648_100033156 128
281 3300026089 Ga0207648_10121092 Ga0207648_101210923 128
282 3300026089 Ga0207648_10125362 Ga0207648_101253623 128
283 3300026095 Ga0207676_10002144 Ga0207676_100021446 128
284 3300026095 Ga0207676_10021291 Ga0207676_100212916 128
285 3300026095 Ga0207676_10541961 Ga0207676_105419612 128
286 3300026095 Ga0207676_12544277 Ga0207676_125442771 128
287 3300026116 Ga0207674_10054186 Ga0207674_100541865 128
288 3300026116 Ga0207674_10088969 Ga0207674_100889692 128
289 3300026118 Ga0207675_100001670 Ga0207675_10000167022 128
290 3300026118 Ga0207675_100104972 Ga0207675_1001049724 128
291 3300026118 Ga0207675_100124979 Ga0207675_1001249792 128
292 3300026118 Ga0207675_100148786 Ga0207675_1001487864 128
293 3300026118 Ga0207675_100158126 Ga0207675_1001581263 128
294 3300026118 Ga0207675_102351720 Ga0207675_1023517201 128
295 3300026121 Ga0207683_10000250 Ga0207683_1000025027 128
296 3300026121 Ga0207683_10000853 Ga0207683_1000085317 128
297 3300026121 Ga0207683_10057077 Ga0207683_100570772 128
298 3300026142 Ga0207698_10003568 Ga0207698_1000356812 128
299 3300027666 Ga0209282_1375077 Ga0209282_13750772 128
300 3300027907 Ga0207428_10089355 Ga0207428_100893554 128
301 3300027907 Ga0207428_10299392 Ga0207428_102993923 128
302 3300028379 Ga0268266_10060333 Ga0268266_100603332 128
303 3300028379 Ga0268266_10202235 Ga0268266_102022354 128
304 3300028379 Ga0268266_10853862 Ga0268266_108538622 128
305 3300028381 Ga0268264_10879234 Ga0268264_108792343 128
306 3300028381 Ga0268264_12507292 Ga0268264_125072922 128
307 3300028786 Ga0307517_10101294 Ga0307517_101012946 128
308 3300028786 Ga0307517_10117953 Ga0307517_101179533 128
309 3300028786 Ga0307517_10164912 Ga0307517_101649124 128
310 3300031456 Ga0307513_10117936 Ga0307513_101179363 128
311 3300031456 Ga0307513_10217539 Ga0307513_102175393 128
312 3300031456 Ga0307513_10352818 Ga0307513_103528182 128
313 3300031548 Ga0307408_100188519 Ga0307408_1001885192 128
314 3300031665 Ga0316575_10019694 Ga0316575_100196941 128
315 3300031691 Ga0316579_10316602 Ga0316579_103166022 128
316 3300031728 Ga0316578_10484401 Ga0316578_104844012 128
317 3300031730 Ga0307516_10022871 Ga0307516_100228713 128
318 3300031730 Ga0307516_10777577 Ga0307516_107775772 128
319 3300031733 Ga0316577_10256301 Ga0316577_102563012 128
320 3300031824 Ga0307413_11034812 Ga0307413_110348122 128
321 3300031995 Ga0307409_100466734 Ga0307409_1004667342 128
322 3300031995 Ga0307409_101964980 Ga0307409_1019649801 128
323 3300032002 Ga0307416_102055419 Ga0307416_1020554191 128
324 3300032002 Ga0307416_102369666 Ga0307416_1023696661 128
325 3300032004 Ga0307414_10983780 Ga0307414_109837801 128
326 3300032005 Ga0307411_10717821 Ga0307411_107178212 128
327 3300032126 Ga0307415_100965271 Ga0307415_1009652711 128
328 3300033180 Ga0307510_10218187 Ga0307510_102181872 128
329 3300034817 Ga0373948_0008567 Ga0373948_0008567_240_632 128
330 3300034818 Ga0373950_0003111 Ga0373950_0003111_935_1327 128
331 3300035088 Ga0373940_0018466 Ga0373940_0018466_1205_1597 128
332 3300035091 Ga0373951_0010198 Ga0373951_0010198_591_983 128
333 3300035114 Ga0373939_0000090 Ga0373939_0000090_7773_8165 128
334 3300035116 Ga0373945_0323885 Ga0373945_0323885_91_540 128
335 3300035121 Ga0373960_0001231 Ga0373960_0001231_1289_1681 128
336 3300035171 Ga0373946_0527707 Ga0373946_0527707_181_573 128
337 3300035241 Ga0373961_0063068 Ga0373961_0063068_643_1035 128
338 3300035691 Ga0373931_0000516 Ga0373931_0000516_7749_8141 128
339 3300036401 Ga0373937_0254405 Ga0373937_0254405_1203_1589 128
340 3300036401 Ga0373937_0478882 Ga0373937_0478882_442_855 128
341 3300036647 Ga0316582_0020819 Ga0316582_0020819_1626_2012 128
342 3300037418 Ga0395900_0814271 Ga0395900_0814271_50_436 128
343 3300037471 Ga0395905_0287921 Ga0395905_0287921_763_1149 128
344 3300037588 Ga0316581_0004793 Ga0316581_0004793_1224_1610 128
345 3300042128 Ga0450897_036166 Ga0450897_036166_32_418 128
346 3300042876 Ga0451577_0094867 Ga0451577_0094867_2156_2542 128
347 3300042876 Ga0451577_1676020 Ga0451577_1676020_96_485 128
348 3300044656 Ga0466969_0018161 Ga0466969_0018161_2075_2473 128
349 3300044673 Ga0453683_0585936 Ga0453683_0585936_293_679 128
350 3300044683 Ga0466965_0130400 Ga0466965_0130400_355_753 128
351 3300044684 Ga0466966_0222488 Ga0466966_0222488_655_1053 128
352 3300044693 Ga0466961_0145275 Ga0466961_0145275_835_1233 128
353 3300044719 Ga0466971_0025669 Ga0466971_0025669_1479_1877 128
354 3300044735 Ga0466968_0393391 Ga0466968_0393391_145_531 128
355 3300044842 Ga0466957_0040153 Ga0466957_0040153_2072_2470 128
356 3300044901 Ga0466960_0006870 Ga0466960_0006870_2936_3322 128
357 3300045049 Ga0466959_0031417 Ga0466959_0031417_1426_1824 128
358 3300045051 Ga0451576_1771352 Ga0451576_1771352_57_455 128
359 3300045976 Ga0466967_1786487 Ga0466967_1786487_109_495 128
360 3300046473 Ga0495582_0285287 Ga0495582_0285287_431_880 128
361 3300046474 Ga0495605_0029015 Ga0495605_0029015_2394_2822 128
362 3300046499 Ga0495594_0090716 Ga0495594_0090716_372_761 128
363 3300046506 Ga0495583_0228919 Ga0495583_0228919_170_559 128
364 3300046512 Ga0495610_0088163 Ga0495610_0088163_293_721 128
365 3300046515 Ga0495620_0088133 Ga0495620_0088133_430_858 128
366 3300046516 Ga0495628_0437154 Ga0495628_0437154_285_698 128
367 3300046517 Ga0495630_0326271 Ga0495630_0326271_599_985 128
368 3300046518 Ga0495631_0054785 Ga0495631_0054785_666_1094 128
369 3300046519 Ga0495632_0003106 Ga0495632_0003106_8096_8524 128
370 3300046528 Ga0495642_0424659 Ga0495642_0424659_167_559 128
371 3300046537 Ga0495598_0015034 Ga0495598_0015034_703_1095 128
372 3300046538 Ga0495609_0044876 Ga0495609_0044876_41_469 128
373 3300046539 Ga0495621_0015517 Ga0495621_0015517_1327_1719 128
374 3300046542 Ga0495597_0059365 Ga0495597_0059365_1084_1512 128
375 3300046542 Ga0495597_0187811 Ga0495597_0187811_150_539 128
376 3300046543 Ga0495645_0087358 Ga0495645_0087358_1365_1763 128
377 3300046616 Ga0495668_0052296 Ga0495668_0052296_1439_1828 128
378 3300046648 Ga0495611_0067112 Ga0495611_0067112_897_1286 128
379 3300046681 Ga0495647_0393362 Ga0495647_0393362_98_511 128
380 3300046683 Ga0495658_0470861 Ga0495658_0470861_364_777 128
381 3300046692 Ga0495671_0180926 Ga0495671_0180926_189_578 128
382 3300046694 Ga0495649_0008052 Ga0495649_0008052_4163_4591 128
383 3300046810 Ga0495660_0043232 Ga0495660_0043232_1027_1455 128
384 3300047315 Ga0495581_0247038 Ga0495581_0247038_266_715 128
385 3300047319 Ga0495674_1426102 Ga0495674_1426102_45_437 128
386 3300047320 Ga0495672_0183233 Ga0495672_0183233_111_497 128
387 3300047443 Ga0495687_001446 Ga0495687_001446_14125_14514 128
388 3300048091 Ga0495626_0205376 Ga0495626_0205376_98_487 128
389 3300048903 Ga0496100_0282514 Ga0496100_0282514_429_815 128
390 3300048907 Ga0496104_0025922 Ga0496104_0025922_3822_4208 128
391 3300048909 Ga0496106_0785255 Ga0496106_0785255_61_447 128
392 3300048910 Ga0496107_0077713 Ga0496107_0077713_1802_2188 128
393 3300048910 Ga0496107_0485869 Ga0496107_0485869_444_830 128
394 3300048911 Ga0496108_1418325 Ga0496108_1418325_116_502 128
395 3300048912 Ga0496109_0853975 Ga0496109_0853975_149_535 128
396 3300048912 Ga0496109_1337561 Ga0496109_1337561_221_619 128
397 3300048915 Ga0496112_0139084 Ga0496112_0139084_1929_2318 128
398 3300048916 Ga0496113_0985216 Ga0496113_0985216_92_478 128
399 3300048917 Ga0496114_0163829 Ga0496114_0163829_851_1237 128
400 3300048918 Ga0496115_0194295 Ga0496115_0194295_434_820 128
401 3300049459 Ga0495678_188748 Ga0495678_188748_64_492 128
402 3300049514 Ga0501291_014467 Ga0501291_014467_514_903 128
403 3300049521 Ga0501298_113555 Ga0501298_113555_60_449 128
404 3300049523 Ga0501300_000731 Ga0501300_000731_993_1382 128
405 3300049569 Ga0501032_0387269 Ga0501032_0387269_311_700 128
406 3300049570 Ga0501033_0000565 Ga0501033_0000565_15208_15597 128
407 3300049571 Ga0501034_0000641 Ga0501034_0000641_26529_26915 128
408 3300049571 Ga0501034_0093094 Ga0501034_0093094_877_1263 128
409 3300049571 Ga0501034_0173008 Ga0501034_0173008_1046_1435 128
410 3300049578 Ga0501042_0504105 Ga0501042_0504105_131_517 128
411 3300049579 Ga0501043_0287146 Ga0501043_0287146_355_741 128
412 3300049580 Ga0501046_0652436 Ga0501046_0652436_231_617 128
413 3300049583 Ga0501067_0015456 Ga0501067_0015456_1857_2243 128
414 3300049584 Ga0501068_0043891 Ga0501068_0043891_353_739 128
415 3300049585 Ga0501069_0916437 Ga0501069_0916437_89_475 128
416 3300049587 Ga0501071_0001676 Ga0501071_0001676_10022_10408 128
417 3300049587 Ga0501071_0270049 Ga0501071_0270049_480_869 128
418 3300049588 Ga0501072_0002048 Ga0501072_0002048_995_1381 128
419 3300049588 Ga0501072_0112710 Ga0501072_0112710_586_972 128
420 3300049589 Ga0501073_0170098 Ga0501073_0170098_71_457 128
421 3300049590 Ga0501074_0032109 Ga0501074_0032109_2993_3379 128
422 3300049593 Ga0501077_0002804 Ga0501077_0002804_8236_8622 128
423 3300049679 Ga0501249_043842 Ga0501249_043842_409_798 128
424 3300049741 Ga0501079_0000604 Ga0501079_0000604_4154_4540 128
425 3300049742 Ga0501080_0015536 Ga0501080_0015536_5275_5661 128
426 3300049742 Ga0501080_0365859 Ga0501080_0365859_827_1243 128
427 3300049743 Ga0501081_0223917 Ga0501081_0223917_587_973 128
428 3300049764 Ga0501267_000112 Ga0501267_000112_3118_3507 128
429 3300049769 Ga0501272_068161 Ga0501272_068161_63_449 128
430 3300050489 nmdc:mga03683_155105_c1 nmdc:mga03683_155105_c1_324_716 128
431 3300050489 nmdc:mga03683_3760_c2 nmdc:mga03683_3760_c2_1871_2263 128
432 3300050490 nmdc:mga03n38_3563_c1 nmdc:mga03n38_3563_c1_411_803 128
433 3300050492 nmdc:mga0yw44_649312_c1 nmdc:mga0yw44_649312_c1_314_700 128
434 3300050493 nmdc:mga0k408_3106_c1 nmdc:mga0k408_3106_c1_3556_3948 128
435 3300050493 nmdc:mga0k408_737755_c1 nmdc:mga0k408_737755_c1_161_553 128
436 3300050494 nmdc:mga06z11_113893_c1 nmdc:mga06z11_113893_c1_658_1050 128
437 3300050494 nmdc:mga06z11_11937_c1 nmdc:mga06z11_11937_c1_1074_1466 128
438 3300050496 nmdc:mga07m45_1462_c1 nmdc:mga07m45_1462_c1_218_610 128
439 3300050496 nmdc:mga07m45_31227_c1 nmdc:mga07m45_31227_c1_573_965 128
440 3300050507 nmdc:mga05p37_1235464_c1 nmdc:mga05p37_1235464_c1_10_396 128
441 3300050508 nmdc:mga09592_224899_c1 nmdc:mga09592_224899_c1_1187_1573 128
442 3300050509 nmdc:mga0qj67_1183511_c1 nmdc:mga0qj67_1183511_c1_92_484 128
443 3300050510 nmdc:mga06r32_334030_c1 nmdc:mga06r32_334030_c1_999_1391 128
444 3300050511 nmdc:mga08y16_1739212_c1 nmdc:mga08y16_1739212_c1_23_412 128
445 3300050511 nmdc:mga08y16_180307_c1 nmdc:mga08y16_180307_c1_1610_1996 128
446 3300050511 nmdc:mga08y16_1859_c1 nmdc:mga08y16_1859_c1_546_932 128
447 3300050513 nmdc:mga0rr50_116593_c1 nmdc:mga0rr50_116593_c1_511_909 128
448 3300050515 nmdc:mga0a205_1537993_c1 nmdc:mga0a205_1537993_c1_74_460 128
449 3300050516 nmdc:mga0sz30_42222_c2 nmdc:mga0sz30_42222_c2_514_906 128
450 3300050516 nmdc:mga0sz30_6858_c1 nmdc:mga0sz30_6858_c1_1243_1635 128
451 3300053086 Ga0500578_0464471 Ga0500578_0464471_123_551 128
452 3300053098 Ga0500650_0247802 Ga0500650_0247802_280_669 128
453 3300053134 Ga0500658_0002629 Ga0500658_0002629_2178_2606 128
454 3300053139 Ga0500568_0025639 Ga0500568_0025639_1469_1858 128
455 3300053142 Ga0500577_0392122 Ga0500577_0392122_177_563 128
456 3300054114 Ga0501084_0023787 Ga0501084_0023787_1811_2197 128
457 3300060353 Ga0501082_0117575 Ga0501082_0117575_577_963 128
458 3300061719 Ga0466962_0003292 Ga0466962_0003292_5027_5425 128
459 3300061719 Ga0466962_0111224 Ga0466962_0111224_17_403 128
460 3300061734 Ga0530510_0366055 Ga0530510_0366055_414_800 128

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22751

DUF488-N3a

Active DUF488-N3 subclade

3

125

0.97

PF04343

DUF488

Domain of unknown function DUF488

4

121

0.88

PF22752

DUF488-N3i

Inactive DUF488-N3 subclade

2

131

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dv5-assembly1.cif.gz_B crystal structure of leu65 to ala mutant of diphthine synthase 0.6489 84 128
2p6k-assembly1.cif.gz_B crystal structure of ph0725 from pyrococcus horikoshii ot3 0.6185 81 128
2pcg-assembly1.cif.gz_B crystal structure of ph0725 from pyrococcus horikoshii ot3 0.5993 76 128
2emr-assembly1.cif.gz_B mutant l65m structure of ph0725 from pyrococcus horikoshii ot3 0.5983 76 128
2e8h-assembly1.cif.gz_B crystal structure of ph0725 from pyrococcus horikoshii ot3 0.5979 76 128
ID Description Score Start End Superfamily
4gamM02 Mainly Alpha;Up-down Bundle;Monooxygenase;Methane monooxygenase, gamma chain, domain 2 0.7157 53 81 1.20.1280.30
af_Q9P6N4_361_771_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.567 54 93 1.25.40.10
af_K7MIR4_1_151_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.5476 52 92 1.25.40.10
af_E1B6W2_4_608_1.20.1280.170 Mainly Alpha;Up-down Bundle;Monooxygenase;Exocyst complex component Exo70 0.5454 53 95 1.20.1280.170
af_K7L3G9_6_154_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.5438 50 94 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A157ZQZ9-F1-model_v4 DUF488 domain-containing protein 0.9993 1 128
AF-A0A375BAR4-F1-model_v4 deleted 0.9992 1 128
AF-A0A375J012-F1-model_v4 DUF488 domain-containing protein 0.9984 1 128
AF-Q2IDM1-F1-model_v4 DUF488 domain-containing protein 0.9958 1 128
AF-A0A2T6CNJ7-F1-model_v4 DUF488 domain-containing protein 0.9944 1 127

Feature Viewer

pLDDT pTM Quality
94.97 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map