F448592
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 460 | 270 | 454 | 129 |
Family's Representative Sequence
| Representative Sequence | 3300044656|Ga0466969_0018161|Ga0466969_0018161_2075_2473 |
| Length | 132 |
| Sequence | MALRVVRLGTERQRDEGTRIGTVRRPPRGVPKSEFASQNWYDVWFPNLAPSLDLTKFALQSKGDAAQWKVFVRKYKAEMAQPDASHAIELLATLSQHADFSVGCYCEDEAWCHRSVLRELLADRGAKLAEHR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 2 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 3 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 4 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 5 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 43 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 44 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 50 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 51 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 52 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 53 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 54 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 55 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 56 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 57 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 61 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 62 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 63 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 64 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 65 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 67 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 88 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 133 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 134 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 138 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 139 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 140 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 141 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 142 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 143 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 144 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 145 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 146 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 147 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 148 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 149 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 150 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 151 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 152 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 153 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 154 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 155 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 156 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 157 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 158 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 159 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 160 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 161 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 162 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 163 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 164 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 165 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 166 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 167 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 168 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 169 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 170 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 171 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 172 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 173 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 174 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 175 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 176 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 177 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 178 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 179 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 180 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 181 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 214 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 215 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 216 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 219 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 220 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 221 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 222 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 224 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 225 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 226 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 242 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 246 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 247 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 248 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 249 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 250 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 251 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 252 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 253 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 261 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 262 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 263 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 264 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 265 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 266 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 269 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 270 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.7 |
| Metatranscriptomes | 0 |
| Isolates | 1.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.04 |
| Nodule | 0.65 |
| Rhizoplane | 2.61 |
| Rhizosphere | 85.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10170785 | 3300003323 | Bacteria | 6105 |
| 2 | Ga0065715_10129151 | 3300005293 | Bacteria | 2051 |
| 3 | Ga0070676_10207221 | 3300005328 | Bacteria | 1288 |
| 4 | Ga0070677_10004666 | 3300005333 | Bacteria | 4484 |
| 5 | Ga0068869_100061399 | 3300005334 | Unclassified | 2757 |
| 6 | Ga0068869_100072884 | 3300005334 | Bacteria | 2545 |
| 7 | Ga0068869_100296523 | 3300005334 | Bacteria | 1304 |
| 8 | Ga0068869_100380109 | 3300005334 | Bacteria | 1157 |
| 9 | Ga0070666_10004385 | 3300005335 | Bacteria | 8596 |
| 10 | Ga0070666_10013781 | 3300005335 | Bacteria | 5135 |
| 11 | Ga0070666_10785047 | 3300005335 | Bacteria | 701 |
| 12 | Ga0070680_100375561 | 3300005336 | Bacteria | 1210 |
| 13 | Ga0068868_100004933 | 3300005338 | Bacteria | 9373 |
| 14 | Ga0068868_100008290 | 3300005338 | Bacteria | 7442 |
| 15 | Ga0068868_100011587 | 3300005338 | Bacteria | 6422 |
| 16 | Ga0070689_100027465 | 3300005340 | Bacteria | 4291 |
| 17 | Ga0070689_100140067 | 3300005340 | Bacteria | 1945 |
| 18 | Ga0070689_100553996 | 3300005340 | Bacteria | 991 |
| 19 | Ga0070668_100003653 | 3300005347 | Bacteria | 11348 |
| 20 | Ga0070668_100025295 | 3300005347 | Bacteria | 4500 |
| 21 | Ga0070669_100187494 | 3300005353 | Bacteria | 1621 |
| 22 | Ga0070669_100298271 | 3300005353 | Bacteria | 1295 |
| 23 | Ga0070675_100008171 | 3300005354 | Bacteria | 8111 |
| 24 | Ga0070675_100008971 | 3300005354 | Bacteria | 7768 |
| 25 | Ga0070671_100002283 | 3300005355 | Bacteria | 14795 |
| 26 | Ga0070674_100001737 | 3300005356 | Bacteria | 11801 |
| 27 | Ga0070674_100042754 | 3300005356 | Bacteria | 3080 |
| 28 | Ga0070673_100000414 | 3300005364 | Bacteria | 22528 |
| 29 | Ga0070673_100024254 | 3300005364 | Bacteria | 4445 |
| 30 | Ga0070673_100052622 | 3300005364 | Bacteria | 3196 |
| 31 | Ga0070673_100075977 | 3300005364 | Bacteria | 2711 |
| 32 | Ga0070688_100007290 | 3300005365 | Bacteria | 5957 |
| 33 | Ga0070688_100734963 | 3300005365 | Bacteria | 767 |
| 34 | Ga0070659_101417061 | 3300005366 | Unclassified | 618 |
| 35 | Ga0070667_100004577 | 3300005367 | Bacteria | 11619 |
| 36 | Ga0070667_100112213 | 3300005367 | Bacteria | 2365 |
| 37 | Ga0070667_100268791 | 3300005367 | Bacteria | 1528 |
| 38 | Ga0070667_101020152 | 3300005367 | Bacteria | 772 |
| 39 | Ga0070700_100473709 | 3300005441 | Bacteria | 958 |
| 40 | Ga0070700_100706468 | 3300005441 | Bacteria | 802 |
| 41 | Ga0070708_100355629 | 3300005445 | Bacteria | 1380 |
| 42 | Ga0070663_100040669 | 3300005455 | Bacteria | 3257 |
| 43 | Ga0070678_100034195 | 3300005456 | Bacteria | 3538 |
| 44 | Ga0070678_100039661 | 3300005456 | Bacteria | 3325 |
| 45 | Ga0070678_100326234 | 3300005456 | Bacteria | 1312 |
| 46 | Ga0070662_100048909 | 3300005457 | Bacteria | 3048 |
| 47 | Ga0068867_100004322 | 3300005459 | Bacteria | 10002 |
| 48 | Ga0068867_100005598 | 3300005459 | Bacteria | 8900 |
| 49 | Ga0070685_10077459 | 3300005466 | Bacteria | 1985 |
| 50 | Ga0070685_10316219 | 3300005466 | Bacteria | 1057 |
| 51 | Ga0068853_100005722 | 3300005539 | Bacteria | 9783 |
| 52 | Ga0068853_100393387 | 3300005539 | Bacteria | 1296 |
| 53 | Ga0068853_101317664 | 3300005539 | Bacteria | 698 |
| 54 | Ga0070672_100009932 | 3300005543 | Bacteria | 6582 |
| 55 | Ga0070672_100218937 | 3300005543 | Bacteria | 1596 |
| 56 | Ga0070695_100290450 | 3300005545 | Bacteria | 1205 |
| 57 | Ga0070696_100309538 | 3300005546 | Bacteria | 1212 |
| 58 | Ga0070665_100042494 | 3300005548 | Bacteria | 4569 |
| 59 | Ga0070665_100060912 | 3300005548 | Bacteria | 3783 |
| 60 | Ga0070665_100124742 | 3300005548 | Bacteria | 2577 |
| 61 | Ga0070665_100341078 | 3300005548 | Unclassified | 1503 |
| 62 | Ga0070704_100768538 | 3300005549 | Unclassified | 859 |
| 63 | Ga0070704_100898897 | 3300005549 | Bacteria | 796 |
| 64 | Ga0068857_100425098 | 3300005577 | Bacteria | 1239 |
| 65 | Ga0070702_101155614 | 3300005615 | Bacteria | 621 |
| 66 | Ga0068852_100156332 | 3300005616 | Bacteria | 2124 |
| 67 | Ga0068859_100025433 | 3300005617 | Bacteria | 5938 |
| 68 | Ga0068859_100648383 | 3300005617 | Bacteria | 1148 |
| 69 | Ga0068859_101042424 | 3300005617 | Bacteria | 899 |
| 70 | Ga0068864_100000046 | 3300005618 | Bacteria | 151661 |
| 71 | Ga0068864_100003522 | 3300005618 | Bacteria | 12945 |
| 72 | Ga0068864_100004730 | 3300005618 | Bacteria | 11150 |
| 73 | Ga0068864_100143009 | 3300005618 | Unclassified | 2160 |
| 74 | Ga0068861_100020784 | 3300005719 | Bacteria | 4708 |
| 75 | Ga0068861_100031275 | 3300005719 | Bacteria | 3909 |
| 76 | Ga0068861_100090966 | 3300005719 | Bacteria | 2408 |
| 77 | Ga0068861_100152102 | 3300005719 | Bacteria | 1900 |
| 78 | Ga0068861_100352945 | 3300005719 | Unclassified | 1291 |
| 79 | Ga0068861_101272997 | 3300005719 | Unclassified | 714 |
| 80 | Ga0068851_10000963 | 3300005834 | Bacteria | 12458 |
| 81 | Ga0068870_10029085 | 3300005840 | Bacteria | 2781 |
| 82 | Ga0068870_10224121 | 3300005840 | Bacteria | 1152 |
| 83 | Ga0068870_10337103 | 3300005840 | Bacteria | 963 |
| 84 | Ga0068863_100003538 | 3300005841 | Bacteria | 15417 |
| 85 | Ga0068863_100014047 | 3300005841 | Bacteria | 7716 |
| 86 | Ga0068863_101538988 | 3300005841 | Bacteria | 674 |
| 87 | Ga0068863_101577344 | 3300005841 | Bacteria | 665 |
| 88 | Ga0068858_100056047 | 3300005842 | Bacteria | 3643 |
| 89 | Ga0068858_100057670 | 3300005842 | Bacteria | 3589 |
| 90 | Ga0068858_100649057 | 3300005842 | Bacteria | 1025 |
| 91 | Ga0068860_100002164 | 3300005843 | Bacteria | 20700 |
| 92 | Ga0068860_100515606 | 3300005843 | Bacteria | 1195 |
| 93 | Ga0068860_102570797 | 3300005843 | Bacteria | 528 |
| 94 | Ga0068862_100380708 | 3300005844 | Bacteria | 1316 |
| 95 | Ga0075368_10327983 | 3300006042 | Bacteria | 664 |
| 96 | Ga0075363_100011486 | 3300006048 | Bacteria | 4242 |
| 97 | Ga0075364_10322441 | 3300006051 | Unclassified | 1052 |
| 98 | Ga0075362_10020687 | 3300006177 | Bacteria | 2752 |
| 99 | Ga0075367_10003340 | 3300006178 | Bacteria | 7625 |
| 100 | Ga0075367_10593146 | 3300006178 | Bacteria | 704 |
| 101 | Ga0075369_10013614 | 3300006186 | Bacteria | 3234 |
| 102 | Ga0075369_10068668 | 3300006186 | Unclassified | 1558 |
| 103 | Ga0075427_10041461 | 3300006194 | Bacteria | 777 |
| 104 | Ga0075366_10072882 | 3300006195 | Bacteria | 2047 |
| 105 | Ga0075366_10101992 | 3300006195 | Bacteria | 1722 |
| 106 | Ga0075366_10127633 | 3300006195 | Bacteria | 1534 |
| 107 | Ga0075366_10246569 | 3300006195 | Bacteria | 1089 |
| 108 | Ga0075366_10843438 | 3300006195 | Bacteria | 570 |
| 109 | Ga0075366_11074172 | 3300006195 | Bacteria | 503 |
| 110 | Ga0097621_100071436 | 3300006237 | Bacteria | 2868 |
| 111 | Ga0097621_100258906 | 3300006237 | Bacteria | 1526 |
| 112 | Ga0097621_100269370 | 3300006237 | Unclassified | 1496 |
| 113 | Ga0097621_101868698 | 3300006237 | Unclassified | 573 |
| 114 | Ga0075370_10002789 | 3300006353 | Bacteria | 8190 |
| 115 | Ga0075370_10027526 | 3300006353 | Bacteria | 3155 |
| 116 | Ga0075370_10039911 | 3300006353 | Bacteria | 2646 |
| 117 | Ga0075370_10074024 | 3300006353 | Bacteria | 1952 |
| 118 | Ga0075370_10892543 | 3300006353 | Bacteria | 543 |
| 119 | Ga0068871_100110972 | 3300006358 | Bacteria | 2307 |
| 120 | Ga0068871_100117282 | 3300006358 | Bacteria | 2245 |
| 121 | Ga0068871_100300819 | 3300006358 | Bacteria | 1408 |
| 122 | Ga0068871_100565308 | 3300006358 | Bacteria | 1031 |
| 123 | Ga0075428_100000133 | 3300006844 | Bacteria | 65398 |
| 124 | Ga0075428_100051798 | 3300006844 | Bacteria | 4501 |
| 125 | Ga0075428_100114848 | 3300006844 | Bacteria | 2933 |
| 126 | Ga0075428_100965143 | 3300006844 | Bacteria | 903 |
| 127 | Ga0075430_100141658 | 3300006846 | Bacteria | 2002 |
| 128 | Ga0075430_101425893 | 3300006846 | Bacteria | 569 |
| 129 | Ga0075431_100244486 | 3300006847 | Bacteria | 1824 |
| 130 | Ga0075429_101054404 | 3300006880 | Bacteria | 710 |
| 131 | Ga0068865_100101685 | 3300006881 | Bacteria | 2105 |
| 132 | Ga0068865_100131619 | 3300006881 | Bacteria | 1875 |
| 133 | Ga0068865_101085519 | 3300006881 | Bacteria | 704 |
| 134 | Ga0097620_100025432 | 3300006931 | Bacteria | 5938 |
| 135 | Ga0097620_100155782 | 3300006931 | Bacteria | 2362 |
| 136 | Ga0097620_100648525 | 3300006931 | Bacteria | 1148 |
| 137 | Ga0097620_101042312 | 3300006931 | Bacteria | 899 |
| 138 | Ga0099826_10457401 | 3300006948 | Bacteria | 606 |
| 139 | Ga0105251_10158598 | 3300009011 | Bacteria | 1020 |
| 140 | Ga0105240_10130469 | 3300009093 | Bacteria | 3015 |
| 141 | Ga0105240_12173381 | 3300009093 | Bacteria | 576 |
| 142 | Ga0111539_10000654 | 3300009094 | Bacteria | 44760 |
| 143 | Ga0111539_10322958 | 3300009094 | Unclassified | 1796 |
| 144 | Ga0105245_10247432 | 3300009098 | Bacteria | 1731 |
| 145 | Ga0105245_10339284 | 3300009098 | Bacteria | 1485 |
| 146 | Ga0105245_11082615 | 3300009098 | Bacteria | 847 |
| 147 | Ga0105247_10021490 | 3300009101 | Bacteria | 3884 |
| 148 | Ga0114129_11061071 | 3300009147 | Bacteria | 1017 |
| 149 | Ga0105243_10024169 | 3300009148 | Bacteria | 4634 |
| 150 | Ga0105243_10478819 | 3300009148 | Bacteria | 1174 |
| 151 | Ga0105248_10003651 | 3300009177 | Bacteria | 17086 |
| 152 | Ga0105248_10019374 | 3300009177 | Bacteria | 7530 |
| 153 | Ga0105248_10078334 | 3300009177 | Bacteria | 3715 |
| 154 | Ga0105248_10555988 | 3300009177 | Bacteria | 1295 |
| 155 | Ga0105237_10057642 | 3300009545 | Bacteria | 3887 |
| 156 | Ga0105249_10047847 | 3300009553 | Bacteria | 3898 |
| 157 | Ga0105239_10040126 | 3300010375 | Bacteria | 5129 |
| 158 | Ga0105239_11167124 | 3300010375 | Bacteria | 887 |
| 159 | Ga0157374_10015238 | 3300013296 | Bacteria | 6742 |
| 160 | Ga0157374_10034007 | 3300013296 | Bacteria | 4654 |
| 161 | Ga0157378_10024746 | 3300013297 | Bacteria | 5286 |
| 162 | Ga0157378_10072118 | 3300013297 | Bacteria | 3103 |
| 163 | Ga0157378_10519654 | 3300013297 | Bacteria | 1192 |
| 164 | Ga0163162_10060010 | 3300013306 | Bacteria | 3837 |
| 165 | Ga0163162_10068114 | 3300013306 | Bacteria | 3610 |
| 166 | Ga0157375_10000991 | 3300013308 | Bacteria | 24533 |
| 167 | Ga0157375_10382621 | 3300013308 | Bacteria | 1574 |
| 168 | Ga0157375_10501963 | 3300013308 | Bacteria | 1377 |
| 169 | Ga0163163_10029012 | 3300014325 | Bacteria | 5320 |
| 170 | Ga0163163_10479608 | 3300014325 | Unclassified | 1305 |
| 171 | Ga0157380_10036291 | 3300014326 | Bacteria | 3813 |
| 172 | Ga0157380_10177359 | 3300014326 | Bacteria | 1869 |
| 173 | Ga0157380_10271386 | 3300014326 | Bacteria | 1547 |
| 174 | Ga0157380_10308298 | 3300014326 | Bacteria | 1462 |
| 175 | Ga0157380_10665009 | 3300014326 | Bacteria | 1041 |
| 176 | Ga0157380_11052233 | 3300014326 | Bacteria | 850 |
| 177 | Ga0157377_10555550 | 3300014745 | Bacteria | 812 |
| 178 | Ga0157379_10004507 | 3300014968 | Bacteria | 11946 |
| 179 | Ga0157376_10050766 | 3300014969 | Bacteria | 3443 |
| 180 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 181 | Ga0163161_10087328 | 3300017792 | Bacteria | 2303 |
| 182 | Ga0163161_10224674 | 3300017792 | Bacteria | 1455 |
| 183 | Ga0209565_1002300 | 3300025263 | Bacteria | 7018 |
| 184 | Ga0207697_10006798 | 3300025315 | Bacteria | 5144 |
| 185 | Ga0207697_10030017 | 3300025315 | Bacteria | 2225 |
| 186 | Ga0207656_10002949 | 3300025321 | Bacteria | 5803 |
| 187 | Ga0207682_10001173 | 3300025893 | Bacteria | 12153 |
| 188 | Ga0207682_10025400 | 3300025893 | Bacteria | 2349 |
| 189 | Ga0207710_10010257 | 3300025900 | Bacteria | 3942 |
| 190 | Ga0207680_10002438 | 3300025903 | Bacteria | 8673 |
| 191 | Ga0207645_10001033 | 3300025907 | Bacteria | 22978 |
| 192 | Ga0207645_10091588 | 3300025907 | Bacteria | 1955 |
| 193 | Ga0207645_10094272 | 3300025907 | Bacteria | 1926 |
| 194 | Ga0207643_10081182 | 3300025908 | Unclassified | 1879 |
| 195 | Ga0207643_10213078 | 3300025908 | Bacteria | 1180 |
| 196 | Ga0207654_10661615 | 3300025911 | Bacteria | 749 |
| 197 | Ga0207695_10167703 | 3300025913 | Bacteria | 2123 |
| 198 | Ga0207671_10018695 | 3300025914 | Bacteria | 5310 |
| 199 | Ga0207660_10866612 | 3300025917 | Bacteria | 737 |
| 200 | Ga0207662_10556988 | 3300025918 | Bacteria | 794 |
| 201 | Ga0207681_10173270 | 3300025923 | Bacteria | 1637 |
| 202 | Ga0207681_10246218 | 3300025923 | Bacteria | 1394 |
| 203 | Ga0207681_10329552 | 3300025923 | Bacteria | 1217 |
| 204 | Ga0207694_10775699 | 3300025924 | Bacteria | 809 |
| 205 | Ga0207650_10174178 | 3300025925 | Bacteria | 1712 |
| 206 | Ga0207650_11483572 | 3300025925 | Unclassified | 576 |
| 207 | Ga0207659_10003127 | 3300025926 | Bacteria | 9890 |
| 208 | Ga0207659_10167779 | 3300025926 | Bacteria | 1729 |
| 209 | Ga0207687_10189273 | 3300025927 | Bacteria | 1600 |
| 210 | Ga0207687_10401813 | 3300025927 | Unclassified | 1127 |
| 211 | Ga0207700_10389005 | 3300025928 | Unclassified | 1221 |
| 212 | Ga0207644_10008533 | 3300025931 | Bacteria | 6704 |
| 213 | Ga0207690_11129996 | 3300025932 | Unclassified | 653 |
| 214 | Ga0207706_10140717 | 3300025933 | Bacteria | 2123 |
| 215 | Ga0207670_10458748 | 3300025936 | Bacteria | 1028 |
| 216 | Ga0207670_10573266 | 3300025936 | Bacteria | 924 |
| 217 | Ga0207669_10001098 | 3300025937 | Bacteria | 11563 |
| 218 | Ga0207669_10017530 | 3300025937 | Bacteria | 3676 |
| 219 | Ga0207704_10001647 | 3300025938 | Bacteria | 10023 |
| 220 | Ga0207704_10016422 | 3300025938 | Bacteria | 3804 |
| 221 | Ga0207691_10000006 | 3300025940 | Bacteria | 161922 |
| 222 | Ga0207691_10001055 | 3300025940 | Bacteria | 27382 |
| 223 | Ga0207691_10002769 | 3300025940 | Bacteria | 17084 |
| 224 | Ga0207691_10230191 | 3300025940 | Bacteria | 1605 |
| 225 | Ga0207711_10171912 | 3300025941 | Bacteria | 1966 |
| 226 | Ga0207711_10176985 | 3300025941 | Bacteria | 1938 |
| 227 | Ga0207711_10306614 | 3300025941 | Bacteria | 1465 |
| 228 | Ga0207711_10353491 | 3300025941 | Bacteria | 1361 |
| 229 | Ga0207689_10001598 | 3300025942 | Bacteria | 21447 |
| 230 | Ga0207689_10055677 | 3300025942 | Bacteria | 3255 |
| 231 | Ga0207689_10247606 | 3300025942 | Bacteria | 1474 |
| 232 | Ga0207689_10294111 | 3300025942 | Bacteria | 1345 |
| 233 | Ga0207689_10383675 | 3300025942 | Bacteria | 1170 |
| 234 | Ga0207689_10910751 | 3300025942 | Bacteria | 742 |
| 235 | Ga0207689_11770871 | 3300025942 | Bacteria | 510 |
| 236 | Ga0207651_10074667 | 3300025960 | Bacteria | 2415 |
| 237 | Ga0207651_10093255 | 3300025960 | Bacteria | 2210 |
| 238 | Ga0207651_10137611 | 3300025960 | Bacteria | 1881 |
| 239 | Ga0207668_10005508 | 3300025972 | Bacteria | 7463 |
| 240 | Ga0207640_10203493 | 3300025981 | Bacteria | 1502 |
| 241 | Ga0207640_10328064 | 3300025981 | Bacteria | 1221 |
| 242 | Ga0207658_10046027 | 3300025986 | Bacteria | 3183 |
| 243 | Ga0207658_10263501 | 3300025986 | Bacteria | 1470 |
| 244 | Ga0207658_10411556 | 3300025986 | Bacteria | 1190 |
| 245 | Ga0207677_10000069 | 3300026023 | Bacteria | 85177 |
| 246 | Ga0207677_10023297 | 3300026023 | Bacteria | 3822 |
| 247 | Ga0207703_10012059 | 3300026035 | Bacteria | 6734 |
| 248 | Ga0207703_10364321 | 3300026035 | Bacteria | 1334 |
| 249 | Ga0207703_10402062 | 3300026035 | Bacteria | 1271 |
| 250 | Ga0207703_10531454 | 3300026035 | Bacteria | 1107 |
| 251 | Ga0207639_10005406 | 3300026041 | Bacteria | 8640 |
| 252 | Ga0207639_10143158 | 3300026041 | Bacteria | 1994 |
| 253 | Ga0207639_10343845 | 3300026041 | Bacteria | 1331 |
| 254 | Ga0207708_10069939 | 3300026075 | Bacteria | 2688 |
| 255 | Ga0207641_10001705 | 3300026088 | Bacteria | 21390 |
| 256 | Ga0207641_10024731 | 3300026088 | Bacteria | 4951 |
| 257 | Ga0207641_10800363 | 3300026088 | Bacteria | 932 |
| 258 | Ga0207641_11242138 | 3300026088 | Bacteria | 745 |
| 259 | Ga0207648_10003315 | 3300026089 | Bacteria | 16908 |
| 260 | Ga0207648_10121092 | 3300026089 | Bacteria | 2301 |
| 261 | Ga0207648_10125362 | 3300026089 | Bacteria | 2259 |
| 262 | Ga0207676_10000008 | 3300026095 | Bacteria | 588913 |
| 263 | Ga0207676_10002144 | 3300026095 | Bacteria | 14263 |
| 264 | Ga0207676_10021291 | 3300026095 | Bacteria | 4756 |
| 265 | Ga0207676_10541961 | 3300026095 | Bacteria | 1110 |
| 266 | Ga0207676_12544277 | 3300026095 | Bacteria | 508 |
| 267 | Ga0207674_10054186 | 3300026116 | Bacteria | 4084 |
| 268 | Ga0207674_10088969 | 3300026116 | Bacteria | 3080 |
| 269 | Ga0207675_100001670 | 3300026118 | Bacteria | 22199 |
| 270 | Ga0207675_100104972 | 3300026118 | Bacteria | 2663 |
| 271 | Ga0207675_100124979 | 3300026118 | Bacteria | 2436 |
| 272 | Ga0207675_100148786 | 3300026118 | Bacteria | 2228 |
| 273 | Ga0207675_100158126 | 3300026118 | Bacteria | 2160 |
| 274 | Ga0207675_102351720 | 3300026118 | Bacteria | 546 |
| 275 | Ga0207683_10000250 | 3300026121 | Bacteria | 48026 |
| 276 | Ga0207683_10000853 | 3300026121 | Bacteria | 27981 |
| 277 | Ga0207683_10057077 | 3300026121 | Bacteria | 3427 |
| 278 | Ga0207698_10003568 | 3300026142 | Bacteria | 9386 |
| 279 | Ga0209282_1375077 | 3300027666 | Bacteria | 570 |
| 280 | Ga0207428_10089355 | 3300027907 | Bacteria | 2394 |
| 281 | Ga0207428_10299392 | 3300027907 | Unclassified | 1190 |
| 282 | Ga0268266_10060333 | 3300028379 | Bacteria | 3269 |
| 283 | Ga0268266_10202235 | 3300028379 | Bacteria | 1818 |
| 284 | Ga0268266_10853862 | 3300028379 | Bacteria | 880 |
| 285 | Ga0268265_10230416 | 3300028380 | Bacteria | 1628 |
| 286 | Ga0268264_10879234 | 3300028381 | Bacteria | 898 |
| 287 | Ga0268264_12507292 | 3300028381 | Bacteria | 521 |
| 288 | Ga0307517_10101294 | 3300028786 | Bacteria | 2268 |
| 289 | Ga0307517_10117953 | 3300028786 | Bacteria | 1978 |
| 290 | Ga0307517_10164912 | 3300028786 | Bacteria | 1475 |
| 291 | Ga0307513_10117936 | 3300031456 | Bacteria | 2630 |
| 292 | Ga0307513_10217539 | 3300031456 | Bacteria | 1735 |
| 293 | Ga0307513_10352818 | 3300031456 | Unclassified | 1218 |
| 294 | Ga0307408_100188519 | 3300031548 | Bacteria | 1659 |
| 295 | Ga0316575_10019694 | 3300031665 | Bacteria | 2583 |
| 296 | Ga0316579_10316602 | 3300031691 | Bacteria | 754 |
| 297 | Ga0316578_10484401 | 3300031728 | Bacteria | 729 |
| 298 | Ga0307516_10022871 | 3300031730 | Bacteria | 6415 |
| 299 | Ga0307516_10777577 | 3300031730 | Bacteria | 618 |
| 300 | Ga0316577_10256301 | 3300031733 | Bacteria | 990 |
| 301 | Ga0307413_11034812 | 3300031824 | Bacteria | 706 |
| 302 | Ga0307409_100466734 | 3300031995 | Bacteria | 1222 |
| 303 | Ga0307409_101964980 | 3300031995 | Bacteria | 614 |
| 304 | Ga0307416_102055419 | 3300032002 | Bacteria | 674 |
| 305 | Ga0307416_102369666 | 3300032002 | Bacteria | 631 |
| 306 | Ga0307414_10983780 | 3300032004 | Bacteria | 776 |
| 307 | Ga0307411_10717821 | 3300032005 | Bacteria | 872 |
| 308 | Ga0307415_100965271 | 3300032126 | Bacteria | 790 |
| 309 | Ga0307510_10218187 | 3300033180 | Bacteria | 1422 |
| 310 | Ga0373948_0008567 | 3300034817 | Bacteria | 1743 |
| 311 | Ga0373950_0003111 | 3300034818 | Bacteria | 2345 |
| 312 | Ga0373940_0018466 | 3300035088 | Bacteria | 1750 |
| 313 | Ga0373951_0010198 | 3300035091 | Bacteria | 2109 |
| 314 | Ga0373939_0000090 | 3300035114 | Bacteria | 29085 |
| 315 | Ga0373945_0323885 | 3300035116 | Bacteria | 664 |
| 316 | Ga0373960_0001231 | 3300035121 | Bacteria | 5606 |
| 317 | Ga0373946_0527707 | 3300035171 | Bacteria | 607 |
| 318 | Ga0373961_0063068 | 3300035241 | Bacteria | 1129 |
| 319 | Ga0373931_0000516 | 3300035691 | Bacteria | 15816 |
| 320 | Ga0373937_0254405 | 3300036401 | Bacteria | 1656 |
| 321 | Ga0373937_0478882 | 3300036401 | Bacteria | 1182 |
| 322 | Ga0316582_0020819 | 3300036647 | Bacteria | 3864 |
| 323 | Ga0395900_0814271 | 3300037418 | Bacteria | 861 |
| 324 | Ga0395905_0287921 | 3300037471 | Bacteria | 1529 |
| 325 | Ga0316581_0004793 | 3300037588 | Bacteria | 3481 |
| 326 | Ga0450897_036166 | 3300042128 | Bacteria | 572 |
| 327 | Ga0451577_0094867 | 3300042876 | Unclassified | 2664 |
| 328 | Ga0451577_1676020 | 3300042876 | Bacteria | 560 |
| 329 | Ga0466969_0018161 | 3300044656 | Bacteria | 3667 |
| 330 | Ga0453683_0585936 | 3300044673 | Unclassified | 727 |
| 331 | Ga0466965_0130400 | 3300044683 | Bacteria | 1303 |
| 332 | Ga0466966_0222488 | 3300044684 | Bacteria | 1139 |
| 333 | Ga0466961_0145275 | 3300044693 | Bacteria | 1483 |
| 334 | Ga0466971_0025669 | 3300044719 | Bacteria | 2631 |
| 335 | Ga0466968_0266167 | 3300044735 | Bacteria | 817 |
| 336 | Ga0466968_0393391 | 3300044735 | Bacteria | 678 |
| 337 | Ga0466957_0040153 | 3300044842 | Bacteria | 2826 |
| 338 | Ga0466960_0006870 | 3300044901 | Bacteria | 4589 |
| 339 | Ga0466959_0031417 | 3300045049 | Bacteria | 3928 |
| 340 | Ga0451576_1771352 | 3300045051 | Bacteria | 639 |
| 341 | Ga0466967_1786487 | 3300045976 | Bacteria | 612 |
| 342 | Ga0495629_0073366 | 3300046459 | Bacteria | 2390 |
| 343 | Ga0495582_0285287 | 3300046473 | Bacteria | 948 |
| 344 | Ga0495605_0029015 | 3300046474 | Bacteria | 2852 |
| 345 | Ga0495594_0090716 | 3300046499 | Unclassified | 1712 |
| 346 | Ga0495583_0228919 | 3300046506 | Bacteria | 750 |
| 347 | Ga0495608_0630071 | 3300046511 | Bacteria | 642 |
| 348 | Ga0495610_0088163 | 3300046512 | Bacteria | 1411 |
| 349 | Ga0495620_0088133 | 3300046515 | Bacteria | 1248 |
| 350 | Ga0495628_0437154 | 3300046516 | Bacteria | 952 |
| 351 | Ga0495630_0326271 | 3300046517 | Bacteria | 1174 |
| 352 | Ga0495630_0708580 | 3300046517 | Bacteria | 770 |
| 353 | Ga0495631_0054785 | 3300046518 | Bacteria | 1738 |
| 354 | Ga0495632_0003106 | 3300046519 | Bacteria | 12035 |
| 355 | Ga0495642_0424659 | 3300046528 | Bacteria | 587 |
| 356 | Ga0495598_0015034 | 3300046537 | Bacteria | 1945 |
| 357 | Ga0495609_0044876 | 3300046538 | Bacteria | 1982 |
| 358 | Ga0495621_0015517 | 3300046539 | Bacteria | 2430 |
| 359 | Ga0495597_0059365 | 3300046542 | Bacteria | 1670 |
| 360 | Ga0495597_0187811 | 3300046542 | Bacteria | 832 |
| 361 | Ga0495645_0087358 | 3300046543 | Bacteria | 2231 |
| 362 | Ga0495668_0052296 | 3300046616 | Bacteria | 2260 |
| 363 | Ga0495611_0067112 | 3300046648 | Bacteria | 1637 |
| 364 | Ga0495625_0023869 | 3300046660 | Bacteria | 4665 |
| 365 | Ga0495647_0393362 | 3300046681 | Bacteria | 636 |
| 366 | Ga0495658_0000385 | 3300046683 | Bacteria | 24814 |
| 367 | Ga0495658_0132765 | 3300046683 | Bacteria | 1517 |
| 368 | Ga0495658_0470861 | 3300046683 | Bacteria | 803 |
| 369 | Ga0495671_0180926 | 3300046692 | Bacteria | 1024 |
| 370 | Ga0495649_0008052 | 3300046694 | Bacteria | 6366 |
| 371 | Ga0495660_0043232 | 3300046810 | Bacteria | 2486 |
| 372 | Ga0495581_0247038 | 3300047315 | Bacteria | 1043 |
| 373 | Ga0495674_1426102 | 3300047319 | Bacteria | 515 |
| 374 | Ga0495672_0183233 | 3300047320 | Bacteria | 1059 |
| 375 | Ga0495687_001446 | 3300047443 | Bacteria | 21795 |
| 376 | Ga0495626_0205376 | 3300048091 | Bacteria | 806 |
| 377 | Ga0496100_0282514 | 3300048903 | Bacteria | 1238 |
| 378 | Ga0496104_0025922 | 3300048907 | Bacteria | 5407 |
| 379 | Ga0496106_0785255 | 3300048909 | Bacteria | 756 |
| 380 | Ga0496107_0077713 | 3300048910 | Bacteria | 2418 |
| 381 | Ga0496107_0485869 | 3300048910 | Unclassified | 916 |
| 382 | Ga0496108_1418325 | 3300048911 | Bacteria | 580 |
| 383 | Ga0496109_0853975 | 3300048912 | Bacteria | 848 |
| 384 | Ga0496109_1337561 | 3300048912 | Bacteria | 652 |
| 385 | Ga0496112_0139084 | 3300048915 | Bacteria | 2397 |
| 386 | Ga0496113_0985216 | 3300048916 | Bacteria | 664 |
| 387 | Ga0496114_0163829 | 3300048917 | Bacteria | 1935 |
| 388 | Ga0496115_0194295 | 3300048918 | Bacteria | 1677 |
| 389 | Ga0495678_188748 | 3300049459 | Bacteria | 642 |
| 390 | Ga0501291_014467 | 3300049514 | Bacteria | 1181 |
| 391 | Ga0501298_113555 | 3300049521 | Bacteria | 631 |
| 392 | Ga0501300_000731 | 3300049523 | Bacteria | 4932 |
| 393 | Ga0501032_0387269 | 3300049569 | Bacteria | 899 |
| 394 | Ga0501033_0000565 | 3300049570 | Bacteria | 34468 |
| 395 | Ga0501034_0000641 | 3300049571 | Bacteria | 54300 |
| 396 | Ga0501034_0093094 | 3300049571 | Bacteria | 3010 |
| 397 | Ga0501034_0173008 | 3300049571 | Bacteria | 2126 |
| 398 | Ga0501042_0504105 | 3300049578 | Bacteria | 879 |
| 399 | Ga0501043_0287146 | 3300049579 | Bacteria | 1260 |
| 400 | Ga0501046_0652436 | 3300049580 | Unclassified | 744 |
| 401 | Ga0501067_0015456 | 3300049583 | Bacteria | 4226 |
| 402 | Ga0501068_0043891 | 3300049584 | Bacteria | 2690 |
| 403 | Ga0501069_0916437 | 3300049585 | Bacteria | 533 |
| 404 | Ga0501071_0001676 | 3300049587 | Bacteria | 12997 |
| 405 | Ga0501071_0270049 | 3300049587 | Bacteria | 1286 |
| 406 | Ga0501072_0002048 | 3300049588 | Bacteria | 14991 |
| 407 | Ga0501072_0024636 | 3300049588 | Bacteria | 4684 |
| 408 | Ga0501072_0112710 | 3300049588 | Bacteria | 2165 |
| 409 | Ga0501073_0170098 | 3300049589 | Bacteria | 1508 |
| 410 | Ga0501074_0032109 | 3300049590 | Bacteria | 3805 |
| 411 | Ga0501074_0206226 | 3300049590 | Bacteria | 1401 |
| 412 | Ga0501075_0043235 | 3300049591 | Bacteria | 3379 |
| 413 | Ga0501077_0002804 | 3300049593 | Bacteria | 10456 |
| 414 | Ga0501249_043842 | 3300049679 | Bacteria | 1018 |
| 415 | Ga0501079_0000604 | 3300049741 | Bacteria | 23816 |
| 416 | Ga0501080_0015536 | 3300049742 | Bacteria | 7020 |
| 417 | Ga0501080_0365859 | 3300049742 | Bacteria | 1301 |
| 418 | Ga0501080_0370346 | 3300049742 | Bacteria | 1292 |
| 419 | Ga0501081_0223917 | 3300049743 | Bacteria | 1368 |
| 420 | Ga0501081_0784888 | 3300049743 | Bacteria | 717 |
| 421 | Ga0501267_000112 | 3300049764 | Bacteria | 5182 |
| 422 | Ga0501272_068161 | 3300049769 | Bacteria | 517 |
| 423 | nmdc:mga03683_155105_c1 | 3300050489 | Unclassified | 1035 |
| 424 | nmdc:mga03683_3760_c2 | 3300050489 | Bacteria | 2804 |
| 425 | nmdc:mga03n38_3563_c1 | 3300050490 | Bacteria | 5026 |
| 426 | nmdc:mga0yw44_649312_c1 | 3300050492 | Unclassified | 717 |
| 427 | nmdc:mga0k408_3106_c1 | 3300050493 | Bacteria | 8801 |
| 428 | nmdc:mga0k408_737755_c1 | 3300050493 | Bacteria | 576 |
| 429 | nmdc:mga06z11_113893_c1 | 3300050494 | Bacteria | 1501 |
| 430 | nmdc:mga06z11_11937_c1 | 3300050494 | Bacteria | 2903 |
| 431 | nmdc:mga07m45_1462_c1 | 3300050496 | Bacteria | 10840 |
| 432 | nmdc:mga07m45_31227_c1 | 3300050496 | Bacteria | 2952 |
| 433 | nmdc:mga05p37_1235464_c1 | 3300050507 | Unclassified | 768 |
| 434 | nmdc:mga09592_224899_c1 | 3300050508 | Unclassified | 1626 |
| 435 | nmdc:mga0qj67_113690_c1 | 3300050509 | Bacteria | 2186 |
| 436 | nmdc:mga0qj67_1183511_c1 | 3300050509 | Bacteria | 595 |
| 437 | nmdc:mga06r32_334030_c1 | 3300050510 | Bacteria | 1500 |
| 438 | nmdc:mga08y16_1739212_c1 | 3300050511 | Bacteria | 578 |
| 439 | nmdc:mga08y16_180307_c1 | 3300050511 | Unclassified | 2193 |
| 440 | nmdc:mga08y16_1859_c1 | 3300050511 | Bacteria | 21453 |
| 441 | nmdc:mga0rr50_116593_c1 | 3300050513 | Bacteria | 2120 |
| 442 | nmdc:mga0a205_1537993_c1 | 3300050515 | Bacteria | 513 |
| 443 | nmdc:mga0sz30_42222_c2 | 3300050516 | Bacteria | 989 |
| 444 | nmdc:mga0sz30_6858_c1 | 3300050516 | Bacteria | 4251 |
| 445 | Ga0500578_0464471 | 3300053086 | Bacteria | 718 |
| 446 | Ga0500650_0247802 | 3300053098 | Bacteria | 800 |
| 447 | Ga0500658_0002629 | 3300053134 | Bacteria | 6916 |
| 448 | Ga0500568_0025639 | 3300053139 | Bacteria | 2484 |
| 449 | Ga0500577_0392122 | 3300053142 | Unclassified | 607 |
| 450 | Ga0501084_0023787 | 3300054114 | Bacteria | 5109 |
| 451 | Ga0501082_0117575 | 3300060353 | Bacteria | 2303 |
| 452 | Ga0466962_0003292 | 3300061719 | Bacteria | 7676 |
| 453 | Ga0466962_0111224 | 3300061719 | Bacteria | 1319 |
| 454 | Ga0530510_0366055 | 3300061734 | Bacteria | 1084 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044735 | Ga0466968_0266167 | Ga0466968_0266167_411_755 | 113 |
| 2 | 3300046683 | Ga0495658_0000385 | Ga0495658_0000385_24104_24490 | 115 |
| 3 | 3300028380 | Ga0268265_10230416 | Ga0268265_102304163 | 116 |
| 4 | 3300046511 | Ga0495608_0630071 | Ga0495608_0630071_193_582 | 116 |
| 5 | 3300046517 | Ga0495630_0708580 | Ga0495630_0708580_109_498 | 116 |
| 6 | 3300005617 | Ga0068859_101042424 | Ga0068859_1010424242 | 117 |
| 7 | 3300005840 | Ga0068870_10224121 | Ga0068870_102241212 | 117 |
| 8 | 3300006931 | Ga0097620_101042312 | Ga0097620_1010423122 | 117 |
| 9 | 3300014326 | Ga0157380_10665009 | Ga0157380_106650092 | 117 |
| 10 | 3300049743 | Ga0501081_0784888 | Ga0501081_0784888_112_501 | 118 |
| 11 | 3300049588 | Ga0501072_0024636 | Ga0501072_0024636_1409_1795 | 119 |
| 12 | 3300049590 | Ga0501074_0206226 | Ga0501074_0206226_584_970 | 119 |
| 13 | 3300049591 | Ga0501075_0043235 | Ga0501075_0043235_1035_1421 | 119 |
| 14 | 3300049742 | Ga0501080_0370346 | Ga0501080_0370346_768_1154 | 119 |
| 15 | 3300050509 | nmdc:mga0qj67_113690_c1 | nmdc:mga0qj67_113690_c1_1759_2118 | 119 |
| 16 | 3300046660 | Ga0495625_0023869 | Ga0495625_0023869_2640_3008 | 121 |
| 17 | 3300005293 | Ga0065715_10129151 | Ga0065715_101291512 | 123 |
| 18 | 3300005618 | Ga0068864_100000046 | Ga0068864_10000004657 | 123 |
| 19 | 3300026095 | Ga0207676_10000008 | Ga0207676_10000008251 | 123 |
| 20 | 3300046459 | Ga0495629_0073366 | Ga0495629_0073366_1876_2247 | 123 |
| 21 | 3300046683 | Ga0495658_0132765 | Ga0495658_0132765_764_1135 | 123 |
| 22 | iso_pu_bacteria | 2643221559 | 2643815737 | 124 |
| 23 | iso_pu_bacteria | 2643221586 | 2643940758 | 124 |
| 24 | iso_pu_bacteria | 2643221612 | 2644080195 | 124 |
| 25 | iso_pu_bacteria | 2643221727 | 2644695791 | 124 |
| 26 | iso_pu_bacteria | 2904615490 | 2904622589 | 124 |
| 27 | iso_pu_bacteria | 642555112 | 642597120 | 124 |
| 28 | 3300014326 | Ga0157380_11052233 | Ga0157380_110522332 | 127 |
| 29 | 3300025936 | Ga0207670_10573266 | Ga0207670_105732662 | 127 |
| 30 | 3300003323 | rootH1_10170785 | rootH1_101707855 | 128 |
| 31 | 3300005328 | Ga0070676_10207221 | Ga0070676_102072212 | 128 |
| 32 | 3300005333 | Ga0070677_10004666 | Ga0070677_100046662 | 128 |
| 33 | 3300005334 | Ga0068869_100061399 | Ga0068869_1000613993 | 128 |
| 34 | 3300005334 | Ga0068869_100072884 | Ga0068869_1000728845 | 128 |
| 35 | 3300005334 | Ga0068869_100296523 | Ga0068869_1002965231 | 128 |
| 36 | 3300005334 | Ga0068869_100380109 | Ga0068869_1003801092 | 128 |
| 37 | 3300005335 | Ga0070666_10004385 | Ga0070666_1000438513 | 128 |
| 38 | 3300005335 | Ga0070666_10013781 | Ga0070666_100137815 | 128 |
| 39 | 3300005335 | Ga0070666_10785047 | Ga0070666_107850472 | 128 |
| 40 | 3300005336 | Ga0070680_100375561 | Ga0070680_1003755612 | 128 |
| 41 | 3300005338 | Ga0068868_100004933 | Ga0068868_1000049334 | 128 |
| 42 | 3300005338 | Ga0068868_100008290 | Ga0068868_1000082904 | 128 |
| 43 | 3300005338 | Ga0068868_100011587 | Ga0068868_1000115879 | 128 |
| 44 | 3300005340 | Ga0070689_100027465 | Ga0070689_1000274654 | 128 |
| 45 | 3300005340 | Ga0070689_100140067 | Ga0070689_1001400672 | 128 |
| 46 | 3300005340 | Ga0070689_100553996 | Ga0070689_1005539962 | 128 |
| 47 | 3300005347 | Ga0070668_100003653 | Ga0070668_1000036536 | 128 |
| 48 | 3300005347 | Ga0070668_100025295 | Ga0070668_1000252955 | 128 |
| 49 | 3300005353 | Ga0070669_100187494 | Ga0070669_1001874942 | 128 |
| 50 | 3300005353 | Ga0070669_100298271 | Ga0070669_1002982713 | 128 |
| 51 | 3300005354 | Ga0070675_100008171 | Ga0070675_10000817112 | 128 |
| 52 | 3300005354 | Ga0070675_100008971 | Ga0070675_1000089714 | 128 |
| 53 | 3300005355 | Ga0070671_100002283 | Ga0070671_1000022835 | 128 |
| 54 | 3300005356 | Ga0070674_100001737 | Ga0070674_1000017372 | 128 |
| 55 | 3300005356 | Ga0070674_100042754 | Ga0070674_1000427543 | 128 |
| 56 | 3300005364 | Ga0070673_100000414 | Ga0070673_1000004147 | 128 |
| 57 | 3300005364 | Ga0070673_100024254 | Ga0070673_1000242542 | 128 |
| 58 | 3300005364 | Ga0070673_100052622 | Ga0070673_1000526225 | 128 |
| 59 | 3300005364 | Ga0070673_100075977 | Ga0070673_1000759774 | 128 |
| 60 | 3300005365 | Ga0070688_100007290 | Ga0070688_1000072904 | 128 |
| 61 | 3300005365 | Ga0070688_100734963 | Ga0070688_1007349631 | 128 |
| 62 | 3300005366 | Ga0070659_101417061 | Ga0070659_1014170612 | 128 |
| 63 | 3300005367 | Ga0070667_100004577 | Ga0070667_10000457721 | 128 |
| 64 | 3300005367 | Ga0070667_100112213 | Ga0070667_1001122133 | 128 |
| 65 | 3300005367 | Ga0070667_100268791 | Ga0070667_1002687912 | 128 |
| 66 | 3300005367 | Ga0070667_101020152 | Ga0070667_1010201522 | 128 |
| 67 | 3300005441 | Ga0070700_100473709 | Ga0070700_1004737092 | 128 |
| 68 | 3300005441 | Ga0070700_100706468 | Ga0070700_1007064681 | 128 |
| 69 | 3300005445 | Ga0070708_100355629 | Ga0070708_1003556293 | 128 |
| 70 | 3300005455 | Ga0070663_100040669 | Ga0070663_1000406694 | 128 |
| 71 | 3300005456 | Ga0070678_100034195 | Ga0070678_1000341953 | 128 |
| 72 | 3300005456 | Ga0070678_100039661 | Ga0070678_1000396614 | 128 |
| 73 | 3300005456 | Ga0070678_100326234 | Ga0070678_1003262342 | 128 |
| 74 | 3300005457 | Ga0070662_100048909 | Ga0070662_1000489095 | 128 |
| 75 | 3300005459 | Ga0068867_100004322 | Ga0068867_10000432213 | 128 |
| 76 | 3300005459 | Ga0068867_100005598 | Ga0068867_10000559815 | 128 |
| 77 | 3300005466 | Ga0070685_10077459 | Ga0070685_100774592 | 128 |
| 78 | 3300005466 | Ga0070685_10316219 | Ga0070685_103162191 | 128 |
| 79 | 3300005539 | Ga0068853_100005722 | Ga0068853_1000057222 | 128 |
| 80 | 3300005539 | Ga0068853_100393387 | Ga0068853_1003933872 | 128 |
| 81 | 3300005539 | Ga0068853_101317664 | Ga0068853_1013176642 | 128 |
| 82 | 3300005543 | Ga0070672_100009932 | Ga0070672_1000099328 | 128 |
| 83 | 3300005543 | Ga0070672_100218937 | Ga0070672_1002189372 | 128 |
| 84 | 3300005545 | Ga0070695_100290450 | Ga0070695_1002904503 | 128 |
| 85 | 3300005546 | Ga0070696_100309538 | Ga0070696_1003095382 | 128 |
| 86 | 3300005548 | Ga0070665_100042494 | Ga0070665_1000424946 | 128 |
| 87 | 3300005548 | Ga0070665_100060912 | Ga0070665_1000609123 | 128 |
| 88 | 3300005548 | Ga0070665_100124742 | Ga0070665_1001247422 | 128 |
| 89 | 3300005548 | Ga0070665_100341078 | Ga0070665_1003410782 | 128 |
| 90 | 3300005549 | Ga0070704_100768538 | Ga0070704_1007685382 | 128 |
| 91 | 3300005549 | Ga0070704_100898897 | Ga0070704_1008988972 | 128 |
| 92 | 3300005577 | Ga0068857_100425098 | Ga0068857_1004250982 | 128 |
| 93 | 3300005615 | Ga0070702_101155614 | Ga0070702_1011556141 | 128 |
| 94 | 3300005616 | Ga0068852_100156332 | Ga0068852_1001563323 | 128 |
| 95 | 3300005617 | Ga0068859_100025433 | Ga0068859_1000254332 | 128 |
| 96 | 3300005617 | Ga0068859_100648383 | Ga0068859_1006483832 | 128 |
| 97 | 3300005618 | Ga0068864_100003522 | Ga0068864_10000352217 | 128 |
| 98 | 3300005618 | Ga0068864_100004730 | Ga0068864_10000473011 | 128 |
| 99 | 3300005618 | Ga0068864_100143009 | Ga0068864_1001430092 | 128 |
| 100 | 3300005719 | Ga0068861_100020784 | Ga0068861_1000207842 | 128 |
| 101 | 3300005719 | Ga0068861_100031275 | Ga0068861_1000312754 | 128 |
| 102 | 3300005719 | Ga0068861_100090966 | Ga0068861_1000909662 | 128 |
| 103 | 3300005719 | Ga0068861_100152102 | Ga0068861_1001521025 | 128 |
| 104 | 3300005719 | Ga0068861_100352945 | Ga0068861_1003529454 | 128 |
| 105 | 3300005719 | Ga0068861_101272997 | Ga0068861_1012729972 | 128 |
| 106 | 3300005834 | Ga0068851_10000963 | Ga0068851_1000096313 | 128 |
| 107 | 3300005840 | Ga0068870_10029085 | Ga0068870_100290853 | 128 |
| 108 | 3300005840 | Ga0068870_10337103 | Ga0068870_103371032 | 128 |
| 109 | 3300005841 | Ga0068863_100003538 | Ga0068863_10000353819 | 128 |
| 110 | 3300005841 | Ga0068863_100014047 | Ga0068863_10001404712 | 128 |
| 111 | 3300005841 | Ga0068863_101538988 | Ga0068863_1015389881 | 128 |
| 112 | 3300005841 | Ga0068863_101577344 | Ga0068863_1015773442 | 128 |
| 113 | 3300005842 | Ga0068858_100056047 | Ga0068858_1000560473 | 128 |
| 114 | 3300005842 | Ga0068858_100057670 | Ga0068858_1000576704 | 128 |
| 115 | 3300005842 | Ga0068858_100649057 | Ga0068858_1006490571 | 128 |
| 116 | 3300005843 | Ga0068860_100002164 | Ga0068860_10000216423 | 128 |
| 117 | 3300005843 | Ga0068860_100515606 | Ga0068860_1005156061 | 128 |
| 118 | 3300005843 | Ga0068860_102570797 | Ga0068860_1025707971 | 128 |
| 119 | 3300005844 | Ga0068862_100380708 | Ga0068862_1003807083 | 128 |
| 120 | 3300006042 | Ga0075368_10327983 | Ga0075368_103279831 | 128 |
| 121 | 3300006048 | Ga0075363_100011486 | Ga0075363_1000114866 | 128 |
| 122 | 3300006051 | Ga0075364_10322441 | Ga0075364_103224412 | 128 |
| 123 | 3300006177 | Ga0075362_10020687 | Ga0075362_100206872 | 128 |
| 124 | 3300006178 | Ga0075367_10003340 | Ga0075367_1000334011 | 128 |
| 125 | 3300006178 | Ga0075367_10593146 | Ga0075367_105931462 | 128 |
| 126 | 3300006186 | Ga0075369_10013614 | Ga0075369_100136141 | 128 |
| 127 | 3300006186 | Ga0075369_10068668 | Ga0075369_100686682 | 128 |
| 128 | 3300006194 | Ga0075427_10041461 | Ga0075427_100414611 | 128 |
| 129 | 3300006195 | Ga0075366_10072882 | Ga0075366_100728823 | 128 |
| 130 | 3300006195 | Ga0075366_10101992 | Ga0075366_101019922 | 128 |
| 131 | 3300006195 | Ga0075366_10127633 | Ga0075366_101276333 | 128 |
| 132 | 3300006195 | Ga0075366_10246569 | Ga0075366_102465692 | 128 |
| 133 | 3300006195 | Ga0075366_10843438 | Ga0075366_108434382 | 128 |
| 134 | 3300006195 | Ga0075366_11074172 | Ga0075366_110741721 | 128 |
| 135 | 3300006237 | Ga0097621_100071436 | Ga0097621_1000714363 | 128 |
| 136 | 3300006237 | Ga0097621_100258906 | Ga0097621_1002589062 | 128 |
| 137 | 3300006237 | Ga0097621_100269370 | Ga0097621_1002693702 | 128 |
| 138 | 3300006237 | Ga0097621_101868698 | Ga0097621_1018686982 | 128 |
| 139 | 3300006353 | Ga0075370_10002789 | Ga0075370_100027898 | 128 |
| 140 | 3300006353 | Ga0075370_10027526 | Ga0075370_100275264 | 128 |
| 141 | 3300006353 | Ga0075370_10039911 | Ga0075370_100399113 | 128 |
| 142 | 3300006353 | Ga0075370_10074024 | Ga0075370_100740244 | 128 |
| 143 | 3300006353 | Ga0075370_10892543 | Ga0075370_108925432 | 128 |
| 144 | 3300006358 | Ga0068871_100110972 | Ga0068871_1001109722 | 128 |
| 145 | 3300006358 | Ga0068871_100117282 | Ga0068871_1001172823 | 128 |
| 146 | 3300006358 | Ga0068871_100300819 | Ga0068871_1003008192 | 128 |
| 147 | 3300006358 | Ga0068871_100565308 | Ga0068871_1005653082 | 128 |
| 148 | 3300006844 | Ga0075428_100000133 | Ga0075428_10000013339 | 128 |
| 149 | 3300006844 | Ga0075428_100051798 | Ga0075428_1000517982 | 128 |
| 150 | 3300006844 | Ga0075428_100114848 | Ga0075428_1001148484 | 128 |
| 151 | 3300006844 | Ga0075428_100965143 | Ga0075428_1009651432 | 128 |
| 152 | 3300006846 | Ga0075430_100141658 | Ga0075430_1001416582 | 128 |
| 153 | 3300006846 | Ga0075430_101425893 | Ga0075430_1014258932 | 128 |
| 154 | 3300006847 | Ga0075431_100244486 | Ga0075431_1002444862 | 128 |
| 155 | 3300006880 | Ga0075429_101054404 | Ga0075429_1010544042 | 128 |
| 156 | 3300006881 | Ga0068865_100101685 | Ga0068865_1001016853 | 128 |
| 157 | 3300006881 | Ga0068865_100131619 | Ga0068865_1001316194 | 128 |
| 158 | 3300006881 | Ga0068865_101085519 | Ga0068865_1010855191 | 128 |
| 159 | 3300006931 | Ga0097620_100025432 | Ga0097620_10002543211 | 128 |
| 160 | 3300006931 | Ga0097620_100155782 | Ga0097620_1001557825 | 128 |
| 161 | 3300006931 | Ga0097620_100648525 | Ga0097620_1006485252 | 128 |
| 162 | 3300006948 | Ga0099826_10457401 | Ga0099826_104574011 | 128 |
| 163 | 3300009011 | Ga0105251_10158598 | Ga0105251_101585981 | 128 |
| 164 | 3300009093 | Ga0105240_10130469 | Ga0105240_101304692 | 128 |
| 165 | 3300009093 | Ga0105240_12173381 | Ga0105240_121733811 | 128 |
| 166 | 3300009094 | Ga0111539_10000654 | Ga0111539_1000065439 | 128 |
| 167 | 3300009094 | Ga0111539_10322958 | Ga0111539_103229584 | 128 |
| 168 | 3300009098 | Ga0105245_10247432 | Ga0105245_102474325 | 128 |
| 169 | 3300009098 | Ga0105245_10339284 | Ga0105245_103392842 | 128 |
| 170 | 3300009098 | Ga0105245_11082615 | Ga0105245_110826151 | 128 |
| 171 | 3300009101 | Ga0105247_10021490 | Ga0105247_100214902 | 128 |
| 172 | 3300009147 | Ga0114129_11061071 | Ga0114129_110610712 | 128 |
| 173 | 3300009148 | Ga0105243_10024169 | Ga0105243_100241693 | 128 |
| 174 | 3300009148 | Ga0105243_10478819 | Ga0105243_104788193 | 128 |
| 175 | 3300009177 | Ga0105248_10003651 | Ga0105248_100036514 | 128 |
| 176 | 3300009177 | Ga0105248_10019374 | Ga0105248_100193746 | 128 |
| 177 | 3300009177 | Ga0105248_10078334 | Ga0105248_100783342 | 128 |
| 178 | 3300009177 | Ga0105248_10555988 | Ga0105248_105559882 | 128 |
| 179 | 3300009545 | Ga0105237_10057642 | Ga0105237_100576425 | 128 |
| 180 | 3300009553 | Ga0105249_10047847 | Ga0105249_100478474 | 128 |
| 181 | 3300010375 | Ga0105239_10040126 | Ga0105239_100401267 | 128 |
| 182 | 3300010375 | Ga0105239_11167124 | Ga0105239_111671241 | 128 |
| 183 | 3300013296 | Ga0157374_10015238 | Ga0157374_100152382 | 128 |
| 184 | 3300013296 | Ga0157374_10034007 | Ga0157374_100340072 | 128 |
| 185 | 3300013297 | Ga0157378_10024746 | Ga0157378_1002474610 | 128 |
| 186 | 3300013297 | Ga0157378_10072118 | Ga0157378_100721182 | 128 |
| 187 | 3300013297 | Ga0157378_10519654 | Ga0157378_105196542 | 128 |
| 188 | 3300013306 | Ga0163162_10060010 | Ga0163162_100600109 | 128 |
| 189 | 3300013306 | Ga0163162_10068114 | Ga0163162_100681144 | 128 |
| 190 | 3300013308 | Ga0157375_10000991 | Ga0157375_1000099119 | 128 |
| 191 | 3300013308 | Ga0157375_10382621 | Ga0157375_103826212 | 128 |
| 192 | 3300013308 | Ga0157375_10501963 | Ga0157375_105019632 | 128 |
| 193 | 3300014325 | Ga0163163_10029012 | Ga0163163_100290128 | 128 |
| 194 | 3300014325 | Ga0163163_10479608 | Ga0163163_104796083 | 128 |
| 195 | 3300014326 | Ga0157380_10036291 | Ga0157380_100362915 | 128 |
| 196 | 3300014326 | Ga0157380_10177359 | Ga0157380_101773593 | 128 |
| 197 | 3300014326 | Ga0157380_10271386 | Ga0157380_102713863 | 128 |
| 198 | 3300014326 | Ga0157380_10308298 | Ga0157380_103082983 | 128 |
| 199 | 3300014745 | Ga0157377_10555550 | Ga0157377_105555502 | 128 |
| 200 | 3300014968 | Ga0157379_10004507 | Ga0157379_1000450717 | 128 |
| 201 | 3300014969 | Ga0157376_10050766 | Ga0157376_100507663 | 128 |
| 202 | 3300015689 | Ga0183360_10001 | Ga0183360_10001525 | 128 |
| 203 | 3300017792 | Ga0163161_10087328 | Ga0163161_100873283 | 128 |
| 204 | 3300017792 | Ga0163161_10224674 | Ga0163161_102246743 | 128 |
| 205 | 3300025263 | Ga0209565_1002300 | Ga0209565_10023008 | 128 |
| 206 | 3300025315 | Ga0207697_10006798 | Ga0207697_100067982 | 128 |
| 207 | 3300025315 | Ga0207697_10030017 | Ga0207697_100300172 | 128 |
| 208 | 3300025321 | Ga0207656_10002949 | Ga0207656_100029492 | 128 |
| 209 | 3300025893 | Ga0207682_10001173 | Ga0207682_100011734 | 128 |
| 210 | 3300025893 | Ga0207682_10025400 | Ga0207682_100254004 | 128 |
| 211 | 3300025900 | Ga0207710_10010257 | Ga0207710_100102576 | 128 |
| 212 | 3300025903 | Ga0207680_10002438 | Ga0207680_1000243813 | 128 |
| 213 | 3300025907 | Ga0207645_10001033 | Ga0207645_100010335 | 128 |
| 214 | 3300025907 | Ga0207645_10091588 | Ga0207645_100915884 | 128 |
| 215 | 3300025907 | Ga0207645_10094272 | Ga0207645_100942724 | 128 |
| 216 | 3300025908 | Ga0207643_10081182 | Ga0207643_100811823 | 128 |
| 217 | 3300025908 | Ga0207643_10213078 | Ga0207643_102130783 | 128 |
| 218 | 3300025911 | Ga0207654_10661615 | Ga0207654_106616151 | 128 |
| 219 | 3300025913 | Ga0207695_10167703 | Ga0207695_101677032 | 128 |
| 220 | 3300025914 | Ga0207671_10018695 | Ga0207671_100186952 | 128 |
| 221 | 3300025917 | Ga0207660_10866612 | Ga0207660_108666122 | 128 |
| 222 | 3300025918 | Ga0207662_10556988 | Ga0207662_105569882 | 128 |
| 223 | 3300025923 | Ga0207681_10173270 | Ga0207681_101732702 | 128 |
| 224 | 3300025923 | Ga0207681_10246218 | Ga0207681_102462184 | 128 |
| 225 | 3300025923 | Ga0207681_10329552 | Ga0207681_103295522 | 128 |
| 226 | 3300025924 | Ga0207694_10775699 | Ga0207694_107756992 | 128 |
| 227 | 3300025925 | Ga0207650_10174178 | Ga0207650_101741783 | 128 |
| 228 | 3300025925 | Ga0207650_11483572 | Ga0207650_114835721 | 128 |
| 229 | 3300025926 | Ga0207659_10003127 | Ga0207659_1000312717 | 128 |
| 230 | 3300025926 | Ga0207659_10167779 | Ga0207659_101677792 | 128 |
| 231 | 3300025927 | Ga0207687_10189273 | Ga0207687_101892732 | 128 |
| 232 | 3300025927 | Ga0207687_10401813 | Ga0207687_104018132 | 128 |
| 233 | 3300025928 | Ga0207700_10389005 | Ga0207700_103890052 | 128 |
| 234 | 3300025931 | Ga0207644_10008533 | Ga0207644_100085338 | 128 |
| 235 | 3300025932 | Ga0207690_11129996 | Ga0207690_111299962 | 128 |
| 236 | 3300025933 | Ga0207706_10140717 | Ga0207706_101407173 | 128 |
| 237 | 3300025936 | Ga0207670_10458748 | Ga0207670_104587481 | 128 |
| 238 | 3300025937 | Ga0207669_10001098 | Ga0207669_100010985 | 128 |
| 239 | 3300025937 | Ga0207669_10017530 | Ga0207669_100175303 | 128 |
| 240 | 3300025938 | Ga0207704_10001647 | Ga0207704_1000164717 | 128 |
| 241 | 3300025938 | Ga0207704_10016422 | Ga0207704_100164225 | 128 |
| 242 | 3300025940 | Ga0207691_10000006 | Ga0207691_1000000636 | 128 |
| 243 | 3300025940 | Ga0207691_10001055 | Ga0207691_100010558 | 128 |
| 244 | 3300025940 | Ga0207691_10002769 | Ga0207691_100027696 | 128 |
| 245 | 3300025940 | Ga0207691_10230191 | Ga0207691_102301911 | 128 |
| 246 | 3300025941 | Ga0207711_10171912 | Ga0207711_101719124 | 128 |
| 247 | 3300025941 | Ga0207711_10176985 | Ga0207711_101769852 | 128 |
| 248 | 3300025941 | Ga0207711_10306614 | Ga0207711_103066142 | 128 |
| 249 | 3300025941 | Ga0207711_10353491 | Ga0207711_103534913 | 128 |
| 250 | 3300025942 | Ga0207689_10001598 | Ga0207689_1000159824 | 128 |
| 251 | 3300025942 | Ga0207689_10055677 | Ga0207689_100556776 | 128 |
| 252 | 3300025942 | Ga0207689_10247606 | Ga0207689_102476062 | 128 |
| 253 | 3300025942 | Ga0207689_10294111 | Ga0207689_102941112 | 128 |
| 254 | 3300025942 | Ga0207689_10383675 | Ga0207689_103836753 | 128 |
| 255 | 3300025942 | Ga0207689_10910751 | Ga0207689_109107512 | 128 |
| 256 | 3300025942 | Ga0207689_11770871 | Ga0207689_117708711 | 128 |
| 257 | 3300025960 | Ga0207651_10074667 | Ga0207651_100746673 | 128 |
| 258 | 3300025960 | Ga0207651_10093255 | Ga0207651_100932554 | 128 |
| 259 | 3300025960 | Ga0207651_10137611 | Ga0207651_101376112 | 128 |
| 260 | 3300025972 | Ga0207668_10005508 | Ga0207668_100055085 | 128 |
| 261 | 3300025981 | Ga0207640_10203493 | Ga0207640_102034934 | 128 |
| 262 | 3300025981 | Ga0207640_10328064 | Ga0207640_103280642 | 128 |
| 263 | 3300025986 | Ga0207658_10046027 | Ga0207658_100460272 | 128 |
| 264 | 3300025986 | Ga0207658_10263501 | Ga0207658_102635011 | 128 |
| 265 | 3300025986 | Ga0207658_10411556 | Ga0207658_104115562 | 128 |
| 266 | 3300026023 | Ga0207677_10000069 | Ga0207677_1000006947 | 128 |
| 267 | 3300026023 | Ga0207677_10023297 | Ga0207677_100232977 | 128 |
| 268 | 3300026035 | Ga0207703_10012059 | Ga0207703_100120597 | 128 |
| 269 | 3300026035 | Ga0207703_10364321 | Ga0207703_103643212 | 128 |
| 270 | 3300026035 | Ga0207703_10402062 | Ga0207703_104020622 | 128 |
| 271 | 3300026035 | Ga0207703_10531454 | Ga0207703_105314542 | 128 |
| 272 | 3300026041 | Ga0207639_10005406 | Ga0207639_1000540612 | 128 |
| 273 | 3300026041 | Ga0207639_10143158 | Ga0207639_101431584 | 128 |
| 274 | 3300026041 | Ga0207639_10343845 | Ga0207639_103438452 | 128 |
| 275 | 3300026075 | Ga0207708_10069939 | Ga0207708_100699396 | 128 |
| 276 | 3300026088 | Ga0207641_10001705 | Ga0207641_1000170526 | 128 |
| 277 | 3300026088 | Ga0207641_10024731 | Ga0207641_100247312 | 128 |
| 278 | 3300026088 | Ga0207641_10800363 | Ga0207641_108003632 | 128 |
| 279 | 3300026088 | Ga0207641_11242138 | Ga0207641_112421382 | 128 |
| 280 | 3300026089 | Ga0207648_10003315 | Ga0207648_100033156 | 128 |
| 281 | 3300026089 | Ga0207648_10121092 | Ga0207648_101210923 | 128 |
| 282 | 3300026089 | Ga0207648_10125362 | Ga0207648_101253623 | 128 |
| 283 | 3300026095 | Ga0207676_10002144 | Ga0207676_100021446 | 128 |
| 284 | 3300026095 | Ga0207676_10021291 | Ga0207676_100212916 | 128 |
| 285 | 3300026095 | Ga0207676_10541961 | Ga0207676_105419612 | 128 |
| 286 | 3300026095 | Ga0207676_12544277 | Ga0207676_125442771 | 128 |
| 287 | 3300026116 | Ga0207674_10054186 | Ga0207674_100541865 | 128 |
| 288 | 3300026116 | Ga0207674_10088969 | Ga0207674_100889692 | 128 |
| 289 | 3300026118 | Ga0207675_100001670 | Ga0207675_10000167022 | 128 |
| 290 | 3300026118 | Ga0207675_100104972 | Ga0207675_1001049724 | 128 |
| 291 | 3300026118 | Ga0207675_100124979 | Ga0207675_1001249792 | 128 |
| 292 | 3300026118 | Ga0207675_100148786 | Ga0207675_1001487864 | 128 |
| 293 | 3300026118 | Ga0207675_100158126 | Ga0207675_1001581263 | 128 |
| 294 | 3300026118 | Ga0207675_102351720 | Ga0207675_1023517201 | 128 |
| 295 | 3300026121 | Ga0207683_10000250 | Ga0207683_1000025027 | 128 |
| 296 | 3300026121 | Ga0207683_10000853 | Ga0207683_1000085317 | 128 |
| 297 | 3300026121 | Ga0207683_10057077 | Ga0207683_100570772 | 128 |
| 298 | 3300026142 | Ga0207698_10003568 | Ga0207698_1000356812 | 128 |
| 299 | 3300027666 | Ga0209282_1375077 | Ga0209282_13750772 | 128 |
| 300 | 3300027907 | Ga0207428_10089355 | Ga0207428_100893554 | 128 |
| 301 | 3300027907 | Ga0207428_10299392 | Ga0207428_102993923 | 128 |
| 302 | 3300028379 | Ga0268266_10060333 | Ga0268266_100603332 | 128 |
| 303 | 3300028379 | Ga0268266_10202235 | Ga0268266_102022354 | 128 |
| 304 | 3300028379 | Ga0268266_10853862 | Ga0268266_108538622 | 128 |
| 305 | 3300028381 | Ga0268264_10879234 | Ga0268264_108792343 | 128 |
| 306 | 3300028381 | Ga0268264_12507292 | Ga0268264_125072922 | 128 |
| 307 | 3300028786 | Ga0307517_10101294 | Ga0307517_101012946 | 128 |
| 308 | 3300028786 | Ga0307517_10117953 | Ga0307517_101179533 | 128 |
| 309 | 3300028786 | Ga0307517_10164912 | Ga0307517_101649124 | 128 |
| 310 | 3300031456 | Ga0307513_10117936 | Ga0307513_101179363 | 128 |
| 311 | 3300031456 | Ga0307513_10217539 | Ga0307513_102175393 | 128 |
| 312 | 3300031456 | Ga0307513_10352818 | Ga0307513_103528182 | 128 |
| 313 | 3300031548 | Ga0307408_100188519 | Ga0307408_1001885192 | 128 |
| 314 | 3300031665 | Ga0316575_10019694 | Ga0316575_100196941 | 128 |
| 315 | 3300031691 | Ga0316579_10316602 | Ga0316579_103166022 | 128 |
| 316 | 3300031728 | Ga0316578_10484401 | Ga0316578_104844012 | 128 |
| 317 | 3300031730 | Ga0307516_10022871 | Ga0307516_100228713 | 128 |
| 318 | 3300031730 | Ga0307516_10777577 | Ga0307516_107775772 | 128 |
| 319 | 3300031733 | Ga0316577_10256301 | Ga0316577_102563012 | 128 |
| 320 | 3300031824 | Ga0307413_11034812 | Ga0307413_110348122 | 128 |
| 321 | 3300031995 | Ga0307409_100466734 | Ga0307409_1004667342 | 128 |
| 322 | 3300031995 | Ga0307409_101964980 | Ga0307409_1019649801 | 128 |
| 323 | 3300032002 | Ga0307416_102055419 | Ga0307416_1020554191 | 128 |
| 324 | 3300032002 | Ga0307416_102369666 | Ga0307416_1023696661 | 128 |
| 325 | 3300032004 | Ga0307414_10983780 | Ga0307414_109837801 | 128 |
| 326 | 3300032005 | Ga0307411_10717821 | Ga0307411_107178212 | 128 |
| 327 | 3300032126 | Ga0307415_100965271 | Ga0307415_1009652711 | 128 |
| 328 | 3300033180 | Ga0307510_10218187 | Ga0307510_102181872 | 128 |
| 329 | 3300034817 | Ga0373948_0008567 | Ga0373948_0008567_240_632 | 128 |
| 330 | 3300034818 | Ga0373950_0003111 | Ga0373950_0003111_935_1327 | 128 |
| 331 | 3300035088 | Ga0373940_0018466 | Ga0373940_0018466_1205_1597 | 128 |
| 332 | 3300035091 | Ga0373951_0010198 | Ga0373951_0010198_591_983 | 128 |
| 333 | 3300035114 | Ga0373939_0000090 | Ga0373939_0000090_7773_8165 | 128 |
| 334 | 3300035116 | Ga0373945_0323885 | Ga0373945_0323885_91_540 | 128 |
| 335 | 3300035121 | Ga0373960_0001231 | Ga0373960_0001231_1289_1681 | 128 |
| 336 | 3300035171 | Ga0373946_0527707 | Ga0373946_0527707_181_573 | 128 |
| 337 | 3300035241 | Ga0373961_0063068 | Ga0373961_0063068_643_1035 | 128 |
| 338 | 3300035691 | Ga0373931_0000516 | Ga0373931_0000516_7749_8141 | 128 |
| 339 | 3300036401 | Ga0373937_0254405 | Ga0373937_0254405_1203_1589 | 128 |
| 340 | 3300036401 | Ga0373937_0478882 | Ga0373937_0478882_442_855 | 128 |
| 341 | 3300036647 | Ga0316582_0020819 | Ga0316582_0020819_1626_2012 | 128 |
| 342 | 3300037418 | Ga0395900_0814271 | Ga0395900_0814271_50_436 | 128 |
| 343 | 3300037471 | Ga0395905_0287921 | Ga0395905_0287921_763_1149 | 128 |
| 344 | 3300037588 | Ga0316581_0004793 | Ga0316581_0004793_1224_1610 | 128 |
| 345 | 3300042128 | Ga0450897_036166 | Ga0450897_036166_32_418 | 128 |
| 346 | 3300042876 | Ga0451577_0094867 | Ga0451577_0094867_2156_2542 | 128 |
| 347 | 3300042876 | Ga0451577_1676020 | Ga0451577_1676020_96_485 | 128 |
| 348 | 3300044656 | Ga0466969_0018161 | Ga0466969_0018161_2075_2473 | 128 |
| 349 | 3300044673 | Ga0453683_0585936 | Ga0453683_0585936_293_679 | 128 |
| 350 | 3300044683 | Ga0466965_0130400 | Ga0466965_0130400_355_753 | 128 |
| 351 | 3300044684 | Ga0466966_0222488 | Ga0466966_0222488_655_1053 | 128 |
| 352 | 3300044693 | Ga0466961_0145275 | Ga0466961_0145275_835_1233 | 128 |
| 353 | 3300044719 | Ga0466971_0025669 | Ga0466971_0025669_1479_1877 | 128 |
| 354 | 3300044735 | Ga0466968_0393391 | Ga0466968_0393391_145_531 | 128 |
| 355 | 3300044842 | Ga0466957_0040153 | Ga0466957_0040153_2072_2470 | 128 |
| 356 | 3300044901 | Ga0466960_0006870 | Ga0466960_0006870_2936_3322 | 128 |
| 357 | 3300045049 | Ga0466959_0031417 | Ga0466959_0031417_1426_1824 | 128 |
| 358 | 3300045051 | Ga0451576_1771352 | Ga0451576_1771352_57_455 | 128 |
| 359 | 3300045976 | Ga0466967_1786487 | Ga0466967_1786487_109_495 | 128 |
| 360 | 3300046473 | Ga0495582_0285287 | Ga0495582_0285287_431_880 | 128 |
| 361 | 3300046474 | Ga0495605_0029015 | Ga0495605_0029015_2394_2822 | 128 |
| 362 | 3300046499 | Ga0495594_0090716 | Ga0495594_0090716_372_761 | 128 |
| 363 | 3300046506 | Ga0495583_0228919 | Ga0495583_0228919_170_559 | 128 |
| 364 | 3300046512 | Ga0495610_0088163 | Ga0495610_0088163_293_721 | 128 |
| 365 | 3300046515 | Ga0495620_0088133 | Ga0495620_0088133_430_858 | 128 |
| 366 | 3300046516 | Ga0495628_0437154 | Ga0495628_0437154_285_698 | 128 |
| 367 | 3300046517 | Ga0495630_0326271 | Ga0495630_0326271_599_985 | 128 |
| 368 | 3300046518 | Ga0495631_0054785 | Ga0495631_0054785_666_1094 | 128 |
| 369 | 3300046519 | Ga0495632_0003106 | Ga0495632_0003106_8096_8524 | 128 |
| 370 | 3300046528 | Ga0495642_0424659 | Ga0495642_0424659_167_559 | 128 |
| 371 | 3300046537 | Ga0495598_0015034 | Ga0495598_0015034_703_1095 | 128 |
| 372 | 3300046538 | Ga0495609_0044876 | Ga0495609_0044876_41_469 | 128 |
| 373 | 3300046539 | Ga0495621_0015517 | Ga0495621_0015517_1327_1719 | 128 |
| 374 | 3300046542 | Ga0495597_0059365 | Ga0495597_0059365_1084_1512 | 128 |
| 375 | 3300046542 | Ga0495597_0187811 | Ga0495597_0187811_150_539 | 128 |
| 376 | 3300046543 | Ga0495645_0087358 | Ga0495645_0087358_1365_1763 | 128 |
| 377 | 3300046616 | Ga0495668_0052296 | Ga0495668_0052296_1439_1828 | 128 |
| 378 | 3300046648 | Ga0495611_0067112 | Ga0495611_0067112_897_1286 | 128 |
| 379 | 3300046681 | Ga0495647_0393362 | Ga0495647_0393362_98_511 | 128 |
| 380 | 3300046683 | Ga0495658_0470861 | Ga0495658_0470861_364_777 | 128 |
| 381 | 3300046692 | Ga0495671_0180926 | Ga0495671_0180926_189_578 | 128 |
| 382 | 3300046694 | Ga0495649_0008052 | Ga0495649_0008052_4163_4591 | 128 |
| 383 | 3300046810 | Ga0495660_0043232 | Ga0495660_0043232_1027_1455 | 128 |
| 384 | 3300047315 | Ga0495581_0247038 | Ga0495581_0247038_266_715 | 128 |
| 385 | 3300047319 | Ga0495674_1426102 | Ga0495674_1426102_45_437 | 128 |
| 386 | 3300047320 | Ga0495672_0183233 | Ga0495672_0183233_111_497 | 128 |
| 387 | 3300047443 | Ga0495687_001446 | Ga0495687_001446_14125_14514 | 128 |
| 388 | 3300048091 | Ga0495626_0205376 | Ga0495626_0205376_98_487 | 128 |
| 389 | 3300048903 | Ga0496100_0282514 | Ga0496100_0282514_429_815 | 128 |
| 390 | 3300048907 | Ga0496104_0025922 | Ga0496104_0025922_3822_4208 | 128 |
| 391 | 3300048909 | Ga0496106_0785255 | Ga0496106_0785255_61_447 | 128 |
| 392 | 3300048910 | Ga0496107_0077713 | Ga0496107_0077713_1802_2188 | 128 |
| 393 | 3300048910 | Ga0496107_0485869 | Ga0496107_0485869_444_830 | 128 |
| 394 | 3300048911 | Ga0496108_1418325 | Ga0496108_1418325_116_502 | 128 |
| 395 | 3300048912 | Ga0496109_0853975 | Ga0496109_0853975_149_535 | 128 |
| 396 | 3300048912 | Ga0496109_1337561 | Ga0496109_1337561_221_619 | 128 |
| 397 | 3300048915 | Ga0496112_0139084 | Ga0496112_0139084_1929_2318 | 128 |
| 398 | 3300048916 | Ga0496113_0985216 | Ga0496113_0985216_92_478 | 128 |
| 399 | 3300048917 | Ga0496114_0163829 | Ga0496114_0163829_851_1237 | 128 |
| 400 | 3300048918 | Ga0496115_0194295 | Ga0496115_0194295_434_820 | 128 |
| 401 | 3300049459 | Ga0495678_188748 | Ga0495678_188748_64_492 | 128 |
| 402 | 3300049514 | Ga0501291_014467 | Ga0501291_014467_514_903 | 128 |
| 403 | 3300049521 | Ga0501298_113555 | Ga0501298_113555_60_449 | 128 |
| 404 | 3300049523 | Ga0501300_000731 | Ga0501300_000731_993_1382 | 128 |
| 405 | 3300049569 | Ga0501032_0387269 | Ga0501032_0387269_311_700 | 128 |
| 406 | 3300049570 | Ga0501033_0000565 | Ga0501033_0000565_15208_15597 | 128 |
| 407 | 3300049571 | Ga0501034_0000641 | Ga0501034_0000641_26529_26915 | 128 |
| 408 | 3300049571 | Ga0501034_0093094 | Ga0501034_0093094_877_1263 | 128 |
| 409 | 3300049571 | Ga0501034_0173008 | Ga0501034_0173008_1046_1435 | 128 |
| 410 | 3300049578 | Ga0501042_0504105 | Ga0501042_0504105_131_517 | 128 |
| 411 | 3300049579 | Ga0501043_0287146 | Ga0501043_0287146_355_741 | 128 |
| 412 | 3300049580 | Ga0501046_0652436 | Ga0501046_0652436_231_617 | 128 |
| 413 | 3300049583 | Ga0501067_0015456 | Ga0501067_0015456_1857_2243 | 128 |
| 414 | 3300049584 | Ga0501068_0043891 | Ga0501068_0043891_353_739 | 128 |
| 415 | 3300049585 | Ga0501069_0916437 | Ga0501069_0916437_89_475 | 128 |
| 416 | 3300049587 | Ga0501071_0001676 | Ga0501071_0001676_10022_10408 | 128 |
| 417 | 3300049587 | Ga0501071_0270049 | Ga0501071_0270049_480_869 | 128 |
| 418 | 3300049588 | Ga0501072_0002048 | Ga0501072_0002048_995_1381 | 128 |
| 419 | 3300049588 | Ga0501072_0112710 | Ga0501072_0112710_586_972 | 128 |
| 420 | 3300049589 | Ga0501073_0170098 | Ga0501073_0170098_71_457 | 128 |
| 421 | 3300049590 | Ga0501074_0032109 | Ga0501074_0032109_2993_3379 | 128 |
| 422 | 3300049593 | Ga0501077_0002804 | Ga0501077_0002804_8236_8622 | 128 |
| 423 | 3300049679 | Ga0501249_043842 | Ga0501249_043842_409_798 | 128 |
| 424 | 3300049741 | Ga0501079_0000604 | Ga0501079_0000604_4154_4540 | 128 |
| 425 | 3300049742 | Ga0501080_0015536 | Ga0501080_0015536_5275_5661 | 128 |
| 426 | 3300049742 | Ga0501080_0365859 | Ga0501080_0365859_827_1243 | 128 |
| 427 | 3300049743 | Ga0501081_0223917 | Ga0501081_0223917_587_973 | 128 |
| 428 | 3300049764 | Ga0501267_000112 | Ga0501267_000112_3118_3507 | 128 |
| 429 | 3300049769 | Ga0501272_068161 | Ga0501272_068161_63_449 | 128 |
| 430 | 3300050489 | nmdc:mga03683_155105_c1 | nmdc:mga03683_155105_c1_324_716 | 128 |
| 431 | 3300050489 | nmdc:mga03683_3760_c2 | nmdc:mga03683_3760_c2_1871_2263 | 128 |
| 432 | 3300050490 | nmdc:mga03n38_3563_c1 | nmdc:mga03n38_3563_c1_411_803 | 128 |
| 433 | 3300050492 | nmdc:mga0yw44_649312_c1 | nmdc:mga0yw44_649312_c1_314_700 | 128 |
| 434 | 3300050493 | nmdc:mga0k408_3106_c1 | nmdc:mga0k408_3106_c1_3556_3948 | 128 |
| 435 | 3300050493 | nmdc:mga0k408_737755_c1 | nmdc:mga0k408_737755_c1_161_553 | 128 |
| 436 | 3300050494 | nmdc:mga06z11_113893_c1 | nmdc:mga06z11_113893_c1_658_1050 | 128 |
| 437 | 3300050494 | nmdc:mga06z11_11937_c1 | nmdc:mga06z11_11937_c1_1074_1466 | 128 |
| 438 | 3300050496 | nmdc:mga07m45_1462_c1 | nmdc:mga07m45_1462_c1_218_610 | 128 |
| 439 | 3300050496 | nmdc:mga07m45_31227_c1 | nmdc:mga07m45_31227_c1_573_965 | 128 |
| 440 | 3300050507 | nmdc:mga05p37_1235464_c1 | nmdc:mga05p37_1235464_c1_10_396 | 128 |
| 441 | 3300050508 | nmdc:mga09592_224899_c1 | nmdc:mga09592_224899_c1_1187_1573 | 128 |
| 442 | 3300050509 | nmdc:mga0qj67_1183511_c1 | nmdc:mga0qj67_1183511_c1_92_484 | 128 |
| 443 | 3300050510 | nmdc:mga06r32_334030_c1 | nmdc:mga06r32_334030_c1_999_1391 | 128 |
| 444 | 3300050511 | nmdc:mga08y16_1739212_c1 | nmdc:mga08y16_1739212_c1_23_412 | 128 |
| 445 | 3300050511 | nmdc:mga08y16_180307_c1 | nmdc:mga08y16_180307_c1_1610_1996 | 128 |
| 446 | 3300050511 | nmdc:mga08y16_1859_c1 | nmdc:mga08y16_1859_c1_546_932 | 128 |
| 447 | 3300050513 | nmdc:mga0rr50_116593_c1 | nmdc:mga0rr50_116593_c1_511_909 | 128 |
| 448 | 3300050515 | nmdc:mga0a205_1537993_c1 | nmdc:mga0a205_1537993_c1_74_460 | 128 |
| 449 | 3300050516 | nmdc:mga0sz30_42222_c2 | nmdc:mga0sz30_42222_c2_514_906 | 128 |
| 450 | 3300050516 | nmdc:mga0sz30_6858_c1 | nmdc:mga0sz30_6858_c1_1243_1635 | 128 |
| 451 | 3300053086 | Ga0500578_0464471 | Ga0500578_0464471_123_551 | 128 |
| 452 | 3300053098 | Ga0500650_0247802 | Ga0500650_0247802_280_669 | 128 |
| 453 | 3300053134 | Ga0500658_0002629 | Ga0500658_0002629_2178_2606 | 128 |
| 454 | 3300053139 | Ga0500568_0025639 | Ga0500568_0025639_1469_1858 | 128 |
| 455 | 3300053142 | Ga0500577_0392122 | Ga0500577_0392122_177_563 | 128 |
| 456 | 3300054114 | Ga0501084_0023787 | Ga0501084_0023787_1811_2197 | 128 |
| 457 | 3300060353 | Ga0501082_0117575 | Ga0501082_0117575_577_963 | 128 |
| 458 | 3300061719 | Ga0466962_0003292 | Ga0466962_0003292_5027_5425 | 128 |
| 459 | 3300061719 | Ga0466962_0111224 | Ga0466962_0111224_17_403 | 128 |
| 460 | 3300061734 | Ga0530510_0366055 | Ga0530510_0366055_414_800 | 128 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2dv5-assembly1.cif.gz_B | crystal structure of leu65 to ala mutant of diphthine synthase | 0.6489 | 84 | 128 |
| 2p6k-assembly1.cif.gz_B | crystal structure of ph0725 from pyrococcus horikoshii ot3 | 0.6185 | 81 | 128 |
| 2pcg-assembly1.cif.gz_B | crystal structure of ph0725 from pyrococcus horikoshii ot3 | 0.5993 | 76 | 128 |
| 2emr-assembly1.cif.gz_B | mutant l65m structure of ph0725 from pyrococcus horikoshii ot3 | 0.5983 | 76 | 128 |
| 2e8h-assembly1.cif.gz_B | crystal structure of ph0725 from pyrococcus horikoshii ot3 | 0.5979 | 76 | 128 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4gamM02 | Mainly Alpha;Up-down Bundle;Monooxygenase;Methane monooxygenase, gamma chain, domain 2 | 0.7157 | 53 | 81 | 1.20.1280.30 |
| af_Q9P6N4_361_771_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.567 | 54 | 93 | 1.25.40.10 |
| af_K7MIR4_1_151_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.5476 | 52 | 92 | 1.25.40.10 |
| af_E1B6W2_4_608_1.20.1280.170 | Mainly Alpha;Up-down Bundle;Monooxygenase;Exocyst complex component Exo70 | 0.5454 | 53 | 95 | 1.20.1280.170 |
| af_K7L3G9_6_154_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.5438 | 50 | 94 | 1.25.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A157ZQZ9-F1-model_v4 | DUF488 domain-containing protein | 0.9993 | 1 | 128 |
|
| AF-A0A375BAR4-F1-model_v4 | deleted | 0.9992 | 1 | 128 |
|
| AF-A0A375J012-F1-model_v4 | DUF488 domain-containing protein | 0.9984 | 1 | 128 |
|
| AF-Q2IDM1-F1-model_v4 | DUF488 domain-containing protein | 0.9958 | 1 | 128 |
|
| AF-A0A2T6CNJ7-F1-model_v4 | DUF488 domain-containing protein | 0.9944 | 1 | 127 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar