metagRoot

F448560

General Info

Members	Datasets	Scaffolds	Average Seq Length
460	225	446	163

Family's Representative Sequence

Representative Sequence	3300025972\|Ga0207668_10767079\|Ga0207668_107670791
Length	188
Sequence	LKKFIEYFFRFQKYAILIRIKKYVCGAMINQSVYLLIGSNVGDRRKHLSDALWAIETRAGVIRGRSSVYETAAWGKTDQPSFYNQAIRITTFLNPSELLAQLQLIEKSLGRERKEKWGERVIDIDILFFGDHIIDTPDLKVPHPELQNRRFALVPMSEIADDLIHPRLYQTIHELLKNCADTLPVKKI

Samples

	Sample ID	Description	Type	Environment
1	2585427687	Pedobacter borealis DSM 19626	Isolate	Rhizosphere
2	2738541302	Pedobacter sp. CF074	Isolate	Unclassified
3	2739367651	Pedobacter sp. OK291	Isolate	Unclassified
4	2739367656	Pedobacter sp. CF523	Isolate	Unclassified
5	2739367663	Pedobacter sp. YR510	Isolate	Unclassified
6	2818991437	Pedobacter terrae 518	Isolate	Unclassified
7	2839989709	Pontibacter arcticus 2b14	Isolate	Unclassified
8	2842722452	Pedobacter sp. R-72249	Isolate	Unclassified
9	2842909656	Pedobacter sp. R-72393	Isolate	Unclassified
10	2849281842	Pedobacter sp. AK013	Isolate	Rhizosphere
11	2902048731	Pedobacter ureilyticus THG-T11	Isolate	Rhizosphere
12	2904445276	Pedobacter terrae 1734	Isolate	Rhizosphere
13	2910245624	Adhaeribacter radiodurans KUDC8001	Isolate	Rhizosphere
14	2945997725	Pedobacter sp. W3I1	Isolate	Rhizosphere
15	2954016120	Flavobacterium sp. W4I14	Isolate	Rhizosphere
16	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
17	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
18	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
19	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
20	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
21	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
22	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
23	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
24	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
25	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
26	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
27	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
28	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
29	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
30	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
31	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
32	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
33	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
34	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
35	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
36	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
37	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
38	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
39	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
40	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
41	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
42	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
43	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
44	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
45	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
46	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
47	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
48	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
49	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
50	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
51	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
52	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
53	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
54	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
55	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
56	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
57	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
58	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
59	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
60	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
61	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
62	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
63	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
64	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
65	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
66	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
67	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
68	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
69	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
70	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
71	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
72	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
73	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
74	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
75	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
76	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
77	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
78	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
79	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
80	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
81	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
82	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
83	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
84	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
85	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
86	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
87	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
88	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
89	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
90	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
91	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
92	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
93	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
94	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
95	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
96	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
97	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
98	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
99	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
100	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
101	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
102	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
103	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
104	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
105	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
106	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
107	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
108	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
109	3300015682	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01	Metagenome	Rhizosphere
110	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
111	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
112	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
113	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
114	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
115	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
116	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
117	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
159	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300030745	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8	Metagenome	Rhizosphere
162	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
163	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
164	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
165	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
166	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
167	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
168	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
169	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
170	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
171	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
172	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
173	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
174	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
175	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
176	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
177	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
178	3300044672	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E	Metagenome	Unclassified
179	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
180	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
181	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
182	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
183	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
184	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
185	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
186	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
187	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
188	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
189	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
190	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
191	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
192	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
193	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
194	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
195	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
196	3300049523	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control	Metagenome	Rhizosphere
197	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
198	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
199	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
200	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
201	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
202	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
203	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
204	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
205	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
206	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
207	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
208	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
209	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
210	3300049657	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought	Metagenome	Rhizosphere
211	3300049661	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control	Metagenome	Rhizosphere
212	3300049663	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought	Metagenome	Rhizosphere
213	3300049670	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought	Metagenome	Rhizosphere
214	3300049681	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought	Metagenome	Rhizosphere
215	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
216	3300049761	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control	Metagenome	Rhizosphere
217	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
218	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
219	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
220	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
221	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
222	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
223	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
224	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
225	3300059424	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	96.74
Metatranscriptomes	0
Isolates	3.26

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	3.91
Nodule	0
Rhizoplane	0.87
Rhizosphere	90.22
Stem	0
Stem Tuber	0
Unclassified	5

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25152J39213_1000017	3300002773	Bacteria	109718
2	JGI25150J39212_1000001	3300002774	Bacteria	1318726
3	JGI25151J46595_10000001	3300003187	Bacteria	887211
4	JGI25153J46596_10000053	3300003215	Bacteria	138301
5	rootH1_10001275	3300003316	Bacteria	21026
6	rootH1_10019234	3300003316	Bacteria	23179
7	rootH2_10002905	3300003320	Bacteria	36151
8	rootH2_10071687	3300003320	Unclassified	1256
9	rootL2_10000133	3300003322	Bacteria	40358
10	rootL2_10184856	3300003322	Bacteria	5341
11	rootL2_10276523	3300003322	Bacteria	3056
12	rootH1_10015770	3300003323	Bacteria	25525
13	rootH1_10029390	3300003316	Bacteria	4608
14	rootH1_10029390	3300003323	Bacteria	24130
15	rootH1_10037052	3300003323	Bacteria	14989
16	rootH1_10037070	3300003323	Bacteria	2989
17	rootH1_10042262	3300003323	Bacteria	8082
18	rootH1_10144022	3300003323	Bacteria	1284
19	Ga0055536_1000001	3300003781	Bacteria	630663
20	Ga0055530_10006389	3300003791	Bacteria	5282
21	Ga0065165_1014484	3300005262	Unclassified	3059
22	Ga0065714_10002285	3300005288	Bacteria	27785
23	Ga0065714_10002947	3300005288	Bacteria	9455
24	Ga0070676_10000263	3300005328	Bacteria	22940
25	Ga0070676_10017885	3300005328	Bacteria	3925
26	Ga0070676_10019279	3300005328	Bacteria	3793
27	Ga0070676_10246114	3300005328	Unclassified	1191
28	Ga0070683_100087498	3300005329	Unclassified	2922
29	Ga0070690_100311665	3300005330	Unclassified	1131
30	Ga0070670_100052282	3300005331	Unclassified	3508
31	Ga0070670_100078185	3300005331	Unclassified	2842
32	Ga0070670_100086988	3300005331	Bacteria	2685
33	Ga0070677_10005260	3300005333	Bacteria	4259
34	Ga0068869_100146755	3300005334	Bacteria	1826
35	Ga0068869_100175527	3300005334	Bacteria	1677
36	Ga0068869_100574013	3300005334	Unclassified	950
37	Ga0070666_10004806	3300005335	Bacteria	8262
38	Ga0070666_10009062	3300005335	Bacteria	6203
39	Ga0070682_100000044	3300005337	Bacteria	133653
40	Ga0068868_100001950	3300005338	Bacteria	14152
41	Ga0068868_100003187	3300005338	Bacteria	11411
42	Ga0068868_100043145	3300005338	Unclassified	3523
43	Ga0068868_100084823	3300005338	Bacteria	2544
44	Ga0068868_100098052	3300005338	Bacteria	2369
45	Ga0068868_100764009	3300005338	Bacteria	869
46	Ga0070689_100005285	3300005340	Bacteria	8798
47	Ga0070661_100014590	3300005344	Bacteria	5538
48	Ga0070661_100735017	3300005344	Unclassified	806
49	Ga0070668_100000106	3300005347	Bacteria	51244
50	Ga0070668_100036094	3300005347	Bacteria	3772
51	Ga0070669_100041950	3300005353	Bacteria	3329
52	Ga0070669_100491504	3300005353	Bacteria	1017
53	Ga0070675_100220545	3300005354	Bacteria	1651
54	Ga0070671_100002242	3300005355	Bacteria	14920
55	Ga0070671_100077412	3300005355	Bacteria	2779
56	Ga0070671_100134157	3300005355	Bacteria	2086
57	Ga0070671_100321168	3300005355	Bacteria	1319
58	Ga0070674_100234659	3300005356	Bacteria	1433
59	Ga0070673_100000229	3300005364	Bacteria	28088
60	Ga0070673_100007488	3300005364	Bacteria	7206
61	Ga0070673_100035166	3300005364	Unclassified	3796
62	Ga0070688_100005254	3300005365	Bacteria	6806
63	Ga0070688_100905940	3300005365	Unclassified	696
64	Ga0070667_100000931	3300005367	Bacteria	27021
65	Ga0070667_100009450	3300005367	Bacteria	8088
66	Ga0070667_100088830	3300005367	Unclassified	2654
67	Ga0070667_100355989	3300005367	Bacteria	1326
68	Ga0070667_100500710	3300005367	Bacteria	1113
69	Ga0070667_100528819	3300005367	Bacteria	1082
70	Ga0070700_100635377	3300005441	Bacteria	841
71	Ga0070663_100104642	3300005455	Unclassified	2117
72	Ga0070663_100620519	3300005455	Unclassified	911
73	Ga0070663_100890908	3300005455	Bacteria	768
74	Ga0070678_100008756	3300005456	Bacteria	6080
75	Ga0070678_100052658	3300005456	Bacteria	2957
76	Ga0070678_100193333	3300005456	Unclassified	1674
77	Ga0070662_100009238	3300005457	Bacteria	6440
78	Ga0070662_100034986	3300005457	Unclassified	3545
79	Ga0070662_100514852	3300005457	Bacteria	999
80	Ga0068867_100001703	3300005459	Bacteria	15314
81	Ga0068867_100009241	3300005459	Bacteria	6956
82	Ga0068867_100035369	3300005459	Bacteria	3623
83	Ga0068867_100077339	3300005459	Bacteria	2500
84	Ga0070699_100449508	3300005518	Bacteria	1168
85	Ga0070684_100010684	3300005535	Bacteria	7282
86	Ga0068853_100072516	3300005539	Unclassified	3001
87	Ga0068853_100180102	3300005539	Unclassified	1916
88	Ga0068853_100870889	3300005539	Bacteria	864
89	Ga0070672_100000325	3300005543	Bacteria	27226
90	Ga0070672_100006683	3300005543	Bacteria	7770
91	Ga0070672_100035809	3300005543	Unclassified	3774
92	Ga0070686_100151912	3300005544	Bacteria	1623
93	Ga0070665_100000570	3300005548	Bacteria	51526
94	Ga0070665_100045100	3300005548	Bacteria	4427
95	Ga0070665_100322144	3300005548	Bacteria	1550
96	Ga0068855_100301826	3300005563	Bacteria	1773
97	Ga0068855_100432613	3300005563	Unclassified	1438
98	Ga0070664_100010065	3300005564	Bacteria	7666
99	Ga0070664_100559587	3300005564	Unclassified	1058
100	Ga0070664_101929676	3300005564	Unclassified	560
101	Ga0068857_100039837	3300005577	Bacteria	4164
102	Ga0068854_100030289	3300005578	Bacteria	3753
103	Ga0068854_100301672	3300005578	Bacteria	1296
104	Ga0068856_100179618	3300005614	Bacteria	2129
105	Ga0068859_100066631	3300005617	Bacteria	3636
106	Ga0068859_100202762	3300005617	Bacteria	2068
107	Ga0068859_100216204	3300005617	Unclassified	2004
108	Ga0068859_100307599	3300005617	Bacteria	1678
109	Ga0068859_100399066	3300005617	Bacteria	1471
110	Ga0068864_100001209	3300005618	Bacteria	21452
111	Ga0068864_100052879	3300005618	Unclassified	3501
112	Ga0068864_100734872	3300005618	Bacteria	966
113	Ga0068866_10018833	3300005718	Bacteria	3131
114	Ga0068866_10023694	3300005718	Bacteria	2858
115	Ga0068866_11183043	3300005718	Unclassified	551
116	Ga0068861_100728722	3300005719	Bacteria	924
117	Ga0068851_10093384	3300005834	Bacteria	1587
118	Ga0068851_10313135	3300005834	Unclassified	905
119	Ga0068870_10013382	3300005840	Bacteria	3855
120	Ga0068863_100003303	3300005841	Bacteria	15923
121	Ga0068863_100036503	3300005841	Unclassified	4682
122	Ga0068863_100073161	3300005841	Bacteria	3242
123	Ga0068863_100139222	3300005841	Bacteria	2319
124	Ga0068863_101916967	3300005841	Unclassified	602
125	Ga0068858_100001322	3300005842	Bacteria	25607
126	Ga0068858_100285677	3300005842	Unclassified	1571
127	Ga0068860_100014141	3300005843	Bacteria	7828
128	Ga0068860_100028713	3300005843	Bacteria	5355
129	Ga0068860_100084825	3300005843	Bacteria	3013
130	Ga0068860_100265273	3300005843	Bacteria	1675
131	Ga0068862_100498956	3300005844	Bacteria	1155
132	Ga0075366_10020956	3300006195	Bacteria	3798
133	Ga0097621_100000143	3300006237	Bacteria	43193
134	Ga0097621_100015299	3300006237	Bacteria	5770
135	Ga0097621_100088421	3300006237	Bacteria	2589
136	Ga0068871_100000741	3300006358	Bacteria	22178
137	Ga0068871_100002881	3300006358	Bacteria	11796
138	Ga0068871_100154122	3300006358	Bacteria	1961
139	Ga0075428_100045782	3300006844	Bacteria	4807
140	Ga0075428_101490096	3300006844	Bacteria	709
141	Ga0075430_100082739	3300006846	Bacteria	2690
142	Ga0068865_100000299	3300006881	Bacteria	27298
143	Ga0068865_100007419	3300006881	Bacteria	6747
144	Ga0068865_100192101	3300006881	Bacteria	1580
145	Ga0097620_100066632	3300006931	Bacteria	3636
146	Ga0097620_100202765	3300006931	Bacteria	2068
147	Ga0097620_100216219	3300006931	Unclassified	2004
148	Ga0097620_100307578	3300006931	Bacteria	1678
149	Ga0097620_100399047	3300006931	Bacteria	1471
150	Ga0097620_100864394	3300006931	Bacteria	990
151	Ga0105240_10000263	3300009093	Bacteria	103973
152	Ga0105240_10137465	3300009093	Bacteria	2925
153	Ga0111539_10087450	3300009094	Unclassified	3661
154	Ga0111539_10102168	3300009094	Bacteria	3365
155	Ga0105245_10366720	3300009098	Unclassified	1431
156	Ga0105243_10270072	3300009148	Unclassified	1526
157	Ga0105243_10351156	3300009148	Bacteria	1354
158	Ga0105241_10000384	3300009174	Bacteria	33496
159	Ga0105241_10053980	3300009174	Bacteria	3075
160	Ga0105242_10004236	3300009176	Bacteria	11182
161	Ga0105242_10022831	3300009176	Bacteria	4926
162	Ga0105242_10311998	3300009176	Unclassified	1439
163	Ga0105248_10293026	3300009177	Bacteria	1832
164	Ga0105248_12241268	3300009177	Bacteria	622
165	Ga0105237_10015253	3300009545	Bacteria	8004
166	Ga0105237_10770574	3300009545	Unclassified	969
167	Ga0105238_10000536	3300009551	Bacteria	39756
168	Ga0105249_10004490	3300009553	Bacteria	12063
169	Ga0105249_10015175	3300009553	Bacteria	6817
170	Ga0105249_10018666	3300009553	Bacteria	6176
171	Ga0105249_10051417	3300009553	Bacteria	3759
172	Ga0105249_10067702	3300009553	Bacteria	3290
173	Ga0105249_10626920	3300009553	Bacteria	1132
174	Ga0105249_10887002	3300009553	Bacteria	958
175	Ga0105249_10955690	3300009553	Bacteria	925
176	Ga0105249_11381920	3300009553	Bacteria	776
177	Ga0105249_11593814	3300009553	Bacteria	725
178	Ga0105239_10004319	3300010375	Bacteria	17042
179	Ga0105239_10353846	3300010375	Unclassified	1658
180	Ga0105239_10711924	3300010375	Bacteria	1148
181	Ga0105246_10020739	3300011119	Bacteria	4219
182	Ga0105246_10096265	3300011119	Unclassified	2145
183	Ga0105246_10282940	3300011119	Unclassified	1331
184	Ga0157373_10271312	3300013100	Bacteria	1201
185	Ga0157371_10000021	3300013102	Bacteria	301017
186	Ga0157371_10540030	3300013102	Bacteria	863
187	Ga0157370_10004406	3300013104	Bacteria	16155
188	Ga0157370_10178601	3300013104	Bacteria	1973
189	Ga0157369_10000008	3300013105	Bacteria	309315
190	Ga0157374_10000089	3300013296	Bacteria	89250
191	Ga0157374_10018673	3300013296	Bacteria	6125
192	Ga0157374_10053957	3300013296	Bacteria	3748
193	Ga0157378_10005286	3300013297	Bacteria	11339
194	Ga0157378_10040087	3300013297	Bacteria	4153
195	Ga0157378_10040776	3300013297	Bacteria	4118
196	Ga0157378_10055412	3300013297	Bacteria	3532
197	Ga0163162_10000084	3300013306	Bacteria	86252
198	Ga0163162_10000206	3300013306	Bacteria	54701
199	Ga0163162_10006680	3300013306	Bacteria	11191
200	Ga0163162_10013609	3300013306	Bacteria	7948
201	Ga0163162_10181511	3300013306	Bacteria	2231
202	Ga0163162_10217582	3300013306	Bacteria	2040
203	Ga0163162_11032835	3300013306	Bacteria	930
204	Ga0157372_10062059	3300013307	Unclassified	4186
205	Ga0157372_10741418	3300013307	Unclassified	1142
206	Ga0157372_11217905	3300013307	Bacteria	870
207	Ga0157372_11389841	3300013307	Bacteria	809
208	Ga0157375_10000057	3300013308	Bacteria	122654
209	Ga0157375_10003373	3300013308	Bacteria	13848
210	Ga0157375_10015071	3300013308	Bacteria	6913
211	Ga0157375_10038254	3300013308	Bacteria	4606
212	Ga0157375_10371592	3300013308	Bacteria	1596
213	Ga0163163_10000804	3300014325	Bacteria	26629
214	Ga0163163_10001267	3300014325	Bacteria	21322
215	Ga0163163_10084270	3300014325	Unclassified	3184
216	Ga0163163_10178860	3300014325	Bacteria	2168
217	Ga0163163_11563780	3300014325	Unclassified	721
218	Ga0157380_10147684	3300014326	Bacteria	2028
219	Ga0157380_10171989	3300014326	Bacteria	1894
220	Ga0157380_10203522	3300014326	Bacteria	1758
221	Ga0157380_10272033	3300014326	Unclassified	1545
222	Ga0157380_10465454	3300014326	Unclassified	1218
223	Ga0157380_10676268	3300014326	Unclassified	1033
224	Ga0157380_11258877	3300014326	Unclassified	785
225	Ga0157380_11450122	3300014326	Unclassified	738
226	Ga0182008_10002479	3300014497	Bacteria	11536
227	Ga0157377_10030923	3300014745	Bacteria	2905
228	Ga0157377_10190271	3300014745	Bacteria	1296
229	Ga0157377_10281154	3300014745	Bacteria	1091
230	Ga0157379_10000032	3300014968	Bacteria	83845
231	Ga0157379_10022190	3300014968	Bacteria	5625
232	Ga0157379_10060338	3300014968	Bacteria	3391
233	Ga0157379_10231472	3300014968	Unclassified	1675
234	Ga0157376_10000318	3300014969	Bacteria	32314
235	Ga0157376_10003039	3300014969	Bacteria	11492
236	Ga0157376_10249930	3300014969	Bacteria	1656
237	Ga0157376_10353049	3300014969	Unclassified	1408
238	Ga0157376_10609042	3300014969	Bacteria	1088
239	Ga0182006_1000091	3300015261	Bacteria	109227
240	Ga0182006_1001551	3300015261	Bacteria	13722
241	Ga0182007_10000003	3300015262	Bacteria	548244
242	Ga0183373_1001	3300015682	Bacteria	1410374
243	Ga0163161_10001232	3300017792	Bacteria	19196
244	Ga0163161_10023384	3300017792	Bacteria	4360
245	Ga0163161_10030785	3300017792	Unclassified	3822
246	Ga0163161_10081322	3300017792	Bacteria	2385
247	Ga0163161_10094297	3300017792	Unclassified	2219
248	Ga0163161_11291937	3300017792	Bacteria	634
249	Ga0207425_1000002	3300025245	Bacteria	1362590
250	Ga0209129_1000002	3300025258	Bacteria	1359086
251	Ga0209676_1000008	3300025292	Bacteria	991778
252	Ga0209025_1000004	3300025294	Bacteria	1361782
253	Ga0209758_1000006	3300025297	Bacteria	1359562
254	Ga0209050_1000045	3300025298	Bacteria	388022
255	Ga0207697_10023743	3300025315	Bacteria	2511
256	Ga0207697_10255000	3300025315	Unclassified	776
257	Ga0207688_10041309	3300025901	Unclassified	2565
258	Ga0207688_10384720	3300025901	Unclassified	868
259	Ga0207680_10000845	3300025903	Bacteria	14475
260	Ga0207680_10019077	3300025903	Bacteria	3662
261	Ga0207647_10051106	3300025904	Bacteria	2556
262	Ga0207647_10173864	3300025904	Unclassified	1253
263	Ga0207645_10000638	3300025907	Bacteria	29117
264	Ga0207645_10001413	3300025907	Bacteria	19673
265	Ga0207645_10073434	3300025907	Bacteria	2190
266	Ga0207645_10527396	3300025907	Bacteria	800
267	Ga0207643_10018778	3300025908	Bacteria	3786
268	Ga0207643_10094115	3300025908	Bacteria	1750
269	Ga0207654_10000887	3300025911	Bacteria	16589
270	Ga0207654_10083671	3300025911	Bacteria	1927
271	Ga0207695_10004554	3300025913	Bacteria	18847
272	Ga0207695_10125536	3300025913	Bacteria	2529
273	Ga0207671_10001944	3300025914	Bacteria	22809
274	Ga0207671_10461159	3300025914	Unclassified	1012
275	Ga0207671_10802584	3300025914	Unclassified	746
276	Ga0207681_10471492	3300025923	Bacteria	1024
277	Ga0207694_10000720	3300025924	Bacteria	29711
278	Ga0207650_10024854	3300025925	Unclassified	4264
279	Ga0207650_10199635	3300025925	Unclassified	1601
280	Ga0207659_10010296	3300025926	Bacteria	5870
281	Ga0207687_10248283	3300025927	Unclassified	1413
282	Ga0207644_10002179	3300025931	Bacteria	12702
283	Ga0207644_10366492	3300025931	Bacteria	1173
284	Ga0207644_10603036	3300025931	Unclassified	912
285	Ga0207690_10106176	3300025932	Bacteria	2015
286	Ga0207690_10670516	3300025932	Unclassified	851
287	Ga0207706_10007388	3300025933	Bacteria	10158
288	Ga0207706_10039794	3300025933	Unclassified	4168
289	Ga0207706_10117833	3300025933	Bacteria	2335
290	Ga0207706_10871013	3300025933	Bacteria	762
291	Ga0207686_10078238	3300025934	Unclassified	2150
292	Ga0207686_10123951	3300025934	Bacteria	1763
293	Ga0207709_10235997	3300025935	Unclassified	1327
294	Ga0207669_10063693	3300025937	Bacteria	2277
295	Ga0207704_10145975	3300025938	Bacteria	1662
296	Ga0207704_10595649	3300025938	Unclassified	904
297	Ga0207691_10000014	3300025940	Bacteria	142542
298	Ga0207691_10011084	3300025940	Bacteria	8652
299	Ga0207691_10233381	3300025940	Bacteria	1592
300	Ga0207689_10000939	3300025942	Bacteria	28012
301	Ga0207689_10002211	3300025942	Bacteria	18237
302	Ga0207689_10004402	3300025942	Bacteria	12804
303	Ga0207689_10202795	3300025942	Bacteria	1637
304	Ga0207661_10095496	3300025944	Unclassified	2485
305	Ga0207679_10060263	3300025945	Unclassified	2819
306	Ga0207679_10942994	3300025945	Bacteria	790
307	Ga0207679_11238372	3300025945	Bacteria	685
308	Ga0207667_10427435	3300025949	Unclassified	1347
309	Ga0207651_10000826	3300025960	Bacteria	13415
310	Ga0207651_10053495	3300025960	Unclassified	2760
311	Ga0207712_10012835	3300025961	Bacteria	5358
312	Ga0207712_10014875	3300025961	Bacteria	5010
313	Ga0207712_10110889	3300025961	Bacteria	2058
314	Ga0207712_10183091	3300025961	Unclassified	1647
315	Ga0207712_10437131	3300025961	Bacteria	1107
316	Ga0207668_10000124	3300025972	Bacteria	54437
317	Ga0207668_10474750	3300025972	Bacteria	1071
318	Ga0207668_10767079	3300025972	Bacteria	852
319	Ga0207640_10064491	3300025981	Bacteria	2439
320	Ga0207640_10192885	3300025981	Bacteria	1537
321	Ga0207658_10000242	3300025986	Bacteria	57191
322	Ga0207658_10013413	3300025986	Bacteria	5598
323	Ga0207658_10128644	3300025986	Unclassified	2031
324	Ga0207658_10139025	3300025986	Bacteria	1963
325	Ga0207658_10395624	3300025986	Unclassified	1213
326	Ga0207658_10922426	3300025986	Bacteria	795
327	Ga0207677_10003043	3300026023	Bacteria	8867
328	Ga0207677_10018269	3300026023	Bacteria	4205
329	Ga0207677_10030799	3300026023	Unclassified	3430
330	Ga0207677_10055599	3300026023	Bacteria	2707
331	Ga0207677_10636048	3300026023	Bacteria	940
332	Ga0207703_10000735	3300026035	Bacteria	32229
333	Ga0207639_10140300	3300026041	Bacteria	2013
334	Ga0207639_10140366	3300026041	Unclassified	2012
335	Ga0207639_11090110	3300026041	Bacteria	749
336	Ga0207678_10123011	3300026067	Unclassified	2214
337	Ga0207678_10201114	3300026067	Bacteria	1703
338	Ga0207702_10341633	3300026078	Bacteria	1430
339	Ga0207641_10013162	3300026088	Bacteria	6782
340	Ga0207641_10143459	3300026088	Bacteria	2157
341	Ga0207641_10232203	3300026088	Unclassified	1715
342	Ga0207648_10001686	3300026089	Bacteria	24217
343	Ga0207648_10008280	3300026089	Bacteria	10096
344	Ga0207648_10028788	3300026089	Unclassified	4924
345	Ga0207648_10153066	3300026089	Bacteria	2035
346	Ga0207676_10005744	3300026095	Bacteria	8775
347	Ga0207674_10053181	3300026116	Bacteria	4128
348	Ga0207674_11079929	3300026116	Bacteria	772
349	Ga0207683_10000535	3300026121	Bacteria	35178
350	Ga0207683_10075606	3300026121	Bacteria	2981
351	Ga0207683_10557788	3300026121	Unclassified	1059
352	Ga0207683_10866189	3300026121	Unclassified	839
353	Ga0207428_10143919	3300027907	Bacteria	1818
354	Ga0207428_10432583	3300027907	Bacteria	961
355	Ga0268266_10052763	3300028379	Bacteria	3492
356	Ga0268266_10366708	3300028379	Bacteria	1356
357	Ga0268264_10003731	3300028381	Bacteria	13086
358	Ga0268264_10215345	3300028381	Bacteria	1765
359	Ga0268264_10440701	3300028381	Bacteria	1260
360	Ga0268264_10585140	3300028381	Unclassified	1098
361	Ga0268264_10587883	3300028381	Bacteria	1096
362	Ga0316182_1034821	3300030745	Unclassified	925
363	Ga0265327_10012523	3300031251	Bacteria	5713
364	Ga0265327_10133937	3300031251	Bacteria	1163
365	Ga0307408_100202628	3300031548	Bacteria	1607
366	Ga0307405_10000042	3300031731	Bacteria	79124
367	Ga0307405_10046431	3300031731	Bacteria	2668
368	Ga0307413_10502340	3300031824	Bacteria	974
369	Ga0307407_10000022	3300031903	Bacteria	120355
370	Ga0307412_10094126	3300031911	Bacteria	2103
371	Ga0307416_100000047	3300032002	Bacteria	120385
372	Ga0307414_10100651	3300032004	Bacteria	2174
373	Ga0307414_10401445	3300032004	Bacteria	1191
374	Ga0307414_10685526	3300032004	Unclassified	926
375	Ga0307414_11083955	3300032004	Bacteria	739
376	Ga0307411_10030778	3300032005	Bacteria	3294
377	Ga0307411_10609076	3300032005	Bacteria	940
378	Ga0307411_11192301	3300032005	Bacteria	690
379	Ga0373945_0169204	3300035116	Bacteria	895
380	Ga0373946_0420598	3300035171	Bacteria	677
381	Ga0373933_0604810	3300035724	Bacteria	720
382	Ga0373937_0761740	3300036401	Unclassified	915
383	Ga0395900_0097305	3300037418	Bacteria	3024
384	Ga0395901_0882478	3300038443	Bacteria	877
385	Ga0451843_1652337	3300041509	Bacteria	1773
386	Ga0466982_0033196	3300044672	Bacteria	3077
387	Ga0495592_0200274	3300046454	Bacteria	1348
388	Ga0495594_0501114	3300046499	Bacteria	690
389	Ga0495606_0160420	3300046507	Bacteria	1312
390	Ga0495608_0179209	3300046511	Bacteria	1341
391	Ga0495610_0002045	3300046512	Bacteria	17226
392	Ga0495610_0005738	3300046512	Bacteria	8744
393	Ga0495618_0773864	3300046514	Bacteria	560
394	Ga0495630_0516863	3300046517	Bacteria	915
395	Ga0495637_0047683	3300046520	Bacteria	1807
396	Ga0495640_0343047	3300046533	Bacteria	923
397	Ga0495634_0736671	3300046642	Bacteria	565
398	Ga0495611_0040188	3300046648	Bacteria	2085
399	Ga0495625_0047308	3300046660	Bacteria	3102
400	Ga0495672_0044833	3300047320	Bacteria	2650
401	Ga0495686_0017977	3300047472	Bacteria	4754
402	Ga0495686_0027415	3300047472	Bacteria	3719
403	Ga0496109_0079110	3300048912	Bacteria	3028
404	Ga0496111_0061606	3300048914	Bacteria	2720
405	Ga0496115_0008480	3300048918	Bacteria	7604
406	Ga0496115_0750099	3300048918	Bacteria	763
407	Ga0501300_005724	3300049523	Unclassified	1831
408	Ga0501032_0004194	3300049569	Bacteria	10916
409	Ga0501034_0082082	3300049571	Bacteria	3225
410	Ga0501034_0125657	3300049571	Bacteria	2550
411	Ga0501036_0046058	3300049572	Bacteria	3693
412	Ga0501036_0246607	3300049572	Unclassified	1497
413	Ga0501037_0070692	3300049573	Bacteria	2539
414	Ga0501037_0081748	3300049573	Bacteria	2342
415	Ga0501037_0090316	3300049573	Unclassified	2216
416	Ga0501038_0012937	3300049574	Bacteria	7613
417	Ga0501039_0021089	3300049575	Bacteria	4997
418	Ga0501039_0397268	3300049575	Bacteria	1083
419	Ga0501043_0037407	3300049579	Bacteria	3817
420	Ga0501043_0037728	3300049579	Bacteria	3800
421	Ga0501043_0099252	3300049579	Bacteria	2289
422	Ga0501046_0011616	3300049580	Bacteria	7526
423	Ga0501047_0220912	3300049581	Bacteria	1751
424	Ga0501048_0036531	3300049582	Bacteria	3531
425	Ga0501067_0320374	3300049583	Bacteria	863
426	Ga0501070_0727214	3300049586	Bacteria	784
427	Ga0501074_0094787	3300049590	Bacteria	2137
428	Ga0501210_000533	3300049657	Bacteria	1836
429	Ga0501217_010252	3300049661	Unclassified	2049
430	Ga0501223_004830	3300049663	Bacteria	2864
431	Ga0501236_001959	3300049670	Bacteria	2353
432	Ga0501251_027934	3300049681	Bacteria	789
433	Ga0501083_0013683	3300049744	Bacteria	5674
434	Ga0501264_000722	3300049761	Bacteria	4451
435	Ga0501035_0049777	3300049822	Bacteria	3755
436	Ga0501035_0159975	3300049822	Bacteria	1950
437	Ga0501044_0218722	3300049823	Unclassified	1856
438	nmdc:mga0k408_11496_c1	3300050493	Bacteria	4824
439	nmdc:mga0k408_46661_c1	3300050493	Bacteria	2502
440	nmdc:mga09592_347229_c1	3300050508	Bacteria	1284
441	nmdc:mga06r32_1487898_c1	3300050510	Unclassified	617
442	nmdc:mga08y16_42972_c1	3300050511	Bacteria	4734
443	nmdc:mga08y16_68129_c1	3300050511	Bacteria	3711
444	Ga0500646_0056395	3300053090	Bacteria	1146
445	Ga0500616_0278986	3300053153	Bacteria	702
446	Ga0590075_076293	3300059424	Bacteria	867

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300009176	Ga0105242_10004236	Ga0105242_100042366	148
2	3300025911	Ga0207654_10083671	Ga0207654_100836713	148
3	3300041509	Ga0451843_1652337	Ga0451843_1652337_324_773	148
4	3300049681	Ga0501251_027934	Ga0501251_027934_93_590	153
5	3300053153	Ga0500616_0278986	Ga0500616_0278986_90_590	155
6	iso_pu_bacteria	2839989709	2839992424	155
7	iso_pu_bacteria	2910245624	2910249030	155
8	3300003316	rootH1_10019234	rootH1_1001923412	159
9	3300003320	rootH2_10071687	rootH2_100716872	159
10	3300003322	rootL2_10184856	rootL2_101848564	159
11	3300003322	rootL2_10276523	rootL2_102765233	159
12	3300003323	rootH1_10015770	rootH1_1001577011	159
13	3300003323	rootH1_10037052	rootH1_100370526	159
14	3300003323	rootH1_10037070	rootH1_100370702	159
15	3300003323	rootH1_10042262	rootH1_100422629	159
16	3300005262	Ga0065165_1014484	Ga0065165_10144842	159
17	3300005328	Ga0070676_10017885	Ga0070676_100178852	159
18	3300005328	Ga0070676_10019279	Ga0070676_100192792	159
19	3300005328	Ga0070676_10246114	Ga0070676_102461142	159
20	3300005329	Ga0070683_100087498	Ga0070683_1000874982	159
21	3300005331	Ga0070670_100052282	Ga0070670_1000522822	159
22	3300005331	Ga0070670_100086988	Ga0070670_1000869884	159
23	3300005333	Ga0070677_10005260	Ga0070677_100052603	159
24	3300005334	Ga0068869_100146755	Ga0068869_1001467552	159
25	3300005334	Ga0068869_100175527	Ga0068869_1001755271	159
26	3300005334	Ga0068869_100574013	Ga0068869_1005740131	159
27	3300005335	Ga0070666_10009062	Ga0070666_100090622	159
28	3300005337	Ga0070682_100000044	Ga0070682_1000000444	159
29	3300005338	Ga0068868_100001950	Ga0068868_10000195013	159
30	3300005338	Ga0068868_100043145	Ga0068868_1000431453	159
31	3300005338	Ga0068868_100084823	Ga0068868_1000848232	159
32	3300005338	Ga0068868_100098052	Ga0068868_1000980523	159
33	3300005340	Ga0070689_100005285	Ga0070689_1000052852	159
34	3300005344	Ga0070661_100014590	Ga0070661_1000145902	159
35	3300005344	Ga0070661_100735017	Ga0070661_1007350171	159
36	3300005347	Ga0070668_100036094	Ga0070668_1000360942	159
37	3300005353	Ga0070669_100041950	Ga0070669_1000419504	159
38	3300005354	Ga0070675_100220545	Ga0070675_1002205452	159
39	3300005355	Ga0070671_100077412	Ga0070671_1000774122	159
40	3300005355	Ga0070671_100134157	Ga0070671_1001341572	159
41	3300005356	Ga0070674_100234659	Ga0070674_1002346592	159
42	3300005364	Ga0070673_100007488	Ga0070673_1000074885	159
43	3300005364	Ga0070673_100035166	Ga0070673_1000351663	159
44	3300005365	Ga0070688_100005254	Ga0070688_1000052543	159
45	3300005365	Ga0070688_100905940	Ga0070688_1009059401	159
46	3300005367	Ga0070667_100009450	Ga0070667_1000094504	159
47	3300005367	Ga0070667_100088830	Ga0070667_1000888302	159
48	3300005367	Ga0070667_100355989	Ga0070667_1003559892	159
49	3300005367	Ga0070667_100500710	Ga0070667_1005007101	159
50	3300005367	Ga0070667_100528819	Ga0070667_1005288192	159
51	3300005455	Ga0070663_100620519	Ga0070663_1006205192	159
52	3300005455	Ga0070663_100890908	Ga0070663_1008909082	159
53	3300005456	Ga0070678_100008756	Ga0070678_1000087564	159
54	3300005456	Ga0070678_100052658	Ga0070678_1000526582	159
55	3300005457	Ga0070662_100034986	Ga0070662_1000349863	159
56	3300005457	Ga0070662_100514852	Ga0070662_1005148522	159
57	3300005459	Ga0068867_100001703	Ga0068867_10000170312	159
58	3300005459	Ga0068867_100035369	Ga0068867_1000353694	159
59	3300005459	Ga0068867_100077339	Ga0068867_1000773392	159
60	3300005518	Ga0070699_100449508	Ga0070699_1004495082	159
61	3300005535	Ga0070684_100010684	Ga0070684_1000106847	159
62	3300005539	Ga0068853_100072516	Ga0068853_1000725161	159
63	3300005543	Ga0070672_100006683	Ga0070672_1000066835	159
64	3300005543	Ga0070672_100035809	Ga0070672_1000358092	159
65	3300005544	Ga0070686_100151912	Ga0070686_1001519122	159
66	3300005548	Ga0070665_100045100	Ga0070665_1000451002	159
67	3300005548	Ga0070665_100322144	Ga0070665_1003221442	159
68	3300005564	Ga0070664_100010065	Ga0070664_1000100652	159
69	3300005564	Ga0070664_100559587	Ga0070664_1005595872	159
70	3300005577	Ga0068857_100039837	Ga0068857_1000398372	159
71	3300005578	Ga0068854_100030289	Ga0068854_1000302893	159
72	3300005578	Ga0068854_100301672	Ga0068854_1003016722	159
73	3300005614	Ga0068856_100179618	Ga0068856_1001796182	159
74	3300005617	Ga0068859_100066631	Ga0068859_1000666312	159
75	3300005617	Ga0068859_100202762	Ga0068859_1002027622	159
76	3300005617	Ga0068859_100216204	Ga0068859_1002162042	159
77	3300005617	Ga0068859_100307599	Ga0068859_1003075992	159
78	3300005617	Ga0068859_100399066	Ga0068859_1003990661	159
79	3300005618	Ga0068864_100052879	Ga0068864_1000528792	159
80	3300005718	Ga0068866_10018833	Ga0068866_100188332	159
81	3300005718	Ga0068866_10023694	Ga0068866_100236942	159
82	3300005834	Ga0068851_10093384	Ga0068851_100933842	159
83	3300005834	Ga0068851_10313135	Ga0068851_103131352	159
84	3300005840	Ga0068870_10013382	Ga0068870_100133823	159
85	3300005841	Ga0068863_100139222	Ga0068863_1001392223	159
86	3300005841	Ga0068863_101916967	Ga0068863_1019169671	159
87	3300005842	Ga0068858_100285677	Ga0068858_1002856772	159
88	3300005843	Ga0068860_100028713	Ga0068860_1000287133	159
89	3300005844	Ga0068862_100498956	Ga0068862_1004989561	159
90	3300006195	Ga0075366_10020956	Ga0075366_100209563	159
91	3300006237	Ga0097621_100088421	Ga0097621_1000884212	159
92	3300006358	Ga0068871_100154122	Ga0068871_1001541222	159
93	3300006881	Ga0068865_100007419	Ga0068865_1000074194	159
94	3300006881	Ga0068865_100192101	Ga0068865_1001921012	159
95	3300006931	Ga0097620_100066632	Ga0097620_1000666322	159
96	3300006931	Ga0097620_100202765	Ga0097620_1002027652	159
97	3300006931	Ga0097620_100216219	Ga0097620_1002162192	159
98	3300006931	Ga0097620_100307578	Ga0097620_1003075782	159
99	3300006931	Ga0097620_100399047	Ga0097620_1003990471	159
100	3300009093	Ga0105240_10000263	Ga0105240_1000026311	159
101	3300009148	Ga0105243_10351156	Ga0105243_103511561	159
102	3300009174	Ga0105241_10000384	Ga0105241_1000038411	159
103	3300009174	Ga0105241_10053980	Ga0105241_100539802	159
104	3300009176	Ga0105242_10311998	Ga0105242_103119982	159
105	3300009177	Ga0105248_10293026	Ga0105248_102930262	159
106	3300009177	Ga0105248_12241268	Ga0105248_122412681	159
107	3300009545	Ga0105237_10015253	Ga0105237_100152533	159
108	3300009551	Ga0105238_10000536	Ga0105238_1000053620	159
109	3300009553	Ga0105249_10018666	Ga0105249_100186665	159
110	3300009553	Ga0105249_10051417	Ga0105249_100514173	159
111	3300009553	Ga0105249_10067702	Ga0105249_100677023	159
112	3300009553	Ga0105249_10626920	Ga0105249_106269202	159
113	3300009553	Ga0105249_10887002	Ga0105249_108870021	159
114	3300009553	Ga0105249_10955690	Ga0105249_109556902	159
115	3300009553	Ga0105249_11381920	Ga0105249_113819201	159
116	3300009553	Ga0105249_11593814	Ga0105249_115938141	159
117	3300010375	Ga0105239_10004319	Ga0105239_100043198	159
118	3300010375	Ga0105239_10353846	Ga0105239_103538462	159
119	3300010375	Ga0105239_10711924	Ga0105239_107119242	159
120	3300011119	Ga0105246_10020739	Ga0105246_100207392	159
121	3300011119	Ga0105246_10282940	Ga0105246_102829401	159
122	3300013296	Ga0157374_10018673	Ga0157374_100186732	159
123	3300013296	Ga0157374_10053957	Ga0157374_100539573	159
124	3300013297	Ga0157378_10040087	Ga0157378_100400873	159
125	3300013297	Ga0157378_10040776	Ga0157378_100407764	159
126	3300013297	Ga0157378_10055412	Ga0157378_100554123	159
127	3300013306	Ga0163162_10006680	Ga0163162_100066802	159
128	3300013306	Ga0163162_10013609	Ga0163162_100136095	159
129	3300013306	Ga0163162_10181511	Ga0163162_101815112	159
130	3300013306	Ga0163162_10217582	Ga0163162_102175821	159
131	3300013306	Ga0163162_11032835	Ga0163162_110328352	159
132	3300013307	Ga0157372_10741418	Ga0157372_107414182	159
133	3300013307	Ga0157372_11389841	Ga0157372_113898411	159
134	3300013308	Ga0157375_10003373	Ga0157375_100033732	159
135	3300013308	Ga0157375_10015071	Ga0157375_100150717	159
136	3300013308	Ga0157375_10038254	Ga0157375_100382543	159
137	3300014325	Ga0163163_10001267	Ga0163163_100012673	159
138	3300014325	Ga0163163_10084270	Ga0163163_100842703	159
139	3300014325	Ga0163163_10178860	Ga0163163_101788603	159
140	3300014325	Ga0163163_11563780	Ga0163163_115637802	159
141	3300014326	Ga0157380_10171989	Ga0157380_101719893	159
142	3300014326	Ga0157380_10272033	Ga0157380_102720333	159
143	3300014326	Ga0157380_10465454	Ga0157380_104654543	159
144	3300014326	Ga0157380_10676268	Ga0157380_106762682	159
145	3300014326	Ga0157380_11258877	Ga0157380_112588772	159
146	3300014326	Ga0157380_11450122	Ga0157380_114501222	159
147	3300014745	Ga0157377_10030923	Ga0157377_100309232	159
148	3300014745	Ga0157377_10190271	Ga0157377_101902712	159
149	3300014745	Ga0157377_10281154	Ga0157377_102811542	159
150	3300014968	Ga0157379_10060338	Ga0157379_100603382	159
151	3300014968	Ga0157379_10231472	Ga0157379_102314722	159
152	3300014969	Ga0157376_10003039	Ga0157376_100030392	159
153	3300014969	Ga0157376_10249930	Ga0157376_102499302	159
154	3300014969	Ga0157376_10353049	Ga0157376_103530492	159
155	3300025315	Ga0207697_10023743	Ga0207697_100237433	159
156	3300025901	Ga0207688_10041309	Ga0207688_100413091	159
157	3300025903	Ga0207680_10019077	Ga0207680_100190772	159
158	3300025904	Ga0207647_10051106	Ga0207647_100511061	159
159	3300025907	Ga0207645_10001413	Ga0207645_1000141313	159
160	3300025907	Ga0207645_10073434	Ga0207645_100734342	159
161	3300025907	Ga0207645_10527396	Ga0207645_105273961	159
162	3300025908	Ga0207643_10018778	Ga0207643_100187782	159
163	3300025908	Ga0207643_10094115	Ga0207643_100941152	159
164	3300025911	Ga0207654_10000887	Ga0207654_100008877	159
165	3300025913	Ga0207695_10004554	Ga0207695_1000455410	159
166	3300025914	Ga0207671_10001944	Ga0207671_1000194412	159
167	3300025914	Ga0207671_10802584	Ga0207671_108025842	159
168	3300025924	Ga0207694_10000720	Ga0207694_1000072020	159
169	3300025925	Ga0207650_10024854	Ga0207650_100248543	159
170	3300025926	Ga0207659_10010296	Ga0207659_100102966	159
171	3300025931	Ga0207644_10603036	Ga0207644_106030362	159
172	3300025932	Ga0207690_10106176	Ga0207690_101061761	159
173	3300025933	Ga0207706_10039794	Ga0207706_100397943	159
174	3300025933	Ga0207706_10117833	Ga0207706_101178331	159
175	3300025933	Ga0207706_10871013	Ga0207706_108710132	159
176	3300025934	Ga0207686_10123951	Ga0207686_101239512	159
177	3300025937	Ga0207669_10063693	Ga0207669_100636933	159
178	3300025938	Ga0207704_10595649	Ga0207704_105956492	159
179	3300025940	Ga0207691_10011084	Ga0207691_100110846	159
180	3300025940	Ga0207691_10233381	Ga0207691_102333812	159
181	3300025942	Ga0207689_10000939	Ga0207689_1000093923	159
182	3300025942	Ga0207689_10002211	Ga0207689_100022117	159
183	3300025942	Ga0207689_10004402	Ga0207689_100044021	159
184	3300025942	Ga0207689_10202795	Ga0207689_102027952	159
185	3300025944	Ga0207661_10095496	Ga0207661_100954962	159
186	3300025945	Ga0207679_10060263	Ga0207679_100602632	159
187	3300025945	Ga0207679_10942994	Ga0207679_109429941	159
188	3300025960	Ga0207651_10053495	Ga0207651_100534952	159
189	3300025961	Ga0207712_10110889	Ga0207712_101108891	159
190	3300025961	Ga0207712_10183091	Ga0207712_101830912	159
191	3300025961	Ga0207712_10437131	Ga0207712_104371312	159
192	3300025972	Ga0207668_10474750	Ga0207668_104747502	159
193	3300025981	Ga0207640_10064491	Ga0207640_100644912	159
194	3300025981	Ga0207640_10192885	Ga0207640_101928852	159
195	3300025986	Ga0207658_10013413	Ga0207658_100134133	159
196	3300025986	Ga0207658_10128644	Ga0207658_101286442	159
197	3300025986	Ga0207658_10139025	Ga0207658_101390252	159
198	3300025986	Ga0207658_10395624	Ga0207658_103956242	159
199	3300025986	Ga0207658_10922426	Ga0207658_109224261	159
200	3300026023	Ga0207677_10018269	Ga0207677_100182693	159
201	3300026023	Ga0207677_10030799	Ga0207677_100307992	159
202	3300026023	Ga0207677_10055599	Ga0207677_100555992	159
203	3300026023	Ga0207677_10636048	Ga0207677_106360482	159
204	3300026041	Ga0207639_10140300	Ga0207639_101403002	159
205	3300026067	Ga0207678_10201114	Ga0207678_102011142	159
206	3300026078	Ga0207702_10341633	Ga0207702_103416332	159
207	3300026089	Ga0207648_10001686	Ga0207648_1000168616	159
208	3300026089	Ga0207648_10008280	Ga0207648_100082806	159
209	3300026089	Ga0207648_10153066	Ga0207648_101530662	159
210	3300026095	Ga0207676_10005744	Ga0207676_100057449	159
211	3300026116	Ga0207674_10053181	Ga0207674_100531812	159
212	3300026121	Ga0207683_10000535	Ga0207683_1000053521	159
213	3300026121	Ga0207683_10075606	Ga0207683_100756063	159
214	3300026121	Ga0207683_10866189	Ga0207683_108661892	159
215	3300028379	Ga0268266_10052763	Ga0268266_100527634	159
216	3300028379	Ga0268266_10366708	Ga0268266_103667082	159
217	3300028381	Ga0268264_10215345	Ga0268264_102153453	159
218	3300028381	Ga0268264_10585140	Ga0268264_105851401	159
219	3300030745	Ga0316182_1034821	Ga0316182_10348211	159
220	3300031251	Ga0265327_10012523	Ga0265327_100125233	159
221	3300031251	Ga0265327_10133937	Ga0265327_101339372	159
222	3300031731	Ga0307405_10046431	Ga0307405_100464312	159
223	3300031911	Ga0307412_10094126	Ga0307412_100941265	159
224	3300032004	Ga0307414_10401445	Ga0307414_104014452	159
225	3300032004	Ga0307414_10685526	Ga0307414_106855262	159
226	3300032004	Ga0307414_11083955	Ga0307414_110839551	159
227	3300032005	Ga0307411_10030778	Ga0307411_100307782	159
228	3300032005	Ga0307411_11192301	Ga0307411_111923011	159
229	3300035116	Ga0373945_0169204	Ga0373945_0169204_19_513	159
230	3300035171	Ga0373946_0420598	Ga0373946_0420598_132_626	159
231	3300035724	Ga0373933_0604810	Ga0373933_0604810_182_676	159
232	3300036401	Ga0373937_0761740	Ga0373937_0761740_409_903	159
233	3300037418	Ga0395900_0097305	Ga0395900_0097305_963_1442	159
234	3300038443	Ga0395901_0882478	Ga0395901_0882478_266_745	159
235	3300044672	Ga0466982_0033196	Ga0466982_0033196_2283_2762	159
236	3300046454	Ga0495592_0200274	Ga0495592_0200274_779_1273	159
237	3300046499	Ga0495594_0501114	Ga0495594_0501114_38_529	159
238	3300046511	Ga0495608_0179209	Ga0495608_0179209_549_1043	159
239	3300046514	Ga0495618_0773864	Ga0495618_0773864_13_507	159
240	3300046517	Ga0495630_0516863	Ga0495630_0516863_220_714	159
241	3300046533	Ga0495640_0343047	Ga0495640_0343047_202_696	159
242	3300046642	Ga0495634_0736671	Ga0495634_0736671_13_507	159
243	3300047320	Ga0495672_0044833	Ga0495672_0044833_140_619	159
244	3300047472	Ga0495686_0017977	Ga0495686_0017977_3217_3702	159
245	3300047472	Ga0495686_0027415	Ga0495686_0027415_704_1189	159
246	3300048914	Ga0496111_0061606	Ga0496111_0061606_2121_2612	159
247	3300049571	Ga0501034_0082082	Ga0501034_0082082_922_1404	159
248	3300049572	Ga0501036_0046058	Ga0501036_0046058_3189_3671	159
249	3300049572	Ga0501036_0246607	Ga0501036_0246607_895_1380	159
250	3300049573	Ga0501037_0070692	Ga0501037_0070692_539_1021	159
251	3300049573	Ga0501037_0090316	Ga0501037_0090316_1593_2078	159
252	3300049574	Ga0501038_0012937	Ga0501038_0012937_3130_3612	159
253	3300049575	Ga0501039_0021089	Ga0501039_0021089_4176_4658	159
254	3300049579	Ga0501043_0037728	Ga0501043_0037728_1551_2033	159
255	3300049579	Ga0501043_0099252	Ga0501043_0099252_1636_2121	159
256	3300049580	Ga0501046_0011616	Ga0501046_0011616_4143_4625	159
257	3300049581	Ga0501047_0220912	Ga0501047_0220912_326_808	159
258	3300049582	Ga0501048_0036531	Ga0501048_0036531_1951_2433	159
259	3300049583	Ga0501067_0320374	Ga0501067_0320374_23_505	159
260	3300049586	Ga0501070_0727214	Ga0501070_0727214_108_590	159
261	3300049590	Ga0501074_0094787	Ga0501074_0094787_768_1250	159
262	3300049663	Ga0501223_004830	Ga0501223_004830_702_1190	159
263	3300049822	Ga0501035_0159975	Ga0501035_0159975_474_956	159
264	3300049823	Ga0501044_0218722	Ga0501044_0218722_898_1383	159
265	3300050493	nmdc:mga0k408_46661_c1	nmdc:mga0k408_46661_c1_1997_2491	159
266	3300053090	Ga0500646_0056395	Ga0500646_0056395_559_1050	159
267	iso_pu_bacteria	2902048731	2902051814	159
268	3300003316	rootH1_10001275	rootH1_1000127514	160
269	3300003320	rootH2_10002905	rootH2_1000290513	160
270	3300003322	rootL2_10000133	rootL2_1000013334	160
271	3300003323	rootH1_10029390	rootH1_1002939013	160
272	3300006844	Ga0075428_100045782	Ga0075428_1000457826	160
273	3300006844	Ga0075428_101490096	Ga0075428_1014900962	160
274	3300006846	Ga0075430_100082739	Ga0075430_1000827393	160
275	3300009094	Ga0111539_10087450	Ga0111539_100874502	160
276	3300009094	Ga0111539_10102168	Ga0111539_101021682	160
277	3300014326	Ga0157380_10147684	Ga0157380_101476842	160
278	3300026041	Ga0207639_11090110	Ga0207639_110901102	160
279	3300027907	Ga0207428_10143919	Ga0207428_101439192	160
280	3300027907	Ga0207428_10432583	Ga0207428_104325832	160
281	3300031548	Ga0307408_100202628	Ga0307408_1002026282	160
282	3300031824	Ga0307413_10502340	Ga0307413_105023401	160
283	3300049523	Ga0501300_005724	Ga0501300_005724_687_1169	160
284	3300049657	Ga0501210_000533	Ga0501210_000533_1131_1619	160
285	3300049661	Ga0501217_010252	Ga0501217_010252_707_1189	160
286	3300049670	Ga0501236_001959	Ga0501236_001959_1400_1888	160
287	3300049761	Ga0501264_000722	Ga0501264_000722_1059_1547	160
288	3300050508	nmdc:mga09592_347229_c1	nmdc:mga09592_347229_c1_246_746	160
289	3300050510	nmdc:mga06r32_1487898_c1	nmdc:mga06r32_1487898_c1_87_587	160
290	3300050511	nmdc:mga08y16_42972_c1	nmdc:mga08y16_42972_c1_2152_2640	160
291	3300050511	nmdc:mga08y16_68129_c1	nmdc:mga08y16_68129_c1_2779_3279	160
292	3300059424	Ga0590075_076293	Ga0590075_076293_155_637	160
293	iso_pu_bacteria	2739367656	2739617255	160
294	3300005355	Ga0070671_100321168	Ga0070671_1003211681	161
295	3300005618	Ga0068864_100734872	Ga0068864_1007348722	161
296	3300005841	Ga0068863_100036503	Ga0068863_1000365032	161
297	3300013308	Ga0157375_10371592	Ga0157375_103715922	161
298	3300025931	Ga0207644_10366492	Ga0207644_103664922	161
299	3300026088	Ga0207641_10232203	Ga0207641_102322032	161
300	3300046660	Ga0495625_0047308	Ga0495625_0047308_1569_2054	161
301	3300005328	Ga0070676_10000263	Ga0070676_1000026315	162
302	3300005330	Ga0070690_100311665	Ga0070690_1003116652	162
303	3300005331	Ga0070670_100078185	Ga0070670_1000781852	162
304	3300005335	Ga0070666_10004806	Ga0070666_100048066	162
305	3300005338	Ga0068868_100003187	Ga0068868_1000031873	162
306	3300005347	Ga0070668_100000106	Ga0070668_10000010629	162
307	3300005364	Ga0070673_100000229	Ga0070673_10000022912	162
308	3300005367	Ga0070667_100000931	Ga0070667_10000093123	162
309	3300005441	Ga0070700_100635377	Ga0070700_1006353771	162
310	3300005455	Ga0070663_100104642	Ga0070663_1001046421	162
311	3300005456	Ga0070678_100193333	Ga0070678_1001933332	162
312	3300005457	Ga0070662_100009238	Ga0070662_1000092386	162
313	3300005459	Ga0068867_100009241	Ga0068867_1000092415	162
314	3300005539	Ga0068853_100180102	Ga0068853_1001801023	162
315	3300005543	Ga0070672_100000325	Ga0070672_10000032516	162
316	3300005548	Ga0070665_100000570	Ga0070665_10000057023	162
317	3300005563	Ga0068855_100432613	Ga0068855_1004326133	162
318	3300005564	Ga0070664_101929676	Ga0070664_1019296761	162
319	3300005618	Ga0068864_100001209	Ga0068864_10000120918	162
320	3300005718	Ga0068866_11183043	Ga0068866_111830431	162
321	3300005841	Ga0068863_100003303	Ga0068863_10000330314	162
322	3300005842	Ga0068858_100001322	Ga0068858_10000132224	162
323	3300005843	Ga0068860_100014141	Ga0068860_1000141416	162
324	3300005843	Ga0068860_100084825	Ga0068860_1000848254	162
325	3300005843	Ga0068860_100265273	Ga0068860_1002652732	162
326	3300006237	Ga0097621_100015299	Ga0097621_1000152994	162
327	3300006358	Ga0068871_100002881	Ga0068871_1000028817	162
328	3300006881	Ga0068865_100000299	Ga0068865_10000029916	162
329	3300006931	Ga0097620_100864394	Ga0097620_1008643942	162
330	3300009093	Ga0105240_10137465	Ga0105240_101374653	162
331	3300009098	Ga0105245_10366720	Ga0105245_103667203	162
332	3300009148	Ga0105243_10270072	Ga0105243_102700722	162
333	3300009176	Ga0105242_10022831	Ga0105242_100228316	162
334	3300009545	Ga0105237_10770574	Ga0105237_107705741	162
335	3300009553	Ga0105249_10004490	Ga0105249_100044902	162
336	3300011119	Ga0105246_10096265	Ga0105246_100962653	162
337	3300013296	Ga0157374_10000089	Ga0157374_1000008933	162
338	3300013297	Ga0157378_10005286	Ga0157378_100052866	162
339	3300013306	Ga0163162_10000084	Ga0163162_1000008418	162
340	3300013307	Ga0157372_10062059	Ga0157372_100620593	162
341	3300013308	Ga0157375_10000057	Ga0157375_100000579	162
342	3300014325	Ga0163163_10000804	Ga0163163_1000080420	162
343	3300014326	Ga0157380_10203522	Ga0157380_102035221	162
344	3300014968	Ga0157379_10000032	Ga0157379_1000003222	162
345	3300014969	Ga0157376_10000318	Ga0157376_100003186	162
346	3300017792	Ga0163161_10030785	Ga0163161_100307853	162
347	3300025315	Ga0207697_10255000	Ga0207697_102550001	162
348	3300025901	Ga0207688_10384720	Ga0207688_103847201	162
349	3300025903	Ga0207680_10000845	Ga0207680_1000084512	162
350	3300025904	Ga0207647_10173864	Ga0207647_101738642	162
351	3300025907	Ga0207645_10000638	Ga0207645_100006388	162
352	3300025913	Ga0207695_10125536	Ga0207695_101255363	162
353	3300025914	Ga0207671_10461159	Ga0207671_104611592	162
354	3300025925	Ga0207650_10199635	Ga0207650_101996352	162
355	3300025927	Ga0207687_10248283	Ga0207687_102482831	162
356	3300025932	Ga0207690_10670516	Ga0207690_106705162	162
357	3300025933	Ga0207706_10007388	Ga0207706_100073887	162
358	3300025934	Ga0207686_10078238	Ga0207686_100782382	162
359	3300025935	Ga0207709_10235997	Ga0207709_102359972	162
360	3300025938	Ga0207704_10145975	Ga0207704_101459752	162
361	3300025940	Ga0207691_10000014	Ga0207691_1000001483	162
362	3300025945	Ga0207679_11238372	Ga0207679_112383722	162
363	3300025949	Ga0207667_10427435	Ga0207667_104274353	162
364	3300025960	Ga0207651_10000826	Ga0207651_100008262	162
365	3300025961	Ga0207712_10012835	Ga0207712_100128355	162
366	3300025961	Ga0207712_10014875	Ga0207712_100148752	162
367	3300025972	Ga0207668_10000124	Ga0207668_100001249	162
368	3300025986	Ga0207658_10000242	Ga0207658_1000024230	162
369	3300026023	Ga0207677_10003043	Ga0207677_100030432	162
370	3300026035	Ga0207703_10000735	Ga0207703_100007352	162
371	3300026041	Ga0207639_10140366	Ga0207639_101403662	162
372	3300026067	Ga0207678_10123011	Ga0207678_101230112	162
373	3300026088	Ga0207641_10013162	Ga0207641_100131623	162
374	3300026089	Ga0207648_10028788	Ga0207648_100287882	162
375	3300026116	Ga0207674_11079929	Ga0207674_110799292	162
376	3300026121	Ga0207683_10557788	Ga0207683_105577881	162
377	3300028381	Ga0268264_10003731	Ga0268264_100037312	162
378	3300028381	Ga0268264_10440701	Ga0268264_104407011	162
379	3300028381	Ga0268264_10587883	Ga0268264_105878831	162
380	3300048912	Ga0496109_0079110	Ga0496109_0079110_792_1283	162
381	3300003323	rootH1_10144022	rootH1_101440222	163
382	3300005338	Ga0068868_100764009	Ga0068868_1007640092	163
383	3300005353	Ga0070669_100491504	Ga0070669_1004915042	163
384	3300005355	Ga0070671_100002242	Ga0070671_1000022423	163
385	3300005539	Ga0068853_100870889	Ga0068853_1008708892	163
386	3300005719	Ga0068861_100728722	Ga0068861_1007287222	163
387	3300005841	Ga0068863_100073161	Ga0068863_1000731612	163
388	3300006237	Ga0097621_100000143	Ga0097621_10000014330	163
389	3300006358	Ga0068871_100000741	Ga0068871_1000007415	163
390	3300009553	Ga0105249_10015175	Ga0105249_100151753	163
391	3300013102	Ga0157371_10540030	Ga0157371_105400302	163
392	3300014968	Ga0157379_10022190	Ga0157379_100221904	163
393	3300014969	Ga0157376_10609042	Ga0157376_106090421	163
394	3300017792	Ga0163161_10001232	Ga0163161_100012327	163
395	3300017792	Ga0163161_10094297	Ga0163161_100942972	163
396	3300025923	Ga0207681_10471492	Ga0207681_104714922	163
397	3300025931	Ga0207644_10002179	Ga0207644_100021792	163
398	3300025972	Ga0207668_10767079	Ga0207668_107670791	163
399	3300026088	Ga0207641_10143459	Ga0207641_101434593	163
400	3300046648	Ga0495611_0040188	Ga0495611_0040188_260_760	163
401	3300048918	Ga0496115_0008480	Ga0496115_0008480_1782_2336	163
402	3300049569	Ga0501032_0004194	Ga0501032_0004194_2890_3417	163
403	3300049571	Ga0501034_0125657	Ga0501034_0125657_1894_2421	163
404	3300049573	Ga0501037_0081748	Ga0501037_0081748_640_1167	163
405	3300049575	Ga0501039_0397268	Ga0501039_0397268_171_698	163
406	3300049579	Ga0501043_0037407	Ga0501043_0037407_1246_1773	163
407	3300049744	Ga0501083_0013683	Ga0501083_0013683_2900_3427	163
408	3300049822	Ga0501035_0049777	Ga0501035_0049777_499_1026	163
409	3300050493	nmdc:mga0k408_11496_c1	nmdc:mga0k408_11496_c1_2593_3138	163
410	iso_pu_bacteria	2585427687	2586209044	163
411	iso_pu_bacteria	2738541302	2738855620	163
412	iso_pu_bacteria	2739367651	2739590503	163
413	iso_pu_bacteria	2739367663	2739647514	163
414	3300002773	JGI25152J39213_1000017	JGI25152J39213_100001732	164
415	3300002774	JGI25150J39212_1000001	JGI25150J39212_1000001706	164
416	3300003187	JGI25151J46595_10000001	JGI25151J46595_1000000199	164
417	3300003215	JGI25153J46596_10000053	JGI25153J46596_1000005313	164
418	3300003781	Ga0055536_1000001	Ga0055536_1000001106	164
419	3300003791	Ga0055530_10006389	Ga0055530_100063892	164
420	3300005288	Ga0065714_10002285	Ga0065714_1000228529	164
421	3300005288	Ga0065714_10002947	Ga0065714_100029479	164
422	3300005563	Ga0068855_100301826	Ga0068855_1003018262	164
423	3300013100	Ga0157373_10271312	Ga0157373_102713121	164
424	3300013102	Ga0157371_10000021	Ga0157371_10000021180	164
425	3300013104	Ga0157370_10004406	Ga0157370_100044067	164
426	3300013104	Ga0157370_10178601	Ga0157370_101786014	164
427	3300013105	Ga0157369_10000008	Ga0157369_10000008173	164
428	3300013306	Ga0163162_10000206	Ga0163162_100002063	164
429	3300013307	Ga0157372_11217905	Ga0157372_112179052	164
430	3300014497	Ga0182008_10002479	Ga0182008_100024799	164
431	3300015261	Ga0182006_1000091	Ga0182006_100009136	164
432	3300015261	Ga0182006_1001551	Ga0182006_10015514	164
433	3300015262	Ga0182007_10000003	Ga0182007_1000000389	164
434	3300015682	Ga0183373_1001	Ga0183373_1001881	164
435	3300017792	Ga0163161_10023384	Ga0163161_100233843	164
436	3300017792	Ga0163161_10081322	Ga0163161_100813223	164
437	3300017792	Ga0163161_11291937	Ga0163161_112919371	164
438	3300025245	Ga0207425_1000002	Ga0207425_1000002470	164
439	3300025258	Ga0209129_1000002	Ga0209129_1000002470	164
440	3300025292	Ga0209676_1000008	Ga0209676_1000008752	164
441	3300025294	Ga0209025_1000004	Ga0209025_1000004720	164
442	3300025297	Ga0209758_1000006	Ga0209758_1000006720	164
443	3300025298	Ga0209050_1000045	Ga0209050_100004533	164
444	3300031731	Ga0307405_10000042	Ga0307405_1000004247	164
445	3300031903	Ga0307407_10000022	Ga0307407_10000022101	164
446	3300032002	Ga0307416_100000047	Ga0307416_100000047101	164
447	3300032004	Ga0307414_10100651	Ga0307414_101006512	164
448	3300032005	Ga0307411_10609076	Ga0307411_106090761	164
449	3300046507	Ga0495606_0160420	Ga0495606_0160420_475_981	164
450	3300046512	Ga0495610_0002045	Ga0495610_0002045_12141_12662	164
451	3300046512	Ga0495610_0005738	Ga0495610_0005738_6083_6595	164
452	3300046520	Ga0495637_0047683	Ga0495637_0047683_524_1045	164
453	3300048918	Ga0496115_0750099	Ga0496115_0750099_221_727	164
454	iso_pu_bacteria	2818991437	2819549304	164
455	iso_pu_bacteria	2842722452	2842724815	164
456	iso_pu_bacteria	2842909656	2842913165	164
457	iso_pu_bacteria	2849281842	2849286928	164
458	iso_pu_bacteria	2904445276	2904448303	164
459	iso_pu_bacteria	2945997725	2946001803	164
460	iso_pu_bacteria	2954016120	2954018638	164

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01288

HPPK

7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)

34

161

0.95 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
2cg8-assembly1.cif.gz_B-2	the bifunctional dihydroneopterin aldolase 6-hydroxymethyl-7,8- dihydropterin synthase from streptococcus pneumoniae	0.9568	4	153
2cg8-assembly1.cif.gz_D-2	the bifunctional dihydroneopterin aldolase 6-hydroxymethyl-7,8- dihydropterin synthase from streptococcus pneumoniae	0.9547	4	153
2cg8-assembly1.cif.gz_C-2	the bifunctional dihydroneopterin aldolase 6-hydroxymethyl-7,8- dihydropterin synthase from streptococcus pneumoniae	0.9435	4	153
2cg8-assembly1.cif.gz_A-2	the bifunctional dihydroneopterin aldolase 6-hydroxymethyl-7,8- dihydropterin synthase from streptococcus pneumoniae	0.9395	4	153
4m5j-assembly1.cif.gz_A	the identification, analysis and structure-based development of novel inhibitors of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase	0.931	6	164

ID	Description	Score	Start	End	Superfamily
af_Q54YD9_144_293_3.30.70.560	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK	0.9779	6	154	3.30.70.560
af_Q54YD9_144_293_3.30.70.560	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK	0.9524	6	154	3.30.70.560
af_Q4LB35_295_465_3.30.70.560	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK	0.9457	6	163	3.30.70.560
af_A0A1D8PN03_274_470_3.30.70.560	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK	0.9433	4	153	3.30.70.560
2cg8A02	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK	0.9393	7	152	3.30.70.560

ID	Description	Score	Start	End	GO Terms
AF-A0A520IV99-F1-model_v4	2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC 2.7.6.3)	0.9866	1	164	GO:0003848 GO:0005524 GO:0016301 GO:0046654 GO:0046656
AF-A0A0Q5TMP6-F1-model_v4	2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC 2.7.6.3)	0.9854	1	164	GO:0003848 GO:0005524 GO:0016301 GO:0046654 GO:0046656
AF-A0A4Q6B3P6-F1-model_v4	2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC 2.7.6.3)	0.985	6	111	GO:0003848 GO:0005524 GO:0016301 GO:0046654 GO:0046656
AF-A0A7J2JKP9-F1-model_v4	2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC 2.7.6.3)	0.9835	6	153	GO:0003848 GO:0003908 GO:0005524 GO:0006281 GO:0016301 GO:0032259 GO:0046654 GO:0046656
AF-A0A519UMX4-F1-model_v4	2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC 2.7.6.3)	0.9795	8	164	GO:0003848 GO:0005524 GO:0016301 GO:0046654 GO:0046656

Feature Viewer

pLDDT	pTM	Quality
93.81	0.9	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F448560

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01288

HPPK

7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)

34

161

0.95

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map