F448504

General Info

Members Datasets Scaffolds Average Seq Length
460 263 920 240

Family's Representative Sequence

Representative Sequence 3300005530|Ga0070679_100576174|Ga0070679_1005761742
Length 266
Sequence LRLAFKARYSSLQDATGTGASPTQIAAGLHRLGSGPHSSIVNSYLVVTDDGVTVVDAGLPRYSRLLEQELASIGRSLDDIRALVLTHGDSDHIGFASWLHRERGIPAHVHEADVDRARLEVKKPNTGWGPVKVGPMTGFLWYSARHGGLRIPPVAEVLTVSDGEVLDVPGSPRIVHVPGHTPGSVAVHVPSVDALFLGDAMTTRNVLTGAEGPKPAPFTLDPDQAAESLERIAAVDATWVLPGHGPAWDGGVPEAVRLIRAGRPGA

Samples

Sample ID Description Type Environment
1 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
89 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
90 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
134 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
135 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
139 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
140 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
141 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
148 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
149 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
151 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
152 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
153 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
154 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
155 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
156 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
159 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
160 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
166 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
167 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
168 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
169 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
170 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
171 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
172 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
173 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
174 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
175 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
176 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
179 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
180 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
181 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
182 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
183 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
184 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
185 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
186 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
187 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
188 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
189 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
190 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
191 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
194 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
195 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
196 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
197 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
198 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
199 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
200 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
201 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
202 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
203 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
204 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
205 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
206 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
207 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
208 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
209 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
210 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
211 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
212 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
213 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
214 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
219 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
220 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
223 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
224 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
229 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
230 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
231 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
243 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
244 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
245 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
246 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
247 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
248 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
253 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
254 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
255 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
256 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
257 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
258 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
259 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
260 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
261 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
262 2643221616 Leifsonia sp. Root227 Isolate Unclassified
263 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.26
Metatranscriptomes 1.3
Isolates 0.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.22
Rhizosphere 91.3
Stem 0
Stem Tuber 0
Unclassified 3.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070679_100576174 3300005530 Bacteria 1069
2 rootH2_10256773 3300003320 Bacteria 2419
3 Ga0070658_10000516 3300005327 Bacteria 33519
4 Ga0070658_10008540 3300005327 Bacteria 8235
5 Ga0070658_10015895 3300005327 Bacteria 6019
6 Ga0070658_10017894 3300005327 Bacteria 5668
7 Ga0070683_100053661 3300005329 Bacteria 3735
8 Ga0070683_100060897 3300005329 Bacteria 3508
9 Ga0070683_100176098 3300005329 Bacteria 2030
10 Ga0070683_100201930 3300005329 Bacteria 1888
11 Ga0068869_100010203 3300005334 Bacteria 6118
12 Ga0070680_100099531 3300005336 Bacteria 2412
13 Ga0070682_100005502 3300005337 Bacteria 7050
14 Ga0070682_100005554 3300005337 Bacteria 7023
15 Ga0068868_100033639 3300005338 Bacteria 3952
16 Ga0070660_100141695 3300005339 Bacteria 1929
17 Ga0070660_100176682 3300005339 Bacteria 1727
18 Ga0070660_100258793 3300005339 Bacteria 1421
19 Ga0070689_100085316 3300005340 Bacteria 2483
20 Ga0070691_10030598 3300005341 Bacteria 2522
21 Ga0070691_10217258 3300005341 Bacteria 1011
22 Ga0070661_100239882 3300005344 Bacteria 1396
23 Ga0070668_100183312 3300005347 Bacteria 1711
24 Ga0070669_100528690 3300005353 Unclassified 981
25 Ga0070675_100024434 3300005354 Bacteria 4839
26 Ga0070671_100284852 3300005355 Bacteria 1406
27 Ga0070688_100063994 3300005365 Bacteria 2333
28 Ga0070659_100014812 3300005366 Bacteria 5831
29 Ga0070709_10266085 3300005434 Bacteria 1240
30 Ga0070709_10473775 3300005434 Bacteria 947
31 Ga0070714_100019555 3300005435 Bacteria 5519
32 Ga0070714_100036770 3300005435 Bacteria 4109
33 Ga0070714_100139220 3300005435 Bacteria 2176
34 Ga0070714_100884584 3300005435 Bacteria 867
35 Ga0070713_100039624 3300005436 Bacteria 3825
36 Ga0070713_100057621 3300005436 Bacteria 3236
37 Ga0070713_100140361 3300005436 Bacteria 2140
38 Ga0070713_100148680 3300005436 Bacteria 2082
39 Ga0070713_100159520 3300005436 Bacteria 2012
40 Ga0070713_100252017 3300005436 Bacteria 1610
41 Ga0070713_100377282 3300005436 Bacteria 1320
42 Ga0070713_100379143 3300005436 Bacteria 1317
43 Ga0070713_100485892 3300005436 Bacteria 1164
44 Ga0070713_100890279 3300005436 Bacteria 856
45 Ga0070710_10073281 3300005437 Bacteria 1979
46 Ga0070710_10242303 3300005437 Bacteria 1156
47 Ga0070710_10473813 3300005437 Bacteria 852
48 Ga0070711_100019199 3300005439 Bacteria 4382
49 Ga0070711_100135431 3300005439 Bacteria 1840
50 Ga0070700_100000792 3300005441 Bacteria 15526
51 Ga0070694_100402214 3300005444 Bacteria 1072
52 Ga0070694_100535383 3300005444 Unclassified 936
53 Ga0070708_100144652 3300005445 Bacteria 2207
54 Ga0070663_100014913 3300005455 Bacteria 4999
55 Ga0070663_100056149 3300005455 Bacteria 2820
56 Ga0070663_100201195 3300005455 Bacteria 1555
57 Ga0070678_100045894 3300005456 Bacteria 3129
58 Ga0070678_100302508 3300005456 Bacteria 1360
59 Ga0070678_100972235 3300005456 Bacteria 779
60 Ga0070681_10091776 3300005458 Bacteria 2987
61 Ga0070681_10104002 3300005458 Bacteria 2782
62 Ga0070681_10597221 3300005458 Bacteria 1018
63 Ga0070685_10083306 3300005466 Bacteria 1921
64 Ga0070706_100272347 3300005467 Bacteria 1580
65 Ga0070706_100274841 3300005467 Bacteria 1572
66 Ga0070706_100329580 3300005467 Bacteria 1424
67 Ga0070706_100553013 3300005467 Bacteria 1070
68 Ga0070707_100034322 3300005468 Bacteria 4839
69 Ga0070707_100063525 3300005468 Bacteria 3543
70 Ga0070698_100005713 3300005471 Bacteria 13619
71 Ga0070698_100014351 3300005471 Bacteria 8372
72 Ga0070698_100047490 3300005471 Bacteria 4388
73 Ga0070698_100048514 3300005471 Bacteria 4339
74 Ga0070698_100135729 3300005471 Bacteria 2414
75 Ga0070698_100308605 3300005471 Bacteria 1513
76 Ga0070698_100720488 3300005471 Bacteria 940
77 Ga0070699_100020405 3300005518 Bacteria 5715
78 Ga0070699_100381849 3300005518 Bacteria 1272
79 Ga0070679_100022961 3300005530 Bacteria 6102
80 Ga0070679_100064486 3300005530 Bacteria 3651
81 Ga0070679_100243476 3300005530 Bacteria 1756
82 Ga0070684_100027309 3300005535 Bacteria 4815
83 Ga0070684_100029127 3300005535 Bacteria 4676
84 Ga0070684_100065622 3300005535 Bacteria 3186
85 Ga0070684_100169230 3300005535 Bacteria 1984
86 Ga0068853_100150320 3300005539 Bacteria 2096
87 Ga0068853_100388699 3300005539 Bacteria 1304
88 Ga0070686_100595202 3300005544 Unclassified 871
89 Ga0070695_100417962 3300005545 Unclassified 1020
90 Ga0070693_100102576 3300005547 Bacteria 1745
91 Ga0070693_100217724 3300005547 Bacteria 1249
92 Ga0070665_100001661 3300005548 Bacteria 25614
93 Ga0068855_100042624 3300005563 Bacteria 5377
94 Ga0068855_100053849 3300005563 Bacteria 4733
95 Ga0068855_100274690 3300005563 Bacteria 1873
96 Ga0068855_100332795 3300005563 Bacteria 1676
97 Ga0068855_100505894 3300005563 Bacteria 1312
98 Ga0068855_100508615 3300005563 Bacteria 1308
99 Ga0070664_100042955 3300005564 Bacteria 3814
100 Ga0068857_100057524 3300005577 Bacteria 3451
101 Ga0068854_100014583 3300005578 Bacteria 5185
102 Ga0068856_100009057 3300005614 Bacteria 9686
103 Ga0068856_100126178 3300005614 Bacteria 2562
104 Ga0070702_100015259 3300005615 Bacteria 3919
105 Ga0070702_100303510 3300005615 Bacteria 1105
106 Ga0068852_100179596 3300005616 Bacteria 1989
107 Ga0068852_100561847 3300005616 Bacteria 1142
108 Ga0068859_100187577 3300005617 Bacteria 2152
109 Ga0068866_10028439 3300005718 Bacteria 2664
110 Ga0068863_100062301 3300005841 Bacteria 3528
111 Ga0068860_100133500 3300005843 Bacteria 2383
112 Ga0081455_10007932 3300005937 Bacteria 11108
113 Ga0081455_10034276 3300005937 Bacteria 4551
114 Ga0081538_10002924 3300005981 Bacteria 16295
115 Ga0070717_10008244 3300006028 Bacteria 7779
116 Ga0075432_10005229 3300006058 Bacteria 4419
117 Ga0070715_10051042 3300006163 Bacteria 1778
118 Ga0070712_100035263 3300006175 Bacteria 3396
119 Ga0070712_100043572 3300006175 Bacteria 3089
120 Ga0070712_100340526 3300006175 Bacteria 1224
121 Ga0068871_100227133 3300006358 Bacteria 1619
122 Ga0075428_100011386 3300006844 Bacteria 9894
123 Ga0075428_100119697 3300006844 Bacteria 2866
124 Ga0075431_100083442 3300006847 Bacteria 3299
125 Ga0075433_10001397 3300006852 Bacteria 17807
126 Ga0075433_10629576 3300006852 Unclassified 941
127 Ga0075434_100002269 3300006871 Bacteria 16813
128 Ga0075434_100664885 3300006871 Bacteria 1060
129 Ga0075434_100976871 3300006871 Unclassified 861
130 Ga0075429_100011769 3300006880 Bacteria 7588
131 Ga0068865_100021557 3300006881 Bacteria 4192
132 Ga0068865_100360387 3300006881 Unclassified 1180
133 Ga0097620_100187591 3300006931 Bacteria 2152
134 Ga0075435_100003645 3300007076 Bacteria 10486
135 Ga0105240_10146727 3300009093 Bacteria 2815
136 Ga0105240_10609651 3300009093 Unclassified 1201
137 Ga0111539_10098128 3300009094 Bacteria 3441
138 Ga0111539_10401301 3300009094 Bacteria 1597
139 Ga0111539_10523731 3300009094 Bacteria 1381
140 Ga0105245_10004499 3300009098 Bacteria 12324
141 Ga0105245_10079221 3300009098 Bacteria 2999
142 Ga0114129_10003514 3300009147 Bacteria 22049
143 Ga0114129_10116154 3300009147 Bacteria 3688
144 Ga0114129_10817195 3300009147 Bacteria 1188
145 Ga0105243_10053438 3300009148 Bacteria 3204
146 Ga0105243_10079447 3300009148 Bacteria 2674
147 Ga0105248_10993196 3300009177 Unclassified 948
148 Ga0105249_10059383 3300009553 Bacteria 3507
149 Ga0105249_10167311 3300009553 Unclassified 2129
150 Ga0105239_10013800 3300010375 Bacteria 8967
151 Ga0105239_10047854 3300010375 Bacteria 4687
152 Ga0105239_10143486 3300010375 Bacteria 2662
153 Ga0105239_10568579 3300010375 Bacteria 1292
154 Ga0105246_10026874 3300011119 Bacteria 3766
155 Ga0157370_10196604 3300013104 Bacteria 1871
156 Ga0157369_10007419 3300013105 Bacteria 12627
157 Ga0157369_10151218 3300013105 Bacteria 2453
158 Ga0157369_10306656 3300013105 Bacteria 1651
159 Ga0157372_10001247 3300013307 Bacteria 27513
160 Ga0157372_10047526 3300013307 Bacteria 4770
161 Ga0157372_10351622 3300013307 Bacteria 1717
162 Ga0157375_10018422 3300013308 Bacteria 6333
163 Ga0157375_10234675 3300013308 Bacteria 1993
164 Ga0163163_10323484 3300014325 Bacteria 1596
165 Ga0157377_10004933 3300014745 Bacteria 6215
166 Ga0157379_10011389 3300014968 Bacteria 7758
167 Ga0157379_10612118 3300014968 Unclassified 1017
168 Ga0197907_10826955 3300020069 Bacteria 1460
169 Ga0206351_10866841 3300020077 Bacteria 1209
170 Ga0206350_10650183 3300020080 Bacteria 810
171 Ga0206354_11699848 3300020081 Bacteria 1977
172 Ga0206353_11836798 3300020082 Bacteria 2470
173 Ga0213874_10075087 3300021377 Bacteria 1086
174 Ga0213875_10019247 3300021388 Bacteria 3285
175 Ga0213875_10059073 3300021388 Bacteria 1795
176 Ga0224712_10079809 3300022467 Bacteria 1348
177 Ga0207692_10059693 3300025898 Bacteria 1970
178 Ga0207642_10014332 3300025899 Bacteria 2922
179 Ga0207688_10018388 3300025901 Bacteria 3803
180 Ga0207647_10156896 3300025904 Bacteria 1328
181 Ga0207699_10042162 3300025906 Bacteria 2641
182 Ga0207699_10145860 3300025906 Bacteria 1560
183 Ga0207705_10023705 3300025909 Bacteria 4379
184 Ga0207705_10055688 3300025909 Bacteria 2851
185 Ga0207684_10038001 3300025910 Bacteria 4085
186 Ga0207684_10079021 3300025910 Bacteria 2799
187 Ga0207684_10167358 3300025910 Bacteria 1894
188 Ga0207707_10032637 3300025912 Bacteria 4557
189 Ga0207707_10492864 3300025912 Bacteria 1046
190 Ga0207671_10417489 3300025914 Unclassified 1067
191 Ga0207693_10046381 3300025915 Bacteria 3413
192 Ga0207693_10108064 3300025915 Bacteria 2182
193 Ga0207693_10135414 3300025915 Bacteria 1937
194 Ga0207693_10160764 3300025915 Bacteria 1767
195 Ga0207663_10019633 3300025916 Bacteria 3813
196 Ga0207663_10037385 3300025916 Bacteria 2926
197 Ga0207663_10110241 3300025916 Unclassified 1866
198 Ga0207660_10210270 3300025917 Bacteria 1523
199 Ga0207657_10040988 3300025919 Bacteria 4098
200 Ga0207657_10085609 3300025919 Bacteria 2640
201 Ga0207657_10159741 3300025919 Bacteria 1831
202 Ga0207657_10507653 3300025919 Bacteria 944
203 Ga0207652_10012650 3300025921 Bacteria 6824
204 Ga0207652_10015382 3300025921 Bacteria 6213
205 Ga0207652_10044801 3300025921 Bacteria 3770
206 Ga0207652_10210124 3300025921 Bacteria 1752
207 Ga0207646_10016270 3300025922 Bacteria 6983
208 Ga0207646_10031184 3300025922 Bacteria 4827
209 Ga0207659_10013570 3300025926 Bacteria 5224
210 Ga0207700_10013670 3300025928 Bacteria 5291
211 Ga0207700_10215689 3300025928 Bacteria 1624
212 Ga0207700_10764952 3300025928 Bacteria 863
213 Ga0207664_10013593 3300025929 Bacteria 5850
214 Ga0207664_10034462 3300025929 Bacteria 3899
215 Ga0207664_10037537 3300025929 Bacteria 3751
216 Ga0207664_10264045 3300025929 Bacteria 1506
217 Ga0207644_10188897 3300025931 Bacteria 1619
218 Ga0207706_10006907 3300025933 Bacteria 10499
219 Ga0207706_10035259 3300025933 Bacteria 4449
220 Ga0207670_10238278 3300025936 Bacteria 1400
221 Ga0207704_10054777 3300025938 Bacteria 2434
222 Ga0207665_10025931 3300025939 Bacteria 3867
223 Ga0207665_10270784 3300025939 Bacteria 1261
224 Ga0207689_10016750 3300025942 Bacteria 6203
225 Ga0207661_10020915 3300025944 Bacteria 4899
226 Ga0207661_10043061 3300025944 Bacteria 3562
227 Ga0207661_10076737 3300025944 Bacteria 2745
228 Ga0207679_10015468 3300025945 Bacteria 5043
229 Ga0207667_10063114 3300025949 Bacteria 3871
230 Ga0207668_10079712 3300025972 Bacteria 2370
231 Ga0207668_10321493 3300025972 Bacteria 1284
232 Ga0207640_10024772 3300025981 Bacteria 3625
233 Ga0207703_10125870 3300026035 Bacteria 2206
234 Ga0207639_10113976 3300026041 Bacteria 2208
235 Ga0207639_10328141 3300026041 Bacteria 1361
236 Ga0207678_10057951 3300026067 Bacteria 3333
237 Ga0207678_10062740 3300026067 Bacteria 3194
238 Ga0207708_10000262 3300026075 Bacteria 41463
239 Ga0207702_10033924 3300026078 Bacteria 4265
240 Ga0207702_10078680 3300026078 Bacteria 2855
241 Ga0207641_10216290 3300026088 Bacteria 1775
242 Ga0207676_10008675 3300026095 Bacteria 7228
243 Ga0207676_10159961 3300026095 Bacteria 1950
244 Ga0207674_10007640 3300026116 Bacteria 12592
245 Ga0207675_100063711 3300026118 Bacteria 3445
246 Ga0207675_100094580 3300026118 Bacteria 2811
247 Ga0207683_10304388 3300026121 Bacteria 1458
248 Ga0207428_10000880 3300027907 Bacteria 33718
249 Ga0268266_10010174 3300028379 Bacteria 8243
250 Ga0268264_10060594 3300028381 Bacteria 3172
251 Ga0268264_10109188 3300028381 Bacteria 2420
252 Ga0307517_10111393 3300028786 Bacteria 2080
253 Ga0307515_10105314 3300028794 Bacteria 3359
254 Ga0307512_10018660 3300030522 Bacteria 6333
255 Ga0307512_10169635 3300030522 Bacteria 1255
256 Ga0307408_100401938 3300031548 Bacteria 1176
257 Ga0307405_10252701 3300031731 Bacteria 1312
258 Ga0307413_10106186 3300031824 Bacteria 1868
259 Ga0307413_10176987 3300031824 Bacteria 1516
260 Ga0307410_10000111 3300031852 Bacteria 28496
261 Ga0307410_10017319 3300031852 Bacteria 4324
262 Ga0307406_10000655 3300031901 Bacteria 19636
263 Ga0307407_10000768 3300031903 Bacteria 10563
264 Ga0307407_10022068 3300031903 Bacteria 3295
265 Ga0307412_10644938 3300031911 Bacteria 902
266 Ga0307409_100000100 3300031995 Bacteria 31226
267 Ga0307409_100045887 3300031995 Bacteria 3303
268 Ga0307416_100000114 3300032002 Bacteria 48291
269 Ga0307416_100016968 3300032002 Bacteria 5078
270 Ga0307416_100141325 3300032002 Bacteria 2188
271 Ga0307414_10013786 3300032004 Bacteria 4822
272 Ga0307415_100000213 3300032126 Bacteria 25468
273 Ga0307415_100080310 3300032126 Bacteria 2326
274 Ga0307415_100194773 3300032126 Bacteria 1602
275 Ga0373926_0003610 3300035083 Bacteria 5022
276 Ga0373944_0004812 3300035089 Bacteria 3536
277 Ga0373923_0013349 3300035111 Bacteria 3060
278 Ga0373936_0000447 3300035113 Bacteria 13810
279 Ga0373953_0094771 3300035117 Bacteria 1252
280 Ga0373956_0034422 3300035119 Bacteria 2231
281 Ga0373943_0000500 3300035170 Bacteria 16764
282 Ga0373943_0014363 3300035170 Bacteria 3584
283 Ga0373946_0000061 3300035171 Bacteria 29253
284 Ga0373946_0056478 3300035171 Bacteria 1658
285 Ga0373955_0043372 3300035172 Bacteria 2420
286 Ga0373955_0055845 3300035172 Bacteria 2164
287 Ga0373924_0007783 3300035410 Bacteria 3874
288 Ga0373935_0003418 3300035692 Bacteria 9221
289 Ga0373927_0000310 3300035695 Bacteria 38316
290 Ga0373927_0225375 3300035695 Bacteria 1231
291 Ga0373933_0032132 3300035724 Bacteria 3049
292 Ga0373947_0004906 3300035725 Bacteria 7830
293 Ga0373947_0103453 3300035725 Bacteria 1792
294 Ga0373937_0021359 3300036401 Bacteria 5810
295 Ga0373925_0000009 3300037068 Bacteria 243099
296 Ga0373925_0025029 3300037068 Bacteria 4359
297 Ga0373925_0027478 3300037068 Bacteria 4164
298 Ga0373925_0029777 3300037068 Bacteria 4005
299 Ga0436364_0665546 3300037853 Bacteria 27376
300 Ga0436364_0880840 3300037853 Bacteria 1906
301 Ga0395901_0351960 3300038443 Bacteria 1520
302 Ga0436360_0468130 3300039438 Bacteria 896
303 Ga0436360_1156912 3300039438 Bacteria 877
304 Ga0436361_0865239 3300039447 Bacteria 4648
305 Ga0436363_0760983 3300039450 Bacteria 2325
306 Ga0439463_001000 3300042016 Bacteria 7684
307 Ga0466972_0258043 3300044658 Bacteria 815
308 Ga0466966_0075360 3300044684 Bacteria 2108
309 Ga0466961_0036407 3300044693 Bacteria 3159
310 Ga0466961_0049826 3300044693 Unclassified 2676
311 Ga0466963_0002220 3300044694 Bacteria 10750
312 Ga0466963_0012321 3300044694 Bacteria 5230
313 Ga0466963_0056583 3300044694 Bacteria 2610
314 Ga0466963_0075176 3300044694 Bacteria 2279
315 Ga0466963_0079516 3300044694 Bacteria 2218
316 Ga0466963_0149918 3300044694 Bacteria 1619
317 Ga0466963_0314628 3300044694 Bacteria 1102
318 Ga0466971_0045166 3300044719 Bacteria 1979
319 Ga0466970_0235517 3300044765 Bacteria 1024
320 Ga0466957_0304010 3300044842 Bacteria 1072
321 Ga0466959_0074222 3300045049 Bacteria 2460
322 Ga0466959_0114979 3300045049 Bacteria 1917
323 Ga0451576_0419555 3300045051 Bacteria 1404
324 Ga0466958_0007874 3300045836 Bacteria 5889
325 Ga0466958_0199715 3300045836 Bacteria 1272
326 Ga0466967_0001958 3300045976 Bacteria 12466
327 Ga0466967_0004239 3300045976 Bacteria 9626
328 Ga0466967_0029205 3300045976 Bacteria 4612
329 Ga0466967_0039116 3300045976 Bacteria 4074
330 Ga0466967_0047848 3300045976 Bacteria 3730
331 Ga0466967_0067378 3300045976 Bacteria 3193
332 Ga0466967_0150500 3300045976 Bacteria 2174
333 Ga0466967_0359578 3300045976 Bacteria 1410
334 Ga0495592_0268755 3300046454 Bacteria 1120
335 Ga0495629_0098577 3300046459 Bacteria 2039
336 Ga0495629_0138843 3300046459 Bacteria 1691
337 Ga0495641_0014249 3300046461 Bacteria 4310
338 Ga0495651_0017329 3300046462 Bacteria 5579
339 Ga0495651_0137563 3300046462 Bacteria 1775
340 Ga0495651_0192879 3300046462 Bacteria 1432
341 Ga0495653_0010090 3300046463 Bacteria 7726
342 Ga0495653_0021593 3300046463 Bacteria 5215
343 Ga0495653_0166054 3300046463 Bacteria 1528
344 Ga0495580_0259123 3300046472 Bacteria 1189
345 Ga0495582_0016175 3300046473 Bacteria 4087
346 Ga0495639_0030845 3300046475 Bacteria 2384
347 Ga0495662_0025799 3300046476 Bacteria 2838
348 Ga0495664_0050209 3300046477 Bacteria 2476
349 Ga0495608_0105013 3300046511 Bacteria 1819
350 Ga0495618_0034049 3300046514 Bacteria 3193
351 Ga0495628_0072364 3300046516 Bacteria 2686
352 Ga0495628_0276421 3300046516 Bacteria 1248
353 Ga0495666_0011810 3300046526 Bacteria 4354
354 Ga0495652_0073551 3300046529 Bacteria 2845
355 Ga0495652_0092853 3300046529 Bacteria 2465
356 Ga0495640_0071587 3300046533 Bacteria 2326
357 Ga0495640_0072486 3300046533 Bacteria 2308
358 Ga0495645_0205580 3300046543 Bacteria 1332
359 Ga0495667_0004367 3300046559 Bacteria 9546
360 Ga0495667_0014977 3300046559 Bacteria 5239
361 Ga0495634_0039936 3300046642 Bacteria 3194
362 Ga0495634_0162959 3300046642 Bacteria 1405
363 Ga0495635_0000296 3300046663 Bacteria 32118
364 Ga0495635_0003706 3300046663 Bacteria 10595
365 Ga0495657_0010911 3300046675 Bacteria 6816
366 Ga0495657_0013400 3300046675 Bacteria 6053
367 Ga0495599_0049642 3300046678 Bacteria 2630
368 Ga0495646_0181500 3300046680 Bacteria 1155
369 Ga0495624_0029086 3300046690 Bacteria 3607
370 Ga0495624_0031747 3300046690 Bacteria 3430
371 Ga0495670_0350409 3300046691 Unclassified 795
372 Ga0495600_0011741 3300046809 Bacteria 5467
373 Ga0495600_0023113 3300046809 Bacteria 3999
374 Ga0495600_0061496 3300046809 Bacteria 2453
375 Ga0495581_0005567 3300047315 Bacteria 7298
376 Ga0495581_0045588 3300047315 Bacteria 2534
377 Ga0495674_0010331 3300047319 Bacteria 8838
378 Ga0495676_0015447 3300047321 Bacteria 6797
379 Ga0495676_0040560 3300047321 Bacteria 3840
380 Ga0495680_0003275 3300047322 Bacteria 16057
381 Ga0495680_0017131 3300047322 Bacteria 6200
382 Ga0495684_0001517 3300047471 Bacteria 18610
383 Ga0495684_0059359 3300047471 Bacteria 2913
384 Ga0495593_0021383 3300047673 Bacteria 3615
385 Ga0495593_0129941 3300047673 Bacteria 1279
386 Ga0495614_0021833 3300048089 Bacteria 2764
387 Ga0496100_0014381 3300048903 Bacteria 4594
388 Ga0496101_0070165 3300048904 Bacteria 2565
389 Ga0496101_0195525 3300048904 Bacteria 1562
390 Ga0496102_0003189 3300048905 Bacteria 13909
391 Ga0496102_0035264 3300048905 Bacteria 4502
392 Ga0496103_0202631 3300048906 Bacteria 1276
393 Ga0496104_0002837 3300048907 Bacteria 14958
394 Ga0496105_0046407 3300048908 Bacteria 3586
395 Ga0496106_0024509 3300048909 Bacteria 4486
396 Ga0496107_0039447 3300048910 Bacteria 3388
397 Ga0496108_0003122 3300048911 Bacteria 13314
398 Ga0496108_0149561 3300048911 Bacteria 2015
399 Ga0496108_0483520 3300048911 Bacteria 1082
400 Ga0496109_0003253 3300048912 Bacteria 13541
401 Ga0496109_0038059 3300048912 Bacteria 4348
402 Ga0496110_0028979 3300048913 Bacteria 4759
403 Ga0496110_0541665 3300048913 Bacteria 1058
404 Ga0496111_0031359 3300048914 Bacteria 3786
405 Ga0496111_0074931 3300048914 Bacteria 2465
406 Ga0496112_0041461 3300048915 Bacteria 4504
407 Ga0496112_0222061 3300048915 Bacteria 1845
408 Ga0496113_0305095 3300048916 Bacteria 1275
409 Ga0496114_0041723 3300048917 Bacteria 3803
410 Ga0496114_0076441 3300048917 Bacteria 2821
411 Ga0496117_0088174 3300048920 Bacteria 2008
412 Ga0496121_0004395 3300048924 Bacteria 19021
413 Ga0496126_0017225 3300048929 Bacteria 7202
414 Ga0501031_0007363 3300049568 Bacteria 7173
415 Ga0501032_0080133 3300049569 Bacteria 2173
416 Ga0501033_0093302 3300049570 Bacteria 2201
417 Ga0501034_0043684 3300049571 Bacteria 4534
418 Ga0501034_0230514 3300049571 Bacteria 1801
419 Ga0501036_0199814 3300049572 Bacteria 1681
420 Ga0501037_0090414 3300049573 Bacteria 2214
421 Ga0501038_0000544 3300049574 Bacteria 33088
422 Ga0501038_0109913 3300049574 Bacteria 2284
423 Ga0501039_0205928 3300049575 Bacteria 1547
424 Ga0501046_0044604 3300049580 Bacteria 3526
425 Ga0501047_0032479 3300049581 Bacteria 5038
426 Ga0501047_0510540 3300049581 Bacteria 1028
427 Ga0501048_0000855 3300049582 Bacteria 22442
428 Ga0501070_0004682 3300049586 Bacteria 11717
429 Ga0501070_0012491 3300049586 Bacteria 7163
430 Ga0501070_0141107 3300049586 Bacteria 1989
431 Ga0501073_0257254 3300049589 Bacteria 1205
432 Ga0501074_0027866 3300049590 Bacteria 4095
433 Ga0501074_0044591 3300049590 Bacteria 3210
434 Ga0501202_032830 3300049652 Bacteria 1091
435 Ga0501216_052912 3300049660 Bacteria 802
436 Ga0501227_061290 3300049665 Bacteria 965
437 Ga0501221_009984 3300049704 Bacteria 1677
438 Ga0501080_0090179 3300049742 Bacteria 2848
439 Ga0501035_0044912 3300049822 Bacteria 3976
440 Ga0501035_0128703 3300049822 Bacteria 2208
441 Ga0501044_0025066 3300049823 Bacteria 6325
442 Ga0501044_0076870 3300049823 Bacteria 3387
443 nmdc:mga05p37_20732_c1 3300050507 Bacteria 7954
444 nmdc:mga05p37_361215_c1 3300050507 Bacteria 1707
445 nmdc:mga09592_78259_c1 3300050508 Bacteria 2814
446 nmdc:mga06r32_15901_c1 3300050510 Bacteria 6846
447 nmdc:mga08y16_361419_c1 3300050511 Bacteria 1490
448 nmdc:mga08y16_58607_c1 3300050511 Bacteria 4024
449 nmdc:mga08y16_700937_c1 3300050511 Bacteria 1012
450 nmdc:mga08y16_80711_c1 3300050511 Bacteria 3391
451 nmdc:mga0n895_13650_c1 3300050512 Bacteria 7342
452 nmdc:mga0n895_253331_c1 3300050512 Bacteria 1786
453 nmdc:mga0rr50_3128_c1 3300050513 Bacteria 9458
454 nmdc:mga0a205_33599_c1 3300050515 Bacteria 4918
455 nmdc:mga0a205_529643_c1 3300050515 Unclassified 1034
456 Ga0495601_0050423 3300053077 Bacteria 2625
457 Ga0495595_0058386 3300053084 Bacteria 1802
458 Ga0466962_0105274 3300061719 Bacteria 1356
459 2644096038 2643221616 Bacteria 4066575
460 2919524512 2919523602 Bacteria 3788128
461 Ga0070679_100576174
462 rootH2_10256773
463 Ga0070658_10000516
464 Ga0070658_10008540
465 Ga0070658_10015895
466 Ga0070658_10017894
467 Ga0070683_100053661
468 Ga0070683_100060897
469 Ga0070683_100176098
470 Ga0070683_100201930
471 Ga0068869_100010203
472 Ga0070680_100099531
473 Ga0070682_100005502
474 Ga0070682_100005554
475 Ga0068868_100033639
476 Ga0070660_100141695
477 Ga0070660_100176682
478 Ga0070660_100258793
479 Ga0070689_100085316
480 Ga0070691_10030598
481 Ga0070691_10217258
482 Ga0070661_100239882
483 Ga0070668_100183312
484 Ga0070669_100528690
485 Ga0070675_100024434
486 Ga0070671_100284852
487 Ga0070688_100063994
488 Ga0070659_100014812
489 Ga0070709_10266085
490 Ga0070709_10473775
491 Ga0070714_100019555
492 Ga0070714_100036770
493 Ga0070714_100139220
494 Ga0070714_100884584
495 Ga0070713_100039624
496 Ga0070713_100057621
497 Ga0070713_100140361
498 Ga0070713_100148680
499 Ga0070713_100159520
500 Ga0070713_100252017
501 Ga0070713_100377282
502 Ga0070713_100379143
503 Ga0070713_100485892
504 Ga0070713_100890279
505 Ga0070710_10073281
506 Ga0070710_10242303
507 Ga0070710_10473813
508 Ga0070711_100019199
509 Ga0070711_100135431
510 Ga0070700_100000792
511 Ga0070694_100402214
512 Ga0070694_100535383
513 Ga0070708_100144652
514 Ga0070663_100014913
515 Ga0070663_100056149
516 Ga0070663_100201195
517 Ga0070678_100045894
518 Ga0070678_100302508
519 Ga0070678_100972235
520 Ga0070681_10091776
521 Ga0070681_10104002
522 Ga0070681_10597221
523 Ga0070685_10083306
524 Ga0070706_100272347
525 Ga0070706_100274841
526 Ga0070706_100329580
527 Ga0070706_100553013
528 Ga0070707_100034322
529 Ga0070707_100063525
530 Ga0070698_100005713
531 Ga0070698_100014351
532 Ga0070698_100047490
533 Ga0070698_100048514
534 Ga0070698_100135729
535 Ga0070698_100308605
536 Ga0070698_100720488
537 Ga0070699_100020405
538 Ga0070699_100381849
539 Ga0070679_100022961
540 Ga0070679_100064486
541 Ga0070679_100243476
542 Ga0070684_100027309
543 Ga0070684_100029127
544 Ga0070684_100065622
545 Ga0070684_100169230
546 Ga0068853_100150320
547 Ga0068853_100388699
548 Ga0070686_100595202
549 Ga0070695_100417962
550 Ga0070693_100102576
551 Ga0070693_100217724
552 Ga0070665_100001661
553 Ga0068855_100042624
554 Ga0068855_100053849
555 Ga0068855_100274690
556 Ga0068855_100332795
557 Ga0068855_100505894
558 Ga0068855_100508615
559 Ga0070664_100042955
560 Ga0068857_100057524
561 Ga0068854_100014583
562 Ga0068856_100009057
563 Ga0068856_100126178
564 Ga0070702_100015259
565 Ga0070702_100303510
566 Ga0068852_100179596
567 Ga0068852_100561847
568 Ga0068859_100187577
569 Ga0068866_10028439
570 Ga0068863_100062301
571 Ga0068860_100133500
572 Ga0081455_10007932
573 Ga0081455_10034276
574 Ga0081538_10002924
575 Ga0070717_10008244
576 Ga0075432_10005229
577 Ga0070715_10051042
578 Ga0070712_100035263
579 Ga0070712_100043572
580 Ga0070712_100340526
581 Ga0068871_100227133
582 Ga0075428_100011386
583 Ga0075428_100119697
584 Ga0075431_100083442
585 Ga0075433_10001397
586 Ga0075433_10629576
587 Ga0075434_100002269
588 Ga0075434_100664885
589 Ga0075434_100976871
590 Ga0075429_100011769
591 Ga0068865_100021557
592 Ga0068865_100360387
593 Ga0097620_100187591
594 Ga0075435_100003645
595 Ga0105240_10146727
596 Ga0105240_10609651
597 Ga0111539_10098128
598 Ga0111539_10401301
599 Ga0111539_10523731
600 Ga0105245_10004499
601 Ga0105245_10079221
602 Ga0114129_10003514
603 Ga0114129_10116154
604 Ga0114129_10817195
605 Ga0105243_10053438
606 Ga0105243_10079447
607 Ga0105248_10993196
608 Ga0105249_10059383
609 Ga0105249_10167311
610 Ga0105239_10013800
611 Ga0105239_10047854
612 Ga0105239_10143486
613 Ga0105239_10568579
614 Ga0105246_10026874
615 Ga0157370_10196604
616 Ga0157369_10007419
617 Ga0157369_10151218
618 Ga0157369_10306656
619 Ga0157372_10001247
620 Ga0157372_10047526
621 Ga0157372_10351622
622 Ga0157375_10018422
623 Ga0157375_10234675
624 Ga0163163_10323484
625 Ga0157377_10004933
626 Ga0157379_10011389
627 Ga0157379_10612118
628 Ga0197907_10826955
629 Ga0206351_10866841
630 Ga0206350_10650183
631 Ga0206354_11699848
632 Ga0206353_11836798
633 Ga0213874_10075087
634 Ga0213875_10019247
635 Ga0213875_10059073
636 Ga0224712_10079809
637 Ga0207692_10059693
638 Ga0207642_10014332
639 Ga0207688_10018388
640 Ga0207647_10156896
641 Ga0207699_10042162
642 Ga0207699_10145860
643 Ga0207705_10023705
644 Ga0207705_10055688
645 Ga0207684_10038001
646 Ga0207684_10079021
647 Ga0207684_10167358
648 Ga0207707_10032637
649 Ga0207707_10492864
650 Ga0207671_10417489
651 Ga0207693_10046381
652 Ga0207693_10108064
653 Ga0207693_10135414
654 Ga0207693_10160764
655 Ga0207663_10019633
656 Ga0207663_10037385
657 Ga0207663_10110241
658 Ga0207660_10210270
659 Ga0207657_10040988
660 Ga0207657_10085609
661 Ga0207657_10159741
662 Ga0207657_10507653
663 Ga0207652_10012650
664 Ga0207652_10015382
665 Ga0207652_10044801
666 Ga0207652_10210124
667 Ga0207646_10016270
668 Ga0207646_10031184
669 Ga0207659_10013570
670 Ga0207700_10013670
671 Ga0207700_10215689
672 Ga0207700_10764952
673 Ga0207664_10013593
674 Ga0207664_10034462
675 Ga0207664_10037537
676 Ga0207664_10264045
677 Ga0207644_10188897
678 Ga0207706_10006907
679 Ga0207706_10035259
680 Ga0207670_10238278
681 Ga0207704_10054777
682 Ga0207665_10025931
683 Ga0207665_10270784
684 Ga0207689_10016750
685 Ga0207661_10020915
686 Ga0207661_10043061
687 Ga0207661_10076737
688 Ga0207679_10015468
689 Ga0207667_10063114
690 Ga0207668_10079712
691 Ga0207668_10321493
692 Ga0207640_10024772
693 Ga0207703_10125870
694 Ga0207639_10113976
695 Ga0207639_10328141
696 Ga0207678_10057951
697 Ga0207678_10062740
698 Ga0207708_10000262
699 Ga0207702_10033924
700 Ga0207702_10078680
701 Ga0207641_10216290
702 Ga0207676_10008675
703 Ga0207676_10159961
704 Ga0207674_10007640
705 Ga0207675_100063711
706 Ga0207675_100094580
707 Ga0207683_10304388
708 Ga0207428_10000880
709 Ga0268266_10010174
710 Ga0268264_10060594
711 Ga0268264_10109188
712 Ga0307517_10111393
713 Ga0307515_10105314
714 Ga0307512_10018660
715 Ga0307512_10169635
716 Ga0307408_100401938
717 Ga0307405_10252701
718 Ga0307413_10106186
719 Ga0307413_10176987
720 Ga0307410_10000111
721 Ga0307410_10017319
722 Ga0307406_10000655
723 Ga0307407_10000768
724 Ga0307407_10022068
725 Ga0307412_10644938
726 Ga0307409_100000100
727 Ga0307409_100045887
728 Ga0307416_100000114
729 Ga0307416_100016968
730 Ga0307416_100141325
731 Ga0307414_10013786
732 Ga0307415_100000213
733 Ga0307415_100080310
734 Ga0307415_100194773
735 Ga0373926_0003610
736 Ga0373944_0004812
737 Ga0373923_0013349
738 Ga0373936_0000447
739 Ga0373953_0094771
740 Ga0373956_0034422
741 Ga0373943_0000500
742 Ga0373943_0014363
743 Ga0373946_0000061
744 Ga0373946_0056478
745 Ga0373955_0043372
746 Ga0373955_0055845
747 Ga0373924_0007783
748 Ga0373935_0003418
749 Ga0373927_0000310
750 Ga0373927_0225375
751 Ga0373933_0032132
752 Ga0373947_0004906
753 Ga0373947_0103453
754 Ga0373937_0021359
755 Ga0373925_0000009
756 Ga0373925_0025029
757 Ga0373925_0027478
758 Ga0373925_0029777
759 Ga0436364_0665546
760 Ga0436364_0880840
761 Ga0395901_0351960
762 Ga0436360_0468130
763 Ga0436360_1156912
764 Ga0436361_0865239
765 Ga0436363_0760983
766 Ga0439463_001000
767 Ga0466972_0258043
768 Ga0466966_0075360
769 Ga0466961_0036407
770 Ga0466961_0049826
771 Ga0466963_0002220
772 Ga0466963_0012321
773 Ga0466963_0056583
774 Ga0466963_0075176
775 Ga0466963_0079516
776 Ga0466963_0149918
777 Ga0466963_0314628
778 Ga0466971_0045166
779 Ga0466970_0235517
780 Ga0466957_0304010
781 Ga0466959_0074222
782 Ga0466959_0114979
783 Ga0451576_0419555
784 Ga0466958_0007874
785 Ga0466958_0199715
786 Ga0466967_0001958
787 Ga0466967_0004239
788 Ga0466967_0029205
789 Ga0466967_0039116
790 Ga0466967_0047848
791 Ga0466967_0067378
792 Ga0466967_0150500
793 Ga0466967_0359578
794 Ga0495592_0268755
795 Ga0495629_0098577
796 Ga0495629_0138843
797 Ga0495641_0014249
798 Ga0495651_0017329
799 Ga0495651_0137563
800 Ga0495651_0192879
801 Ga0495653_0010090
802 Ga0495653_0021593
803 Ga0495653_0166054
804 Ga0495580_0259123
805 Ga0495582_0016175
806 Ga0495639_0030845
807 Ga0495662_0025799
808 Ga0495664_0050209
809 Ga0495608_0105013
810 Ga0495618_0034049
811 Ga0495628_0072364
812 Ga0495628_0276421
813 Ga0495666_0011810
814 Ga0495652_0073551
815 Ga0495652_0092853
816 Ga0495640_0071587
817 Ga0495640_0072486
818 Ga0495645_0205580
819 Ga0495667_0004367
820 Ga0495667_0014977
821 Ga0495634_0039936
822 Ga0495634_0162959
823 Ga0495635_0000296
824 Ga0495635_0003706
825 Ga0495657_0010911
826 Ga0495657_0013400
827 Ga0495599_0049642
828 Ga0495646_0181500
829 Ga0495624_0029086
830 Ga0495624_0031747
831 Ga0495670_0350409
832 Ga0495600_0011741
833 Ga0495600_0023113
834 Ga0495600_0061496
835 Ga0495581_0005567
836 Ga0495581_0045588
837 Ga0495674_0010331
838 Ga0495676_0015447
839 Ga0495676_0040560
840 Ga0495680_0003275
841 Ga0495680_0017131
842 Ga0495684_0001517
843 Ga0495684_0059359
844 Ga0495593_0021383
845 Ga0495593_0129941
846 Ga0495614_0021833
847 Ga0496100_0014381
848 Ga0496101_0070165
849 Ga0496101_0195525
850 Ga0496102_0003189
851 Ga0496102_0035264
852 Ga0496103_0202631
853 Ga0496104_0002837
854 Ga0496105_0046407
855 Ga0496106_0024509
856 Ga0496107_0039447
857 Ga0496108_0003122
858 Ga0496108_0149561
859 Ga0496108_0483520
860 Ga0496109_0003253
861 Ga0496109_0038059
862 Ga0496110_0028979
863 Ga0496110_0541665
864 Ga0496111_0031359
865 Ga0496111_0074931
866 Ga0496112_0041461
867 Ga0496112_0222061
868 Ga0496113_0305095
869 Ga0496114_0041723
870 Ga0496114_0076441
871 Ga0496117_0088174
872 Ga0496121_0004395
873 Ga0496126_0017225
874 Ga0501031_0007363
875 Ga0501032_0080133
876 Ga0501033_0093302
877 Ga0501034_0043684
878 Ga0501034_0230514
879 Ga0501036_0199814
880 Ga0501037_0090414
881 Ga0501038_0000544
882 Ga0501038_0109913
883 Ga0501039_0205928
884 Ga0501046_0044604
885 Ga0501047_0032479
886 Ga0501047_0510540
887 Ga0501048_0000855
888 Ga0501070_0004682
889 Ga0501070_0012491
890 Ga0501070_0141107
891 Ga0501073_0257254
892 Ga0501074_0027866
893 Ga0501074_0044591
894 Ga0501202_032830
895 Ga0501216_052912
896 Ga0501227_061290
897 Ga0501221_009984
898 Ga0501080_0090179
899 Ga0501035_0044912
900 Ga0501035_0128703
901 Ga0501044_0025066
902 Ga0501044_0076870
903 nmdc:mga05p37_20732_c1
904 nmdc:mga05p37_361215_c1
905 nmdc:mga09592_78259_c1
906 nmdc:mga06r32_15901_c1
907 nmdc:mga08y16_361419_c1
908 nmdc:mga08y16_58607_c1
909 nmdc:mga08y16_700937_c1
910 nmdc:mga08y16_80711_c1
911 nmdc:mga0n895_13650_c1
912 nmdc:mga0n895_253331_c1
913 nmdc:mga0rr50_3128_c1
914 nmdc:mga0a205_33599_c1
915 nmdc:mga0a205_529643_c1
916 Ga0495601_0050423
917 Ga0495595_0058386
918 Ga0466962_0105274
919 2644096038
920 2919524512

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

39

244

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qed-assembly1.cif.gz_A crystal structure of salmonella thyphimurium lt2 glyoxalase ii 0.8239 7 218
7l0b-assembly3.cif.gz_C crystal structure of hydroxyacyl glutathione hydrolase (glob) from staphylococcus aureus, apoenzyme 0.7912 7 224
7l0b-assembly1.cif.gz_A crystal structure of hydroxyacyl glutathione hydrolase (glob) from staphylococcus aureus, apoenzyme 0.7893 7 224
6s0i-assembly1.cif.gz_A crystal structure of escherichia coli glyoxalase ii with l-tartrate in the active site 0.7876 7 218
2zzi-assembly1.cif.gz_A crystal structure of ttha1623 in a di-iron-bound form 0.7775 8 236
ID Description Score Start End Superfamily
af_O86336_13_270_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8832 1 235 3.60.15.10
af_O86336_13_270_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8761 1 235 3.60.15.10
2obwA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8188 7 218 3.60.15.10
af_Q8N490_119_385_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8051 7 218 3.60.15.10
af_I1MD49_73_326_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7974 7 218 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A542YG06-F1-model_v4 Glyoxylase-like metal-dependent hydrolase (Beta-lactamase superfamily II) 0.9896 1 236 GO:0016787
AF-A0A537ZPX9-F1-model_v4 MBL fold metallo-hydrolase 0.9891 140 235 GO:0016787
AF-A0A2N3FDU3-F1-model_v4 MBL fold metallo-hydrolase 0.9866 1 235 GO:0016787
AF-A0A2Y9AQV1-F1-model_v4 Glyoxylase, beta-lactamase superfamily II 0.9861 1 236
AF-A0A4R1VNJ0-F1-model_v4 deleted 0.9859 1 236

Map