F448402

General Info

Members Datasets Scaffolds Average Seq Length
459 228 918 267

Family's Representative Sequence

Representative Sequence 3300042157|Ga0439458_0025634|Ga0439458_0025634_17_955
Length 312
Sequence MRPDAHDPGVAHGFGKGGEGRNGAALALHGPRIGVVEALRQVEGWPAGTVAVAVLRGAEEVASHGPRERAFLWASVTKPVTALATLVAAEEGILELDEPAGPEGSTVRHLLAHASGLPFEGRTPIAEPGRRRIYSNSGFEVLGEVVGAAAEMPFPEYLQAAVLGPLELRTAELRSSPGSGMRGSLDDLARLAAELQRPRLVAPETLAEATSVQFPGLVGVLPDIGRMEPNDWGLGVELRDRKRPHWTGSRNSERTFGHFGGSGTFLWVDPEADLALACLTDLDFGPWSLEAWPALSDAVLAQGSGSVQGHSG

Samples

Sample ID Description Type Environment
1 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
119 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
125 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
126 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
133 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
134 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
135 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
136 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
137 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
138 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
139 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
140 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
141 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
150 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
151 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
152 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
153 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
154 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
155 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
156 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
157 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
158 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
159 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
160 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
161 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
162 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
165 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
168 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
186 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
200 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
201 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
202 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
203 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
204 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
205 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
206 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
207 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
208 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
209 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
210 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
211 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
212 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
215 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
216 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
219 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
223 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
226 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
227 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
228 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.31
Nodule 0
Rhizoplane 10.46
Rhizosphere 87.58
Stem 0
Stem Tuber 0
Unclassified 3.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439458_0025634 3300042157 Bacteria 1384
2 Ga0070676_10299296 3300005328 Bacteria 1090
3 Ga0070683_100039456 3300005329 Bacteria 4335
4 Ga0070683_100523905 3300005329 Bacteria 1133
5 Ga0070690_100120985 3300005330 Bacteria 1757
6 Ga0070680_100154889 3300005336 Bacteria 1925
7 Ga0070682_100051729 3300005337 Bacteria 2568
8 Ga0070682_100117100 3300005337 Unclassified 1783
9 Ga0068868_100010300 3300005338 Bacteria 6762
10 Ga0068868_100015386 3300005338 Bacteria 5656
11 Ga0068868_100222308 3300005338 Bacteria 1581
12 Ga0070660_100011217 3300005339 Bacteria 6361
13 Ga0070689_100216525 3300005340 Bacteria 1569
14 Ga0070691_10014500 3300005341 Bacteria 3617
15 Ga0070691_10019544 3300005341 Bacteria 3127
16 Ga0070687_100015627 3300005343 Bacteria 3438
17 Ga0070692_10002512 3300005345 Bacteria 7140
18 Ga0070692_10032523 3300005345 Bacteria 2623
19 Ga0070671_100254475 3300005355 Bacteria 1492
20 Ga0070674_100036290 3300005356 Bacteria 3308
21 Ga0070674_100048944 3300005356 Bacteria 2903
22 Ga0070674_100138335 3300005356 Bacteria 1825
23 Ga0070688_100003349 3300005365 Bacteria 8215
24 Ga0070659_100054472 3300005366 Bacteria 3150
25 Ga0070659_100290144 3300005366 Bacteria 1362
26 Ga0070709_10023306 3300005434 Bacteria 3632
27 Ga0070710_10090198 3300005437 Bacteria 1807
28 Ga0070711_100491510 3300005439 Bacteria 1010
29 Ga0070705_100017554 3300005440 Bacteria 3736
30 Ga0070700_100023901 3300005441 Bacteria 3580
31 Ga0070700_100282944 3300005441 Bacteria 1203
32 Ga0070708_100152607 3300005445 Bacteria 2149
33 Ga0070708_100186115 3300005445 Bacteria 1942
34 Ga0070708_100244207 3300005445 Bacteria 1686
35 Ga0070708_100333634 3300005445 Bacteria 1429
36 Ga0070678_100003649 3300005456 Bacteria 8593
37 Ga0070678_100430005 3300005456 Bacteria 1153
38 Ga0070662_100041803 3300005457 Bacteria 3272
39 Ga0070662_100126205 3300005457 Bacteria 1967
40 Ga0070681_10006481 3300005458 Bacteria 11391
41 Ga0068867_100005806 3300005459 Bacteria 8757
42 Ga0068867_100021930 3300005459 Bacteria 4561
43 Ga0068867_100062393 3300005459 Bacteria 2769
44 Ga0070685_10041084 3300005466 Bacteria 2634
45 Ga0070706_100018291 3300005467 Bacteria 6466
46 Ga0070707_100531644 3300005468 Bacteria 1138
47 Ga0070698_100040584 3300005471 Bacteria 4782
48 Ga0070699_100033321 3300005518 Bacteria 4450
49 Ga0070679_100326857 3300005530 Bacteria 1482
50 Ga0070684_100187513 3300005535 Bacteria 1881
51 Ga0070684_100214605 3300005535 Unclassified 1754
52 Ga0068853_100007723 3300005539 Bacteria 8623
53 Ga0070672_100017154 3300005543 Bacteria 5206
54 Ga0070686_100104662 3300005544 Bacteria 1917
55 Ga0070695_100045804 3300005545 Bacteria 2789
56 Ga0070696_100053966 3300005546 Bacteria 2799
57 Ga0070704_100453052 3300005549 Bacteria 1105
58 Ga0068855_100128790 3300005563 Bacteria 2892
59 Ga0068856_100122465 3300005614 Bacteria 2603
60 Ga0068856_100128254 3300005614 Bacteria 2540
61 Ga0070702_100020752 3300005615 Bacteria 3446
62 Ga0070702_100058827 3300005615 Bacteria 2228
63 Ga0070702_100092185 3300005615 Unclassified 1840
64 Ga0068852_100092040 3300005616 Bacteria 2715
65 Ga0068866_10005350 3300005718 Bacteria 5295
66 Ga0068866_10010138 3300005718 Bacteria 4029
67 Ga0068866_10052568 3300005718 Bacteria 2079
68 Ga0068861_100075655 3300005719 Bacteria 2622
69 Ga0081455_10013624 3300005937 Bacteria 8012
70 Ga0081455_10017283 3300005937 Bacteria 6923
71 Ga0081455_10097826 3300005937 Bacteria 2364
72 Ga0081540_1003007 3300005983 Bacteria 13504
73 Ga0081540_1010691 3300005983 Bacteria 6187
74 Ga0070717_10053250 3300006028 Bacteria 3335
75 Ga0070717_10145251 3300006028 Bacteria 2049
76 Ga0070717_10476885 3300006028 Bacteria 1126
77 Ga0075365_10057824 3300006038 Bacteria 2580
78 Ga0075364_10054356 3300006051 Bacteria 2618
79 Ga0075364_10211607 3300006051 Bacteria 1315
80 Ga0075432_10002401 3300006058 Bacteria 6240
81 Ga0075432_10009974 3300006058 Bacteria 3226
82 Ga0075432_10079429 3300006058 Bacteria 1188
83 Ga0070712_100022216 3300006175 Bacteria 4176
84 Ga0070712_100023536 3300006175 Bacteria 4070
85 Ga0070712_100061929 3300006175 Bacteria 2645
86 Ga0070712_100508677 3300006175 Bacteria 1010
87 Ga0075428_100029122 3300006844 Bacteria 6110
88 Ga0075428_100034487 3300006844 Bacteria 5581
89 Ga0075428_100281470 3300006844 Bacteria 1789
90 Ga0075428_100486937 3300006844 Bacteria 1320
91 Ga0075430_100374860 3300006846 Bacteria 1175
92 Ga0075431_100032019 3300006847 Bacteria 5418
93 Ga0075431_100142963 3300006847 Bacteria 2466
94 Ga0075431_100153953 3300006847 Bacteria 2366
95 Ga0075433_10002886 3300006852 Bacteria 13178
96 Ga0075434_100007586 3300006871 Bacteria 10046
97 Ga0075434_100017062 3300006871 Bacteria 6986
98 Ga0075434_100050803 3300006871 Bacteria 4119
99 Ga0075434_100067800 3300006871 Bacteria 3554
100 Ga0075434_100091676 3300006871 Bacteria 3041
101 Ga0075434_100193494 3300006871 Bacteria 2054
102 Ga0068865_100667835 3300006881 Unclassified 885
103 Ga0075436_100023487 3300006914 Bacteria 4235
104 Ga0075436_100081987 3300006914 Bacteria 2237
105 Ga0075436_100191381 3300006914 Bacteria 1447
106 Ga0075436_100212329 3300006914 Bacteria 1372
107 Ga0075435_100002102 3300007076 Bacteria 13098
108 Ga0075435_100006211 3300007076 Bacteria 8430
109 Ga0075435_100020818 3300007076 Bacteria 5034
110 Ga0111539_10018517 3300009094 Bacteria 8626
111 Ga0111539_10035388 3300009094 Bacteria 6047
112 Ga0111539_10134282 3300009094 Bacteria 2898
113 Ga0111539_10174925 3300009094 Bacteria 2508
114 Ga0111539_10248492 3300009094 Unclassified 2071
115 Ga0105245_10016804 3300009098 Bacteria 6389
116 Ga0105245_10049159 3300009098 Bacteria 3775
117 Ga0105245_10058127 3300009098 Bacteria 3480
118 Ga0105245_10132556 3300009098 Bacteria 2339
119 Ga0105245_10156401 3300009098 Bacteria 2159
120 Ga0105245_10218984 3300009098 Bacteria 1836
121 Ga0105245_10264225 3300009098 Bacteria 1676
122 Ga0105247_10059820 3300009101 Bacteria 2360
123 Ga0114129_10015577 3300009147 Bacteria 10809
124 Ga0114129_10067185 3300009147 Bacteria 5000
125 Ga0105243_10005429 3300009148 Bacteria 9950
126 Ga0105243_10025826 3300009148 Bacteria 4492
127 Ga0105242_10208772 3300009176 Bacteria 1739
128 Ga0105242_10217154 3300009176 Bacteria 1707
129 Ga0105248_10018487 3300009177 Bacteria 7703
130 Ga0105248_10032669 3300009177 Bacteria 5813
131 Ga0105248_10204743 3300009177 Bacteria 2224
132 Ga0105249_10265257 3300009553 Bacteria 1708
133 Ga0105249_10344749 3300009553 Unclassified 1507
134 Ga0105249_10465941 3300009553 Bacteria 1304
135 Ga0105239_10045318 3300010375 Bacteria 4820
136 Ga0105239_10053603 3300010375 Bacteria 4424
137 Ga0105239_10094830 3300010375 Bacteria 3296
138 Ga0105239_10147453 3300010375 Bacteria 2625
139 Ga0105239_10154229 3300010375 Bacteria 2564
140 Ga0105246_10008899 3300011119 Bacteria 6180
141 Ga0157371_10046541 3300013102 Bacteria 3085
142 Ga0157374_10003998 3300013296 Bacteria 12390
143 Ga0157374_10318635 3300013296 Bacteria 1540
144 Ga0157378_10055043 3300013297 Bacteria 3543
145 Ga0163162_10001552 3300013306 Bacteria 21472
146 Ga0163162_10461729 3300013306 Bacteria 1401
147 Ga0157372_10081925 3300013307 Bacteria 3653
148 Ga0157372_10145767 3300013307 Bacteria 2730
149 Ga0157375_10063195 3300013308 Bacteria 3682
150 Ga0157375_10106967 3300013308 Bacteria 2890
151 Ga0157375_10114101 3300013308 Bacteria 2803
152 Ga0157380_10042903 3300014326 Bacteria 3539
153 Ga0157380_10171518 3300014326 Bacteria 1896
154 Ga0157377_10007678 3300014745 Bacteria 5225
155 Ga0157377_10060066 3300014745 Bacteria 2169
156 Ga0157376_10017283 3300014969 Bacteria 5495
157 Ga0157376_10027466 3300014969 Bacteria 4512
158 Ga0213871_10039577 3300021441 Bacteria 1262
159 Ga0207692_10031031 3300025898 Bacteria 2555
160 Ga0207692_10219878 3300025898 Bacteria 1125
161 Ga0207642_10007029 3300025899 Bacteria 3776
162 Ga0207642_10090574 3300025899 Bacteria 1510
163 Ga0207642_10265529 3300025899 Bacteria 980
164 Ga0207688_10011275 3300025901 Bacteria 4865
165 Ga0207685_10007963 3300025905 Bacteria 2989
166 Ga0207699_10021084 3300025906 Bacteria 3505
167 Ga0207645_10100712 3300025907 Bacteria 1863
168 Ga0207684_10229922 3300025910 Bacteria 1600
169 Ga0207707_10018455 3300025912 Bacteria 6082
170 Ga0207693_10007043 3300025915 Bacteria 9281
171 Ga0207693_10039513 3300025915 Bacteria 3716
172 Ga0207693_10078141 3300025915 Bacteria 2591
173 Ga0207663_10028039 3300025916 Bacteria 3290
174 Ga0207660_10374940 3300025917 Bacteria 1143
175 Ga0207657_10018031 3300025919 Bacteria 6753
176 Ga0207657_10104497 3300025919 Bacteria 2346
177 Ga0207646_10062720 3300025922 Bacteria 3318
178 Ga0207659_10273767 3300025926 Bacteria 1378
179 Ga0207687_10067896 3300025927 Bacteria 2538
180 Ga0207687_10137248 3300025927 Bacteria 1851
181 Ga0207700_10041949 3300025928 Bacteria 3351
182 Ga0207644_10529913 3300025931 Unclassified 974
183 Ga0207706_10003452 3300025933 Bacteria 15088
184 Ga0207706_10059394 3300025933 Bacteria 3367
185 Ga0207709_10033606 3300025935 Bacteria 3014
186 Ga0207670_10167418 3300025936 Bacteria 1645
187 Ga0207669_10109349 3300025937 Bacteria 1848
188 Ga0207691_10020501 3300025940 Bacteria 6250
189 Ga0207691_10081995 3300025940 Bacteria 2898
190 Ga0207711_10096354 3300025941 Bacteria 2611
191 Ga0207689_10185553 3300025942 Bacteria 1715
192 Ga0207661_10024652 3300025944 Bacteria 4561
193 Ga0207667_10119835 3300025949 Bacteria 2712
194 Ga0207667_10137211 3300025949 Bacteria 2518
195 Ga0207677_10047904 3300026023 Bacteria 2873
196 Ga0207677_10121793 3300026023 Unclassified 1964
197 Ga0207678_10004904 3300026067 Bacteria 12023
198 Ga0207708_10005409 3300026075 Bacteria 9408
199 Ga0207708_10040505 3300026075 Bacteria 3551
200 Ga0207708_10325964 3300026075 Bacteria 1254
201 Ga0207702_10049390 3300026078 Bacteria 3550
202 Ga0207648_10000097 3300026089 Bacteria 83554
203 Ga0207648_10006302 3300026089 Bacteria 11801
204 Ga0207648_10096032 3300026089 Bacteria 2593
205 Ga0207675_100031753 3300026118 Bacteria 4920
206 Ga0207675_100190427 3300026118 Bacteria 1967
207 Ga0207683_10000038 3300026121 Bacteria 100875
208 Ga0207683_10269138 3300026121 Bacteria 1556
209 Ga0207698_10029950 3300026142 Bacteria 3907
210 Ga0207698_10106066 3300026142 Bacteria 2342
211 Ga0207428_10004378 3300027907 Bacteria 13466
212 Ga0207428_10027165 3300027907 Bacteria 4766
213 Ga0207428_10072614 3300027907 Bacteria 2701
214 Ga0207428_10114103 3300027907 Unclassified 2076
215 Ga0268265_10308156 3300028380 Bacteria 1429
216 Ga0268264_10057461 3300028381 Bacteria 3254
217 Ga0265340_10001123 3300031247 Bacteria 15296
218 Ga0307513_10000085 3300031456 Bacteria 131110
219 Ga0307410_10357033 3300031852 Bacteria 1169
220 Ga0307409_100285852 3300031995 Bacteria 1527
221 Ga0307416_100153141 3300032002 Bacteria 2118
222 Ga0307415_100030665 3300032126 Bacteria 3455
223 Ga0307415_100157411 3300032126 Bacteria 1756
224 Ga0373943_0011122 3300035170 Bacteria 4045
225 Ga0373947_0020006 3300035725 Bacteria 3863
226 Ga0373925_0021983 3300037068 Bacteria 4649
227 Ga0395899_0016857 3300037312 Bacteria 5569
228 Ga0395900_0001661 3300037418 Bacteria 26033
229 Ga0395900_0004285 3300037418 Bacteria 15136
230 Ga0395900_0007978 3300037418 Bacteria 10895
231 Ga0395900_0008041 3300037418 Bacteria 10858
232 Ga0395900_0008289 3300037418 Bacteria 10697
233 Ga0395900_0010638 3300037418 Bacteria 9409
234 Ga0395900_0074309 3300037418 Bacteria 3495
235 Ga0395900_0077358 3300037418 Bacteria 3418
236 Ga0395900_0084024 3300037418 Bacteria 3271
237 Ga0395900_0190520 3300037418 Unclassified 2080
238 Ga0395898_0003247 3300037466 Bacteria 18276
239 Ga0395898_0003970 3300037466 Bacteria 16287
240 Ga0395898_0038845 3300037466 Bacteria 4714
241 Ga0395898_0198868 3300037466 Bacteria 1914
242 Ga0395898_0231294 3300037466 Bacteria 1763
243 Ga0395898_0240464 3300037466 Bacteria 1727
244 Ga0395905_0002976 3300037471 Bacteria 18407
245 Ga0395905_0004494 3300037471 Bacteria 14464
246 Ga0395905_0006104 3300037471 Bacteria 12175
247 Ga0395905_0008889 3300037471 Bacteria 9868
248 Ga0395905_0027747 3300037471 Bacteria 5339
249 Ga0395905_0031539 3300037471 Bacteria 4989
250 Ga0395905_0090548 3300037471 Bacteria 2868
251 Ga0395905_0133713 3300037471 Bacteria 2333
252 Ga0395905_0387720 3300037471 Bacteria 1291
253 Ga0395905_0427691 3300037471 Bacteria 1221
254 Ga0395901_0002931 3300038443 Bacteria 17220
255 Ga0395901_0003855 3300038443 Bacteria 15100
256 Ga0395901_0005613 3300038443 Bacteria 12697
257 Ga0395901_0010300 3300038443 Bacteria 9469
258 Ga0395901_0013682 3300038443 Bacteria 8246
259 Ga0395901_0018864 3300038443 Bacteria 7051
260 Ga0395901_0022057 3300038443 Bacteria 6527
261 Ga0395901_0036304 3300038443 Bacteria 5093
262 Ga0395901_0230524 3300038443 Bacteria 1933
263 Ga0395901_0313409 3300038443 Bacteria 1624
264 Ga0395901_0387404 3300038443 Bacteria 1438
265 Ga0436360_0830746 3300039438 Bacteria 6002
266 Ga0439436_0061301 3300041404 Bacteria 1053
267 Ga0451789_0493179 3300041443 Bacteria 1181
268 Ga0451795_0397067 3300041456 Bacteria 2355
269 Ga0451853_1391112 3300041512 Bacteria 1290
270 Ga0439452_030092 3300042010 Bacteria 1342
271 Ga0466965_0214414 3300044683 Bacteria 1024
272 Ga0466963_0000814 3300044694 Bacteria 15586
273 Ga0466964_0003564 3300044706 Bacteria 5688
274 Ga0466964_0031408 3300044706 Bacteria 2106
275 Ga0466971_0051832 3300044719 Unclassified 1848
276 Ga0466957_0026276 3300044842 Bacteria 3453
277 Ga0466958_0255863 3300045836 Bacteria 1120
278 Ga0466967_0036943 3300045976 Bacteria 4175
279 Ga0466967_0146827 3300045976 Archaea 2200
280 Ga0466967_0340472 3300045976 Bacteria 1450
281 Ga0495603_0014152 3300046455 Bacteria 4827
282 Ga0495603_0024889 3300046455 Bacteria 3621
283 Ga0495629_0007275 3300046459 Bacteria 8151
284 Ga0495641_0002693 3300046461 Bacteria 13808
285 Ga0495641_0036028 3300046461 Bacteria 2328
286 Ga0495641_0048578 3300046461 Bacteria 1945
287 Ga0495641_0129619 3300046461 Bacteria 1126
288 Ga0495580_0180910 3300046472 Bacteria 1456
289 Ga0495582_0011042 3300046473 Bacteria 4971
290 Ga0495582_0046323 3300046473 Bacteria 2395
291 Ga0495582_0066767 3300046473 Bacteria 1987
292 Ga0495582_0070370 3300046473 Bacteria 1935
293 Ga0495585_0080802 3300046492 Bacteria 1762
294 Ga0495594_0000157 3300046499 Bacteria 32522
295 Ga0495594_0116916 3300046499 Bacteria 1506
296 Ga0495630_0043232 3300046517 Bacteria 3365
297 Ga0495637_0098678 3300046520 Unclassified 1144
298 Ga0495663_0031435 3300046525 Unclassified 1577
299 Ga0495665_0067421 3300046531 Bacteria 1888
300 Ga0495586_0101570 3300046535 Bacteria 1596
301 Ga0495609_0026245 3300046538 Unclassified 2668
302 Ga0495609_0030690 3300046538 Bacteria 2446
303 Ga0495656_0054578 3300046615 Bacteria 1720
304 Ga0495668_0119098 3300046616 Bacteria 1444
305 Ga0495634_0076742 3300046642 Bacteria 2193
306 Ga0495588_0000628 3300046674 Bacteria 16489
307 Ga0495658_0026948 3300046683 Bacteria 3087
308 Ga0495658_0056324 3300046683 Bacteria 2242
309 Ga0495658_0118608 3300046683 Bacteria 1598
310 Ga0495613_0034921 3300046689 Bacteria 3733
311 Ga0495613_0096968 3300046689 Bacteria 2132
312 Ga0495613_0131935 3300046689 Bacteria 1789
313 Ga0495660_0160359 3300046810 Bacteria 1104
314 Ga0495581_0005981 3300047315 Bacteria 7048
315 Ga0495581_0080615 3300047315 Bacteria 1884
316 Ga0495674_0496761 3300047319 Bacteria 976
317 Ga0495676_0004618 3300047321 Bacteria 12614
318 Ga0495676_0011496 3300047321 Bacteria 7984
319 Ga0495676_0016323 3300047321 Bacteria 6595
320 Ga0495614_0092724 3300048089 Bacteria 1315
321 Ga0496100_0024245 3300048903 Bacteria 3697
322 Ga0496101_0177591 3300048904 Bacteria 1638
323 Ga0496101_0377800 3300048904 Bacteria 1115
324 Ga0496102_0014928 3300048905 Bacteria 6759
325 Ga0496102_0036106 3300048905 Bacteria 4451
326 Ga0496102_0077642 3300048905 Bacteria 3056
327 Ga0496102_0340399 3300048905 Bacteria 1413
328 Ga0496103_0044224 3300048906 Bacteria 2743
329 Ga0496104_0001402 3300048907 Bacteria 20869
330 Ga0496104_0133482 3300048907 Bacteria 2385
331 Ga0496105_0000313 3300048908 Bacteria 31795
332 Ga0496105_0023838 3300048908 Bacteria 4969
333 Ga0496106_0200359 3300048909 Bacteria 1589
334 Ga0496106_0485111 3300048909 Bacteria 993
335 Ga0496107_0015928 3300048910 Bacteria 5274
336 Ga0496107_0037932 3300048910 Bacteria 3458
337 Ga0496108_0007104 3300048911 Bacteria 9069
338 Ga0496108_0007860 3300048911 Bacteria 8646
339 Ga0496108_0119606 3300048911 Bacteria 2258
340 Ga0496109_0000511 3300048912 Bacteria 32973
341 Ga0496109_0000523 3300048912 Bacteria 32527
342 Ga0496109_0002044 3300048912 Bacteria 16720
343 Ga0496109_0090087 3300048912 Bacteria 2836
344 Ga0496109_0140682 3300048912 Bacteria 2256
345 Ga0496110_0000600 3300048913 Bacteria 24759
346 Ga0496111_0004165 3300048914 Bacteria 9099
347 Ga0496111_0005831 3300048914 Bacteria 7942
348 Ga0496111_0011826 3300048914 Bacteria 5892
349 Ga0496111_0055856 3300048914 Bacteria 2856
350 Ga0496111_0079484 3300048914 Bacteria 2392
351 Ga0496111_0094875 3300048914 Bacteria 2188
352 Ga0496112_0000384 3300048915 Bacteria 29024
353 Ga0496112_0000731 3300048915 Bacteria 22853
354 Ga0496112_0115897 3300048915 Bacteria 2649
355 Ga0496112_0140018 3300048915 Bacteria 2389
356 Ga0496112_0149288 3300048915 Bacteria 2305
357 Ga0496112_0469127 3300048915 Bacteria 1196
358 Ga0496113_0012601 3300048916 Bacteria 5689
359 Ga0496113_0014986 3300048916 Bacteria 5309
360 Ga0496113_0286249 3300048916 Bacteria 1318
361 Ga0496114_0004248 3300048917 Bacteria 11098
362 Ga0496114_0050188 3300048917 Bacteria 3473
363 Ga0496114_0257256 3300048917 Bacteria 1537
364 Ga0496114_0616724 3300048917 Bacteria 956
365 Ga0496115_0014761 3300048918 Bacteria 5921
366 Ga0496115_0070730 3300048918 Bacteria 2829
367 Ga0496126_0018973 3300048929 Bacteria 6793
368 Ga0501031_0007325 3300049568 Bacteria 7197
369 Ga0501031_0082848 3300049568 Bacteria 2090
370 Ga0501032_0110697 3300049569 Bacteria 1817
371 Ga0501034_0094075 3300049571 Bacteria 2994
372 Ga0501036_0018719 3300049572 Bacteria 5807
373 Ga0501037_0014100 3300049573 Bacteria 5888
374 Ga0501037_0036266 3300049573 Bacteria 3634
375 Ga0501038_0016903 3300049574 Bacteria 6603
376 Ga0501038_0027027 3300049574 Bacteria 5107
377 Ga0501039_0013375 3300049575 Bacteria 6274
378 Ga0501039_0103655 3300049575 Bacteria 2221
379 Ga0501039_0350545 3300049575 Bacteria 1160
380 Ga0501040_0001212 3300049576 Bacteria 16426
381 Ga0501040_0142005 3300049576 Bacteria 1692
382 Ga0501040_0482943 3300049576 Bacteria 893
383 Ga0501041_0005196 3300049577 Bacteria 7600
384 Ga0501041_0076506 3300049577 Bacteria 2059
385 Ga0501041_0086256 3300049577 Bacteria 1936
386 Ga0501042_0008111 3300049578 Bacteria 6915
387 Ga0501046_0069402 3300049580 Bacteria 2742
388 Ga0501047_0572331 3300049581 Bacteria 953
389 Ga0501048_0286125 3300049582 Bacteria 1172
390 Ga0501068_0089939 3300049584 Bacteria 1893
391 Ga0501068_0207827 3300049584 Bacteria 1243
392 Ga0501069_0040300 3300049585 Bacteria 2581
393 Ga0501069_0219635 3300049585 Bacteria 1104
394 Ga0501070_0061057 3300049586 Bacteria 3124
395 Ga0501072_0004625 3300049588 Bacteria 10483
396 Ga0501072_0229351 3300049588 Bacteria 1479
397 Ga0501073_0256353 3300049589 Bacteria 1207
398 Ga0501074_0020185 3300049590 Bacteria 4842
399 Ga0501074_0043110 3300049590 Bacteria 3265
400 Ga0501075_0004114 3300049591 Bacteria 9825
401 Ga0501075_0092823 3300049591 Bacteria 2291
402 Ga0501076_0003461 3300049592 Bacteria 11078
403 Ga0501076_0061054 3300049592 Bacteria 2999
404 Ga0501076_0155087 3300049592 Bacteria 1864
405 Ga0501077_0000662 3300049593 Bacteria 20841
406 Ga0501077_0048713 3300049593 Bacteria 2692
407 Ga0501079_0010572 3300049741 Bacteria 7020
408 Ga0501079_0096890 3300049741 Bacteria 2287
409 Ga0501079_0122943 3300049741 Bacteria 2018
410 Ga0501079_0188567 3300049741 Bacteria 1609
411 Ga0501080_0095738 3300049742 Bacteria 2757
412 Ga0501080_0124554 3300049742 Bacteria 2387
413 Ga0501081_0061142 3300049743 Bacteria 2611
414 Ga0501083_0127271 3300049744 Bacteria 1669
415 Ga0501035_0007143 3300049822 Bacteria 10444
416 Ga0501044_0415869 3300049823 Bacteria 1255
417 Ga0501045_0001292 3300049824 Bacteria 16604
418 nmdc:mga00v17_29523_c1 3300050491 Bacteria 3219
419 nmdc:mga0yw44_31243_c1 3300050492 Bacteria 3095
420 nmdc:mga0yw44_379851_c1 3300050492 Bacteria 954
421 nmdc:mga05p37_141589_c1 3300050507 Bacteria 2946
422 nmdc:mga05p37_148050_c1 3300050507 Bacteria 2874
423 nmdc:mga05p37_2561_c1 3300050507 Bacteria 21145
424 nmdc:mga05p37_35044_c1 3300050507 Bacteria 6153
425 nmdc:mga05p37_377585_c1 3300050507 Bacteria 1662
426 nmdc:mga05p37_58201_c1 3300050507 Bacteria 4759
427 nmdc:mga09592_56498_c1 3300050508 Bacteria 3317
428 nmdc:mga06r32_100069_c1 3300050510 Bacteria 2844
429 nmdc:mga06r32_150891_c1 3300050510 Bacteria 2302
430 nmdc:mga06r32_570961_c1 3300050510 Bacteria 1104
431 nmdc:mga08y16_146753_c1 3300050511 Bacteria 2453
432 nmdc:mga08y16_283943_c1 3300050511 Unclassified 1707
433 nmdc:mga08y16_28881_c1 3300050511 Bacteria 5847
434 nmdc:mga08y16_31482_c1 3300050511 Bacteria 5579
435 nmdc:mga08y16_342344_c1 3300050511 Bacteria 1537
436 nmdc:mga0n895_11406_c1 3300050512 Bacteria 7928
437 nmdc:mga0n895_3146_c1 3300050512 Bacteria 13173
438 nmdc:mga0n895_388113_c1 3300050512 Bacteria 1412
439 nmdc:mga0n895_87536_c1 3300050512 Bacteria 3113
440 nmdc:mga0n895_88705_c1 3300050512 Bacteria 3093
441 nmdc:mga0rr50_19351_c1 3300050513 Bacteria 4594
442 nmdc:mga0rr50_26403_c1 3300050513 Bacteria 4051
443 nmdc:mga0rr50_6469_c1 3300050513 Bacteria 7134
444 nmdc:mga08x19_12562_c1 3300050514 Bacteria 5106
445 nmdc:mga08x19_187025_c1 3300050514 Bacteria 1416
446 nmdc:mga08x19_21941_c1 3300050514 Bacteria 3948
447 nmdc:mga08x19_90327_c1 3300050514 Bacteria 2021
448 nmdc:mga0a205_2005_c1 3300050515 Bacteria 17756
449 nmdc:mga0a205_23496_c1 3300050515 Bacteria 5849
450 nmdc:mga0a205_23562_c1 3300050515 Bacteria 5840
451 nmdc:mga0a205_82978_c1 3300050515 Bacteria 3096
452 Ga0501084_0087508 3300054114 Bacteria 2615
453 Ga0501082_0004966 3300060353 Bacteria 11610
454 Ga0501082_0064059 3300060353 Bacteria 3165
455 Ga0466962_0087223 3300061719 Bacteria 1494
456 Ga0530510_0010082 3300061734 Bacteria 6624
457 Ga0530510_0062153 3300061734 Bacteria 2704
458 Ga0530510_0072930 3300061734 Bacteria 2492
459 Ga0530510_0485379 3300061734 Unclassified 936
460 Ga0439458_0025634
461 Ga0070676_10299296
462 Ga0070683_100039456
463 Ga0070683_100523905
464 Ga0070690_100120985
465 Ga0070680_100154889
466 Ga0070682_100051729
467 Ga0070682_100117100
468 Ga0068868_100010300
469 Ga0068868_100015386
470 Ga0068868_100222308
471 Ga0070660_100011217
472 Ga0070689_100216525
473 Ga0070691_10014500
474 Ga0070691_10019544
475 Ga0070687_100015627
476 Ga0070692_10002512
477 Ga0070692_10032523
478 Ga0070671_100254475
479 Ga0070674_100036290
480 Ga0070674_100048944
481 Ga0070674_100138335
482 Ga0070688_100003349
483 Ga0070659_100054472
484 Ga0070659_100290144
485 Ga0070709_10023306
486 Ga0070710_10090198
487 Ga0070711_100491510
488 Ga0070705_100017554
489 Ga0070700_100023901
490 Ga0070700_100282944
491 Ga0070708_100152607
492 Ga0070708_100186115
493 Ga0070708_100244207
494 Ga0070708_100333634
495 Ga0070678_100003649
496 Ga0070678_100430005
497 Ga0070662_100041803
498 Ga0070662_100126205
499 Ga0070681_10006481
500 Ga0068867_100005806
501 Ga0068867_100021930
502 Ga0068867_100062393
503 Ga0070685_10041084
504 Ga0070706_100018291
505 Ga0070707_100531644
506 Ga0070698_100040584
507 Ga0070699_100033321
508 Ga0070679_100326857
509 Ga0070684_100187513
510 Ga0070684_100214605
511 Ga0068853_100007723
512 Ga0070672_100017154
513 Ga0070686_100104662
514 Ga0070695_100045804
515 Ga0070696_100053966
516 Ga0070704_100453052
517 Ga0068855_100128790
518 Ga0068856_100122465
519 Ga0068856_100128254
520 Ga0070702_100020752
521 Ga0070702_100058827
522 Ga0070702_100092185
523 Ga0068852_100092040
524 Ga0068866_10005350
525 Ga0068866_10010138
526 Ga0068866_10052568
527 Ga0068861_100075655
528 Ga0081455_10013624
529 Ga0081455_10017283
530 Ga0081455_10097826
531 Ga0081540_1003007
532 Ga0081540_1010691
533 Ga0070717_10053250
534 Ga0070717_10145251
535 Ga0070717_10476885
536 Ga0075365_10057824
537 Ga0075364_10054356
538 Ga0075364_10211607
539 Ga0075432_10002401
540 Ga0075432_10009974
541 Ga0075432_10079429
542 Ga0070712_100022216
543 Ga0070712_100023536
544 Ga0070712_100061929
545 Ga0070712_100508677
546 Ga0075428_100029122
547 Ga0075428_100034487
548 Ga0075428_100281470
549 Ga0075428_100486937
550 Ga0075430_100374860
551 Ga0075431_100032019
552 Ga0075431_100142963
553 Ga0075431_100153953
554 Ga0075433_10002886
555 Ga0075434_100007586
556 Ga0075434_100017062
557 Ga0075434_100050803
558 Ga0075434_100067800
559 Ga0075434_100091676
560 Ga0075434_100193494
561 Ga0068865_100667835
562 Ga0075436_100023487
563 Ga0075436_100081987
564 Ga0075436_100191381
565 Ga0075436_100212329
566 Ga0075435_100002102
567 Ga0075435_100006211
568 Ga0075435_100020818
569 Ga0111539_10018517
570 Ga0111539_10035388
571 Ga0111539_10134282
572 Ga0111539_10174925
573 Ga0111539_10248492
574 Ga0105245_10016804
575 Ga0105245_10049159
576 Ga0105245_10058127
577 Ga0105245_10132556
578 Ga0105245_10156401
579 Ga0105245_10218984
580 Ga0105245_10264225
581 Ga0105247_10059820
582 Ga0114129_10015577
583 Ga0114129_10067185
584 Ga0105243_10005429
585 Ga0105243_10025826
586 Ga0105242_10208772
587 Ga0105242_10217154
588 Ga0105248_10018487
589 Ga0105248_10032669
590 Ga0105248_10204743
591 Ga0105249_10265257
592 Ga0105249_10344749
593 Ga0105249_10465941
594 Ga0105239_10045318
595 Ga0105239_10053603
596 Ga0105239_10094830
597 Ga0105239_10147453
598 Ga0105239_10154229
599 Ga0105246_10008899
600 Ga0157371_10046541
601 Ga0157374_10003998
602 Ga0157374_10318635
603 Ga0157378_10055043
604 Ga0163162_10001552
605 Ga0163162_10461729
606 Ga0157372_10081925
607 Ga0157372_10145767
608 Ga0157375_10063195
609 Ga0157375_10106967
610 Ga0157375_10114101
611 Ga0157380_10042903
612 Ga0157380_10171518
613 Ga0157377_10007678
614 Ga0157377_10060066
615 Ga0157376_10017283
616 Ga0157376_10027466
617 Ga0213871_10039577
618 Ga0207692_10031031
619 Ga0207692_10219878
620 Ga0207642_10007029
621 Ga0207642_10090574
622 Ga0207642_10265529
623 Ga0207688_10011275
624 Ga0207685_10007963
625 Ga0207699_10021084
626 Ga0207645_10100712
627 Ga0207684_10229922
628 Ga0207707_10018455
629 Ga0207693_10007043
630 Ga0207693_10039513
631 Ga0207693_10078141
632 Ga0207663_10028039
633 Ga0207660_10374940
634 Ga0207657_10018031
635 Ga0207657_10104497
636 Ga0207646_10062720
637 Ga0207659_10273767
638 Ga0207687_10067896
639 Ga0207687_10137248
640 Ga0207700_10041949
641 Ga0207644_10529913
642 Ga0207706_10003452
643 Ga0207706_10059394
644 Ga0207709_10033606
645 Ga0207670_10167418
646 Ga0207669_10109349
647 Ga0207691_10020501
648 Ga0207691_10081995
649 Ga0207711_10096354
650 Ga0207689_10185553
651 Ga0207661_10024652
652 Ga0207667_10119835
653 Ga0207667_10137211
654 Ga0207677_10047904
655 Ga0207677_10121793
656 Ga0207678_10004904
657 Ga0207708_10005409
658 Ga0207708_10040505
659 Ga0207708_10325964
660 Ga0207702_10049390
661 Ga0207648_10000097
662 Ga0207648_10006302
663 Ga0207648_10096032
664 Ga0207675_100031753
665 Ga0207675_100190427
666 Ga0207683_10000038
667 Ga0207683_10269138
668 Ga0207698_10029950
669 Ga0207698_10106066
670 Ga0207428_10004378
671 Ga0207428_10027165
672 Ga0207428_10072614
673 Ga0207428_10114103
674 Ga0268265_10308156
675 Ga0268264_10057461
676 Ga0265340_10001123
677 Ga0307513_10000085
678 Ga0307410_10357033
679 Ga0307409_100285852
680 Ga0307416_100153141
681 Ga0307415_100030665
682 Ga0307415_100157411
683 Ga0373943_0011122
684 Ga0373947_0020006
685 Ga0373925_0021983
686 Ga0395899_0016857
687 Ga0395900_0001661
688 Ga0395900_0004285
689 Ga0395900_0007978
690 Ga0395900_0008041
691 Ga0395900_0008289
692 Ga0395900_0010638
693 Ga0395900_0074309
694 Ga0395900_0077358
695 Ga0395900_0084024
696 Ga0395900_0190520
697 Ga0395898_0003247
698 Ga0395898_0003970
699 Ga0395898_0038845
700 Ga0395898_0198868
701 Ga0395898_0231294
702 Ga0395898_0240464
703 Ga0395905_0002976
704 Ga0395905_0004494
705 Ga0395905_0006104
706 Ga0395905_0008889
707 Ga0395905_0027747
708 Ga0395905_0031539
709 Ga0395905_0090548
710 Ga0395905_0133713
711 Ga0395905_0387720
712 Ga0395905_0427691
713 Ga0395901_0002931
714 Ga0395901_0003855
715 Ga0395901_0005613
716 Ga0395901_0010300
717 Ga0395901_0013682
718 Ga0395901_0018864
719 Ga0395901_0022057
720 Ga0395901_0036304
721 Ga0395901_0230524
722 Ga0395901_0313409
723 Ga0395901_0387404
724 Ga0436360_0830746
725 Ga0439436_0061301
726 Ga0451789_0493179
727 Ga0451795_0397067
728 Ga0451853_1391112
729 Ga0439452_030092
730 Ga0466965_0214414
731 Ga0466963_0000814
732 Ga0466964_0003564
733 Ga0466964_0031408
734 Ga0466971_0051832
735 Ga0466957_0026276
736 Ga0466958_0255863
737 Ga0466967_0036943
738 Ga0466967_0146827
739 Ga0466967_0340472
740 Ga0495603_0014152
741 Ga0495603_0024889
742 Ga0495629_0007275
743 Ga0495641_0002693
744 Ga0495641_0036028
745 Ga0495641_0048578
746 Ga0495641_0129619
747 Ga0495580_0180910
748 Ga0495582_0011042
749 Ga0495582_0046323
750 Ga0495582_0066767
751 Ga0495582_0070370
752 Ga0495585_0080802
753 Ga0495594_0000157
754 Ga0495594_0116916
755 Ga0495630_0043232
756 Ga0495637_0098678
757 Ga0495663_0031435
758 Ga0495665_0067421
759 Ga0495586_0101570
760 Ga0495609_0026245
761 Ga0495609_0030690
762 Ga0495656_0054578
763 Ga0495668_0119098
764 Ga0495634_0076742
765 Ga0495588_0000628
766 Ga0495658_0026948
767 Ga0495658_0056324
768 Ga0495658_0118608
769 Ga0495613_0034921
770 Ga0495613_0096968
771 Ga0495613_0131935
772 Ga0495660_0160359
773 Ga0495581_0005981
774 Ga0495581_0080615
775 Ga0495674_0496761
776 Ga0495676_0004618
777 Ga0495676_0011496
778 Ga0495676_0016323
779 Ga0495614_0092724
780 Ga0496100_0024245
781 Ga0496101_0177591
782 Ga0496101_0377800
783 Ga0496102_0014928
784 Ga0496102_0036106
785 Ga0496102_0077642
786 Ga0496102_0340399
787 Ga0496103_0044224
788 Ga0496104_0001402
789 Ga0496104_0133482
790 Ga0496105_0000313
791 Ga0496105_0023838
792 Ga0496106_0200359
793 Ga0496106_0485111
794 Ga0496107_0015928
795 Ga0496107_0037932
796 Ga0496108_0007104
797 Ga0496108_0007860
798 Ga0496108_0119606
799 Ga0496109_0000511
800 Ga0496109_0000523
801 Ga0496109_0002044
802 Ga0496109_0090087
803 Ga0496109_0140682
804 Ga0496110_0000600
805 Ga0496111_0004165
806 Ga0496111_0005831
807 Ga0496111_0011826
808 Ga0496111_0055856
809 Ga0496111_0079484
810 Ga0496111_0094875
811 Ga0496112_0000384
812 Ga0496112_0000731
813 Ga0496112_0115897
814 Ga0496112_0140018
815 Ga0496112_0149288
816 Ga0496112_0469127
817 Ga0496113_0012601
818 Ga0496113_0014986
819 Ga0496113_0286249
820 Ga0496114_0004248
821 Ga0496114_0050188
822 Ga0496114_0257256
823 Ga0496114_0616724
824 Ga0496115_0014761
825 Ga0496115_0070730
826 Ga0496126_0018973
827 Ga0501031_0007325
828 Ga0501031_0082848
829 Ga0501032_0110697
830 Ga0501034_0094075
831 Ga0501036_0018719
832 Ga0501037_0014100
833 Ga0501037_0036266
834 Ga0501038_0016903
835 Ga0501038_0027027
836 Ga0501039_0013375
837 Ga0501039_0103655
838 Ga0501039_0350545
839 Ga0501040_0001212
840 Ga0501040_0142005
841 Ga0501040_0482943
842 Ga0501041_0005196
843 Ga0501041_0076506
844 Ga0501041_0086256
845 Ga0501042_0008111
846 Ga0501046_0069402
847 Ga0501047_0572331
848 Ga0501048_0286125
849 Ga0501068_0089939
850 Ga0501068_0207827
851 Ga0501069_0040300
852 Ga0501069_0219635
853 Ga0501070_0061057
854 Ga0501072_0004625
855 Ga0501072_0229351
856 Ga0501073_0256353
857 Ga0501074_0020185
858 Ga0501074_0043110
859 Ga0501075_0004114
860 Ga0501075_0092823
861 Ga0501076_0003461
862 Ga0501076_0061054
863 Ga0501076_0155087
864 Ga0501077_0000662
865 Ga0501077_0048713
866 Ga0501079_0010572
867 Ga0501079_0096890
868 Ga0501079_0122943
869 Ga0501079_0188567
870 Ga0501080_0095738
871 Ga0501080_0124554
872 Ga0501081_0061142
873 Ga0501083_0127271
874 Ga0501035_0007143
875 Ga0501044_0415869
876 Ga0501045_0001292
877 nmdc:mga00v17_29523_c1
878 nmdc:mga0yw44_31243_c1
879 nmdc:mga0yw44_379851_c1
880 nmdc:mga05p37_141589_c1
881 nmdc:mga05p37_148050_c1
882 nmdc:mga05p37_2561_c1
883 nmdc:mga05p37_35044_c1
884 nmdc:mga05p37_377585_c1
885 nmdc:mga05p37_58201_c1
886 nmdc:mga09592_56498_c1
887 nmdc:mga06r32_100069_c1
888 nmdc:mga06r32_150891_c1
889 nmdc:mga06r32_570961_c1
890 nmdc:mga08y16_146753_c1
891 nmdc:mga08y16_283943_c1
892 nmdc:mga08y16_28881_c1
893 nmdc:mga08y16_31482_c1
894 nmdc:mga08y16_342344_c1
895 nmdc:mga0n895_11406_c1
896 nmdc:mga0n895_3146_c1
897 nmdc:mga0n895_388113_c1
898 nmdc:mga0n895_87536_c1
899 nmdc:mga0n895_88705_c1
900 nmdc:mga0rr50_19351_c1
901 nmdc:mga0rr50_26403_c1
902 nmdc:mga0rr50_6469_c1
903 nmdc:mga08x19_12562_c1
904 nmdc:mga08x19_187025_c1
905 nmdc:mga08x19_21941_c1
906 nmdc:mga08x19_90327_c1
907 nmdc:mga0a205_2005_c1
908 nmdc:mga0a205_23496_c1
909 nmdc:mga0a205_23562_c1
910 nmdc:mga0a205_82978_c1
911 Ga0501084_0087508
912 Ga0501082_0004966
913 Ga0501082_0064059
914 Ga0466962_0087223
915 Ga0530510_0010082
916 Ga0530510_0062153
917 Ga0530510_0072930
918 Ga0530510_0485379

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00144

Beta-lactamase

Beta-lactamase

40

300

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i7j-assembly2.cif.gz_B crystal structure of a beta-lactamase (mb2281c) from mycobacterium bovis, northeast structural genomics consortium target mbr246 0.9892 3 264
3i7j-assembly2.cif.gz_B crystal structure of a beta-lactamase (mb2281c) from mycobacterium bovis, northeast structural genomics consortium target mbr246 0.9744 3 264
6kjr-assembly1.cif.gz_A functional and structural insights into the unusual oxyanion hole-like geometry in macrolactin acyltransferase selective for dicarboxylic acyl donors 0.8754 4 262
6kjt-assembly1.cif.gz_C functional and structural insights into the unusual oxyanion hole-like geometry in macrolactin acyltransferase selective for dicarboxylic acyl donors 0.8695 4 261
6kjq-assembly1.cif.gz_A functional and structural insights into the unusual oxyanion hole-like geometry in macrolactin acyltransferase selective for dicarboxylic acyl donors 0.8617 4 261
ID Description Score Start End Superfamily
3i7jB00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.9748 3 264 3.40.710.10
3i7jB00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.9603 3 264 3.40.710.10
af_I1M9W9_472_764_3.40.710.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8459 2 159 3.40.710.10
af_Q8T2U3_27_449_3.40.710.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8335 5 263 3.40.710.10
af_P77619_23_410_3.40.710.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8296 5 245 3.40.710.10
ID Description Score Start End GO Terms
AF-A0A7V9M9U2-F1-model_v4 Beta-lactamase family protein 0.9953 1 263
AF-A0A7W0TR36-F1-model_v4 Beta-lactamase family protein 0.9952 1 264
AF-A0A1Q9LCV7-F1-model_v4 Serine hydrolase 0.9939 5 264 GO:0016787
AF-A0A6N7H3I1-F1-model_v4 Serine hydrolase 0.9938 1 264 GO:0016787
AF-A0A177R5L0-F1-model_v4 deleted 0.9936 69 264

Map