metagRoot

F448370

General Info

Members	Datasets	Scaffolds	Average Seq Length
459	195	457	231

Family's Representative Sequence

Representative Sequence	3300025938\|Ga0207704_10305273\|Ga0207704_103052732
Length	256
Sequence	MIRQPPEAVPAAMINAHITLIHSAIVRLLPGSGASLESSAPLSFTVHSMPAPAMADDVVRRTASGRLKMFIVLLVCAAPVVASYLAYFVIRPEGRTNYSELVEPLRPIPAALPLSDLQGRPVAAESLKGQWLLVVVSGGACDARCEHYLWLQRQLRETLGREKERVDKVWLIDDAATPRSATLDAIAGATVLRVPRDALTGWLAPAPQRTLEQHVYIVDPLGNWMMRVPVDPEPAKFKRDVEKLLRASAGWDKPGR

Samples

	Sample ID	Description	Type	Environment
1	2585428062	Methylibium sp. CF059	Isolate	Rhizosphere
2	2643221654	Rhizobacter sp. Root404	Isolate	Unclassified
3	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
4	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
5	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
6	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
7	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
8	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
9	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
10	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
11	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
12	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
13	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
14	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
15	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
16	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
17	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
18	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
19	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
20	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
21	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
22	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
23	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
24	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
25	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
26	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
27	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
28	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
29	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
30	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
31	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
32	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
33	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
34	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
35	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
36	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
37	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
38	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
39	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
40	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
41	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
42	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
43	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
44	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
45	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
46	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
47	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
48	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
49	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
50	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
51	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
52	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
53	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
54	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
55	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
56	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
57	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
58	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
59	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
60	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
61	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
62	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
63	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
64	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
65	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
66	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
67	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
68	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
69	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
70	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
71	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
72	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
73	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
74	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
75	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
76	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
77	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
78	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
79	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
80	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
81	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
82	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
83	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
84	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
85	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
86	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
87	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
125	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
126	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
127	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
128	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
129	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
130	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
131	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
132	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
133	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
134	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
135	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
136	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
137	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
138	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
139	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
140	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
141	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
142	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
143	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
144	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
145	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
146	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
147	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
148	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
149	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
150	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
151	3300041511	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG	Metagenome	Unclassified
152	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
153	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
154	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
155	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
156	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
157	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
158	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
159	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
160	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
161	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
162	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
163	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
164	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
165	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
166	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
167	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
168	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
169	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
170	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
171	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
172	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
173	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
174	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
175	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
176	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
177	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
178	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
179	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
180	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
181	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
182	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
183	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
184	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
185	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
186	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
187	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
188	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
189	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
190	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
191	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
192	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
193	3300053138	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere	Metagenome	Endosphere
194	3300053154	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere	Metagenome	Endosphere
195	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.56
Metatranscriptomes	0
Isolates	0.44

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	13.07
Nodule	0
Rhizoplane	1.74
Rhizosphere	78.87
Stem	0
Stem Tuber	0
Unclassified	6.32

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0065707_10255445	3300005295	Unclassified	1112
2	Ga0070676_10001883	3300005328	Bacteria	10660
3	Ga0070676_10035138	3300005328	Bacteria	2881
4	Ga0070676_10145622	3300005328	Bacteria	1512
5	Ga0070676_10188568	3300005328	Bacteria	1345
6	Ga0070670_100007394	3300005331	Bacteria	9328
7	Ga0070670_100010949	3300005331	Bacteria	7748
8	Ga0070670_100025563	3300005331	Bacteria	5079
9	Ga0070670_100095992	3300005331	Bacteria	2550
10	Ga0070670_100128726	3300005331	Bacteria	2185
11	Ga0070670_100137665	3300005331	Bacteria	2110
12	Ga0070670_100787784	3300005331	Bacteria	858
13	Ga0070677_10008030	3300005333	Bacteria	3538
14	Ga0070677_10055583	3300005333	Bacteria	1616
15	Ga0070677_10105842	3300005333	Unclassified	1248
16	Ga0068869_100081244	3300005334	Bacteria	2420
17	Ga0068869_100440207	3300005334	Bacteria	1079
18	Ga0070666_10085571	3300005335	Bacteria	2159
19	Ga0068868_100052358	3300005338	Bacteria	3214
20	Ga0068868_100090342	3300005338	Bacteria	2466
21	Ga0068868_100184473	3300005338	Bacteria	1732
22	Ga0068868_100210332	3300005338	Bacteria	1625
23	Ga0070661_100379167	3300005344	Bacteria	1115
24	Ga0070661_100383071	3300005344	Bacteria	1109
25	Ga0070668_100138587	3300005347	Bacteria	1959
26	Ga0070668_100212251	3300005347	Bacteria	1593
27	Ga0070668_100539175	3300005347	Bacteria	1014
28	Ga0070675_100009273	3300005354	Bacteria	7649
29	Ga0070675_100080091	3300005354	Bacteria	2722
30	Ga0070675_100096698	3300005354	Bacteria	2481
31	Ga0070671_100007158	3300005355	Bacteria	8919
32	Ga0070671_100008311	3300005355	Bacteria	8308
33	Ga0070671_100022927	3300005355	Bacteria	5102
34	Ga0070671_100038584	3300005355	Bacteria	3964
35	Ga0070671_100098910	3300005355	Bacteria	2447
36	Ga0070671_100111150	3300005355	Bacteria	2302
37	Ga0070671_100374405	3300005355	Bacteria	1216
38	Ga0070674_100002407	3300005356	Bacteria	10331
39	Ga0070674_100152941	3300005356	Bacteria	1742
40	Ga0070674_100159021	3300005356	Bacteria	1712
41	Ga0070674_100214140	3300005356	Bacteria	1495
42	Ga0070674_100451940	3300005356	Unclassified	1061
43	Ga0070673_100010080	3300005364	Bacteria	6377
44	Ga0070673_100106767	3300005364	Bacteria	2315
45	Ga0070673_100312379	3300005364	Bacteria	1387
46	Ga0070673_100366109	3300005364	Bacteria	1282
47	Ga0070673_100522238	3300005364	Bacteria	1076
48	Ga0070688_100071491	3300005365	Bacteria	2221
49	Ga0070667_100075751	3300005367	Bacteria	2873
50	Ga0070667_100116971	3300005367	Bacteria	2315
51	Ga0070667_100139274	3300005367	Bacteria	2123
52	Ga0070667_100190369	3300005367	Bacteria	1817
53	Ga0070700_100043013	3300005441	Bacteria	2777
54	Ga0070708_100751488	3300005445	Bacteria	917
55	Ga0070663_100232892	3300005455	Bacteria	1451
56	Ga0070663_100238017	3300005455	Bacteria	1436
57	Ga0070663_100404569	3300005455	Bacteria	1116
58	Ga0070678_100004379	3300005456	Bacteria	7998
59	Ga0070678_100041326	3300005456	Bacteria	3267
60	Ga0070678_100089307	3300005456	Bacteria	2358
61	Ga0070678_100151611	3300005456	Bacteria	1868
62	Ga0070678_100161814	3300005456	Bacteria	1814
63	Ga0070678_100202851	3300005456	Bacteria	1638
64	Ga0070678_100253386	3300005456	Bacteria	1477
65	Ga0070662_100064032	3300005457	Bacteria	2691
66	Ga0070662_100115959	3300005457	Bacteria	2047
67	Ga0068867_100004202	3300005459	Bacteria	10131
68	Ga0068867_100011197	3300005459	Bacteria	6328
69	Ga0068867_100034791	3300005459	Bacteria	3653
70	Ga0068867_100038202	3300005459	Bacteria	3495
71	Ga0068867_100432861	3300005459	Bacteria	1117
72	Ga0070706_100016850	3300005467	Bacteria	6747
73	Ga0070707_100007656	3300005468	Bacteria	10028
74	Ga0070698_100144170	3300005471	Bacteria	2332
75	Ga0068853_100618966	3300005539	Bacteria	1029
76	Ga0070672_100011799	3300005543	Bacteria	6105
77	Ga0070672_100014240	3300005543	Bacteria	5631
78	Ga0070672_100044935	3300005543	Bacteria	3414
79	Ga0070672_100492625	3300005543	Bacteria	1059
80	Ga0070693_100612651	3300005547	Bacteria	787
81	Ga0070665_100015847	3300005548	Bacteria	7567
82	Ga0070665_100076667	3300005548	Bacteria	3350
83	Ga0070664_100054435	3300005564	Bacteria	3394
84	Ga0070664_100254587	3300005564	Bacteria	1579
85	Ga0070664_100288852	3300005564	Bacteria	1480
86	Ga0068857_100006256	3300005577	Bacteria	10181
87	Ga0068857_100041838	3300005577	Bacteria	4063
88	Ga0068854_100067480	3300005578	Bacteria	2606
89	Ga0068854_100527065	3300005578	Bacteria	999
90	Ga0068856_100016853	3300005614	Bacteria	7081
91	Ga0068856_100794910	3300005614	Unclassified	966
92	Ga0068852_100013659	3300005616	Bacteria	6221
93	Ga0068852_100037378	3300005616	Bacteria	4070
94	Ga0068852_100129111	3300005616	Bacteria	2325
95	Ga0068852_100186012	3300005616	Bacteria	1956
96	Ga0068852_100351402	3300005616	Bacteria	1440
97	Ga0068852_100640771	3300005616	Bacteria	1069
98	Ga0068859_100028879	3300005617	Bacteria	5562
99	Ga0068859_100039493	3300005617	Bacteria	4735
100	Ga0068859_100111783	3300005617	Bacteria	2795
101	Ga0068859_100271860	3300005617	Bacteria	1787
102	Ga0068864_100002333	3300005618	Bacteria	15684
103	Ga0068864_100012150	3300005618	Bacteria	7116
104	Ga0068864_100017128	3300005618	Bacteria	6043
105	Ga0068864_100076316	3300005618	Bacteria	2928
106	Ga0068864_100680181	3300005618	Bacteria	1004
107	Ga0068866_10065718	3300005718	Bacteria	1898
108	Ga0068861_100014317	3300005719	Bacteria	5563
109	Ga0068861_100045999	3300005719	Bacteria	3289
110	Ga0068861_100379983	3300005719	Bacteria	1248
111	Ga0068870_10008654	3300005840	Bacteria	4588
112	Ga0068863_100122401	3300005841	Bacteria	2481
113	Ga0068858_100026016	3300005842	Bacteria	5442
114	Ga0068858_100785575	3300005842	Bacteria	929
115	Ga0068860_100007532	3300005843	Bacteria	10891
116	Ga0068860_100187707	3300005843	Bacteria	1999
117	Ga0068860_100233488	3300005843	Bacteria	1788
118	Ga0068860_100243889	3300005843	Bacteria	1748
119	Ga0068860_100527007	3300005843	Bacteria	1182
120	Ga0068862_100010243	3300005844	Bacteria	7736
121	Ga0068862_100031437	3300005844	Bacteria	4481
122	Ga0081455_10169083	3300005937	Bacteria	1667
123	Ga0075365_10128483	3300006038	Bacteria	1752
124	Ga0075365_10241881	3300006038	Bacteria	1268
125	Ga0075368_10144194	3300006042	Bacteria	993
126	Ga0075368_10180595	3300006042	Bacteria	889
127	Ga0075363_100079230	3300006048	Bacteria	1794
128	Ga0075363_100131356	3300006048	Bacteria	1404
129	Ga0075364_10025873	3300006051	Bacteria	3739
130	Ga0075362_10051002	3300006177	Bacteria	1851
131	Ga0075362_10201676	3300006177	Bacteria	968
132	Ga0075367_10006801	3300006178	Bacteria	5809
133	Ga0075367_10013431	3300006178	Bacteria	4401
134	Ga0075367_10060128	3300006178	Bacteria	2264
135	Ga0075367_10135770	3300006178	Bacteria	1522
136	Ga0075367_10316186	3300006178	Bacteria	984
137	Ga0075369_10016233	3300006186	Bacteria	3001
138	Ga0075369_10047437	3300006186	Bacteria	1852
139	Ga0075366_10000238	3300006195	Bacteria	24452
140	Ga0075366_10002285	3300006195	Bacteria	9796
141	Ga0075366_10015694	3300006195	Bacteria	4347
142	Ga0075366_10017161	3300006195	Bacteria	4164
143	Ga0075366_10060801	3300006195	Bacteria	2244
144	Ga0075366_10105244	3300006195	Bacteria	1696
145	Ga0075366_10174966	3300006195	Bacteria	1303
146	Ga0075366_10457451	3300006195	Bacteria	788
147	Ga0097621_100062486	3300006237	Bacteria	3057
148	Ga0097621_100962794	3300006237	Bacteria	797
149	Ga0075370_10003402	3300006353	Bacteria	7564
150	Ga0075370_10003622	3300006353	Bacteria	7389
151	Ga0075370_10007889	3300006353	Bacteria	5446
152	Ga0075370_10072907	3300006353	Bacteria	1966
153	Ga0075370_10136654	3300006353	Bacteria	1432
154	Ga0075370_10167143	3300006353	Bacteria	1292
155	Ga0068871_100019122	3300006358	Bacteria	5225
156	Ga0068871_100028313	3300006358	Bacteria	4392
157	Ga0068871_100803333	3300006358	Bacteria	867
158	Ga0068865_100043562	3300006881	Bacteria	3068
159	Ga0068865_100322769	3300006881	Bacteria	1243
160	Ga0068865_100378061	3300006881	Bacteria	1154
161	Ga0097620_100028878	3300006931	Bacteria	5562
162	Ga0097620_100039493	3300006931	Bacteria	4735
163	Ga0097620_100111780	3300006931	Bacteria	2795
164	Ga0097620_100271858	3300006931	Bacteria	1787
165	Ga0105240_10411110	3300009093	Bacteria	1522
166	Ga0111539_11442987	3300009094	Unclassified	798
167	Ga0105245_10059345	3300009098	Bacteria	3445
168	Ga0105245_10478371	3300009098	Bacteria	1258
169	Ga0105243_10037161	3300009148	Bacteria	3782
170	Ga0105242_11119799	3300009176	Unclassified	802
171	Ga0105242_11248658	3300009176	Unclassified	764
172	Ga0105248_10055987	3300009177	Bacteria	4424
173	Ga0105248_10220975	3300009177	Bacteria	2133
174	Ga0105248_10837726	3300009177	Bacteria	1038
175	Ga0105237_10026456	3300009545	Bacteria	5930
176	Ga0105249_10014728	3300009553	Bacteria	6913
177	Ga0105249_10051022	3300009553	Bacteria	3772
178	Ga0105239_10084454	3300010375	Bacteria	3497
179	Ga0157378_10012503	3300013297	Bacteria	7430
180	Ga0157378_10147081	3300013297	Bacteria	2193
181	Ga0157378_10162588	3300013297	Bacteria	2089
182	Ga0157378_10253214	3300013297	Bacteria	1686
183	Ga0157378_10517925	3300013297	Bacteria	1194
184	Ga0157378_11720503	3300013297	Bacteria	674
185	Ga0163162_10006024	3300013306	Bacteria	11734
186	Ga0163162_10235391	3300013306	Bacteria	1962
187	Ga0163162_10239017	3300013306	Bacteria	1947
188	Ga0163162_10268858	3300013306	Bacteria	1836
189	Ga0157372_10246847	3300013307	Bacteria	2072
190	Ga0157375_10023553	3300013308	Bacteria	5683
191	Ga0157375_10132268	3300013308	Bacteria	2615
192	Ga0157375_10170608	3300013308	Bacteria	2323
193	Ga0157375_10457112	3300013308	Bacteria	1442
194	Ga0163163_10279051	3300014325	Bacteria	1722
195	Ga0157380_10073990	3300014326	Bacteria	2764
196	Ga0157380_10135766	3300014326	Bacteria	2105
197	Ga0157379_10035363	3300014968	Bacteria	4454
198	Ga0157379_10057966	3300014968	Bacteria	3461
199	Ga0157379_10089615	3300014968	Bacteria	2759
200	Ga0157376_10008366	3300014969	Bacteria	7461
201	Ga0157376_10083623	3300014969	Bacteria	2746
202	Ga0157376_10085329	3300014969	Bacteria	2720
203	Ga0157376_10839732	3300014969	Bacteria	933
204	Ga0163161_10069213	3300017792	Bacteria	2579
205	Ga0163161_10154788	3300017792	Bacteria	1744
206	Ga0163161_10239523	3300017792	Bacteria	1411
207	Ga0163161_10262096	3300017792	Bacteria	1350
208	Ga0207697_10078310	3300025315	Bacteria	1391
209	Ga0207682_10035940	3300025893	Bacteria	2003
210	Ga0207682_10041731	3300025893	Bacteria	1873
211	Ga0207682_10097328	3300025893	Bacteria	1283
212	Ga0207642_10066266	3300025899	Bacteria	1700
213	Ga0207680_10101286	3300025903	Bacteria	1851
214	Ga0207645_10008719	3300025907	Bacteria	7061
215	Ga0207645_10040896	3300025907	Bacteria	2969
216	Ga0207645_10105987	3300025907	Bacteria	1817
217	Ga0207643_10040836	3300025908	Bacteria	2613
218	Ga0207643_10056482	3300025908	Bacteria	2233
219	Ga0207643_10058991	3300025908	Bacteria	2189
220	Ga0207684_10018036	3300025910	Bacteria	6050
221	Ga0207695_10340732	3300025913	Bacteria	1387
222	Ga0207671_10020453	3300025914	Bacteria	5037
223	Ga0207649_10286034	3300025920	Bacteria	1200
224	Ga0207646_10026212	3300025922	Bacteria	5322
225	Ga0207681_10006812	3300025923	Bacteria	7007
226	Ga0207650_10011105	3300025925	Bacteria	6194
227	Ga0207650_10029526	3300025925	Bacteria	3942
228	Ga0207650_10206965	3300025925	Bacteria	1574
229	Ga0207659_10001102	3300025926	Bacteria	16008
230	Ga0207659_10006244	3300025926	Bacteria	7290
231	Ga0207659_10007533	3300025926	Bacteria	6703
232	Ga0207659_10023849	3300025926	Bacteria	4091
233	Ga0207659_10159735	3300025926	Bacteria	1768
234	Ga0207644_10000537	3300025931	Bacteria	24617
235	Ga0207644_10022107	3300025931	Bacteria	4342
236	Ga0207644_10027110	3300025931	Bacteria	3956
237	Ga0207644_10030822	3300025931	Bacteria	3733
238	Ga0207706_10037591	3300025933	Bacteria	4298
239	Ga0207706_10160655	3300025933	Bacteria	1975
240	Ga0207706_10176643	3300025933	Bacteria	1876
241	Ga0207706_10188878	3300025933	Bacteria	1809
242	Ga0207706_10386829	3300025933	Bacteria	1213
243	Ga0207706_10706563	3300025933	Bacteria	861
244	Ga0207686_10086723	3300025934	Bacteria	2057
245	Ga0207709_10020126	3300025935	Bacteria	3761
246	Ga0207709_10156553	3300025935	Bacteria	1584
247	Ga0207709_10688963	3300025935	Bacteria	817
248	Ga0207669_10028040	3300025937	Bacteria	3092
249	Ga0207669_10043995	3300025937	Bacteria	2619
250	Ga0207669_10644759	3300025937	Bacteria	865
251	Ga0207704_10031460	3300025938	Bacteria	2990
252	Ga0207704_10049657	3300025938	Bacteria	2526
253	Ga0207704_10077266	3300025938	Bacteria	2136
254	Ga0207704_10133027	3300025938	Bacteria	1726
255	Ga0207704_10305273	3300025938	Bacteria	1221
256	Ga0207704_10340880	3300025938	Unclassified	1163
257	Ga0207691_10008879	3300025940	Bacteria	9650
258	Ga0207691_10028304	3300025940	Bacteria	5248
259	Ga0207691_10061538	3300025940	Bacteria	3409
260	Ga0207691_10243543	3300025940	Bacteria	1554
261	Ga0207691_10312715	3300025940	Bacteria	1348
262	Ga0207691_10648672	3300025940	Bacteria	892
263	Ga0207711_10031153	3300025941	Bacteria	4500
264	Ga0207689_10105664	3300025942	Bacteria	2313
265	Ga0207689_10504849	3300025942	Bacteria	1013
266	Ga0207679_10064155	3300025945	Bacteria	2744
267	Ga0207679_10397826	3300025945	Bacteria	1211
268	Ga0207679_10443406	3300025945	Bacteria	1150
269	Ga0207667_10386266	3300025949	Bacteria	1426
270	Ga0207651_10039936	3300025960	Bacteria	3099
271	Ga0207651_10046201	3300025960	Bacteria	2926
272	Ga0207651_10050035	3300025960	Bacteria	2835
273	Ga0207712_10073003	3300025961	Bacteria	2473
274	Ga0207668_10024966	3300025972	Bacteria	3863
275	Ga0207668_10129756	3300025972	Bacteria	1923
276	Ga0207668_10444626	3300025972	Bacteria	1105
277	Ga0207640_10286617	3300025981	Bacteria	1296
278	Ga0207640_10836114	3300025981	Unclassified	800
279	Ga0207658_10017804	3300025986	Bacteria	4895
280	Ga0207658_10056850	3300025986	Bacteria	2905
281	Ga0207658_10079124	3300025986	Bacteria	2514
282	Ga0207658_10091282	3300025986	Bacteria	2363
283	Ga0207677_10014089	3300026023	Bacteria	4657
284	Ga0207677_10049143	3300026023	Bacteria	2844
285	Ga0207677_10277201	3300026023	Bacteria	1375
286	Ga0207677_10370963	3300026023	Bacteria	1205
287	Ga0207703_10019767	3300026035	Bacteria	5264
288	Ga0207703_10457403	3300026035	Bacteria	1193
289	Ga0207639_10558359	3300026041	Bacteria	1052
290	Ga0207639_10772625	3300026041	Bacteria	894
291	Ga0207678_10010974	3300026067	Bacteria	7957
292	Ga0207678_10140693	3300026067	Bacteria	2059
293	Ga0207678_10266400	3300026067	Bacteria	1469
294	Ga0207678_10417589	3300026067	Bacteria	1163
295	Ga0207708_10014402	3300026075	Bacteria	5918
296	Ga0207702_10307710	3300026078	Bacteria	1506
297	Ga0207641_10068981	3300026088	Bacteria	3033
298	Ga0207641_10386292	3300026088	Bacteria	1342
299	Ga0207641_10486253	3300026088	Bacteria	1197
300	Ga0207648_10002847	3300026089	Bacteria	18313
301	Ga0207648_10007326	3300026089	Bacteria	10868
302	Ga0207648_10012759	3300026089	Bacteria	7852
303	Ga0207648_10013271	3300026089	Bacteria	7676
304	Ga0207648_10031382	3300026089	Bacteria	4698
305	Ga0207648_10108805	3300026089	Bacteria	2433
306	Ga0207648_10166075	3300026089	Bacteria	1950
307	Ga0207648_10245474	3300026089	Bacteria	1595
308	Ga0207648_10726896	3300026089	Bacteria	921
309	Ga0207676_10084736	3300026095	Bacteria	2584
310	Ga0207676_10093166	3300026095	Bacteria	2479
311	Ga0207676_10981821	3300026095	Bacteria	831
312	Ga0207674_10024496	3300026116	Bacteria	6448
313	Ga0207674_10041528	3300026116	Bacteria	4756
314	Ga0207675_100000437	3300026118	Bacteria	40518
315	Ga0207675_100018382	3300026118	Bacteria	6518
316	Ga0207675_100091829	3300026118	Bacteria	2855
317	Ga0207675_100237136	3300026118	Bacteria	1761
318	Ga0207675_100980854	3300026118	Unclassified	863
319	Ga0207683_10022475	3300026121	Bacteria	5415
320	Ga0207683_10030166	3300026121	Bacteria	4698
321	Ga0207683_10118324	3300026121	Bacteria	2377
322	Ga0207683_10192191	3300026121	Bacteria	1853
323	Ga0207683_10632104	3300026121	Bacteria	991
324	Ga0207683_10671045	3300026121	Bacteria	961
325	Ga0207698_10025142	3300026142	Bacteria	4190
326	Ga0207698_10107245	3300026142	Bacteria	2331
327	Ga0207698_10271699	3300026142	Bacteria	1563
328	Ga0207698_10288000	3300026142	Unclassified	1523
329	Ga0207698_10298628	3300026142	Bacteria	1498
330	Ga0207698_10361531	3300026142	Bacteria	1375
331	Ga0207698_10573072	3300026142	Bacteria	1109
332	Ga0209974_10006891	3300027876	Bacteria	3940
333	Ga0268266_10015567	3300028379	Bacteria	6521
334	Ga0268265_10013143	3300028380	Bacteria	5624
335	Ga0268264_10026487	3300028381	Bacteria	4738
336	Ga0268264_10151932	3300028381	Bacteria	2077
337	Ga0268264_10209556	3300028381	Bacteria	1788
338	Ga0307517_10001975	3300028786	Bacteria	33407
339	Ga0307517_10132884	3300028786	Bacteria	1783
340	Ga0307515_10038558	3300028794	Bacteria	7637
341	Ga0307515_10044865	3300028794	Bacteria	6812
342	Ga0307515_10242174	3300028794	Bacteria	1572
343	Ga0307512_10061720	3300030522	Bacteria	2883
344	Ga0307512_10083347	3300030522	Bacteria	2281
345	Ga0307513_10014677	3300031456	Bacteria	9536
346	Ga0307513_10062278	3300031456	Bacteria	3944
347	Ga0307513_10165534	3300031456	Bacteria	2096
348	Ga0307509_10009555	3300031507	Bacteria	12087
349	Ga0307509_10027173	3300031507	Bacteria	6369
350	Ga0307509_10070485	3300031507	Bacteria	3650
351	Ga0307509_10077519	3300031507	Bacteria	3446
352	Ga0307509_10094110	3300031507	Bacteria	3055
353	Ga0307509_10110851	3300031507	Bacteria	2749
354	Ga0307509_10228896	3300031507	Bacteria	1664
355	Ga0307408_100257267	3300031548	Bacteria	1443
356	Ga0307508_10000271	3300031616	Bacteria	63576
357	Ga0307508_10003497	3300031616	Bacteria	15837
358	Ga0307508_10064405	3300031616	Bacteria	3231
359	Ga0307514_10217656	3300031649	Bacteria	1176
360	Ga0307516_10025523	3300031730	Bacteria	6016
361	Ga0307516_10055082	3300031730	Bacteria	3884
362	Ga0307516_10084353	3300031730	Bacteria	3016
363	Ga0307405_10321520	3300031731	Bacteria	1182
364	Ga0307413_10148802	3300031824	Bacteria	1629
365	Ga0307413_10237493	3300031824	Bacteria	1343
366	Ga0307407_10071972	3300031903	Bacteria	2060
367	Ga0307412_10007679	3300031911	Bacteria	6127
368	Ga0307412_10129177	3300031911	Bacteria	1833
369	Ga0307416_100851012	3300032002	Unclassified	1010
370	Ga0307414_10236679	3300032004	Bacteria	1509
371	Ga0307411_10007510	3300032005	Bacteria	5562
372	Ga0307415_100096040	3300032126	Bacteria	2159
373	Ga0307507_10037515	3300033179	Bacteria	4932
374	Ga0307510_10000122	3300033180	Bacteria	62024
375	Ga0307510_10041455	3300033180	Bacteria	5032
376	Ga0373926_0048605	3300035083	Bacteria	1526
377	Ga0373928_0022705	3300035084	Bacteria	1333
378	Ga0373931_0033445	3300035691	Bacteria	2664
379	Ga0373931_0411864	3300035691	Bacteria	858
380	Ga0373927_0229861	3300035695	Bacteria	1219
381	Ga0373933_0481730	3300035724	Unclassified	812
382	Ga0373937_0125495	3300036401	Bacteria	2394
383	Ga0373937_0766318	3300036401	Unclassified	912
384	Ga0373925_0011887	3300037068	Bacteria	6300
385	Ga0373925_0065554	3300037068	Bacteria	2736
386	Ga0451793_0286320	3300041452	Bacteria	878
387	Ga0451855_0440974	3300041511	Bacteria	1284
388	Ga0451577_0057907	3300042876	Bacteria	3453
389	Ga0453684_0197580	3300044712	Bacteria	2347
390	Ga0451576_0006110	3300045051	Bacteria	14839
391	Ga0451576_0083596	3300045051	Bacteria	3321
392	Ga0451576_0274636	3300045051	Bacteria	1762
393	Ga0495592_0000153	3300046454	Bacteria	60062
394	Ga0495590_0018945	3300046457	Bacteria	2457
395	Ga0495629_0229391	3300046459	Bacteria	1280
396	Ga0495638_0116566	3300046460	Bacteria	1582
397	Ga0495664_0098230	3300046477	Bacteria	1763
398	Ga0495610_0059607	3300046512	Bacteria	1821
399	Ga0495632_0008136	3300046519	Bacteria	6484
400	Ga0495632_0217730	3300046519	Bacteria	864
401	Ga0495632_0232780	3300046519	Bacteria	830
402	Ga0495648_0297337	3300046524	Bacteria	758
403	Ga0495642_0042450	3300046528	Bacteria	1853
404	Ga0495621_0085488	3300046539	Bacteria	1182
405	Ga0495597_0019840	3300046542	Bacteria	3140
406	Ga0495625_0079571	3300046660	Bacteria	2285
407	Ga0495658_0035930	3300046683	Bacteria	2730
408	Ga0495658_0079803	3300046683	Bacteria	1918
409	Ga0495658_0528160	3300046683	Bacteria	755
410	Ga0495613_0426883	3300046689	Unclassified	901
411	Ga0495671_0066016	3300046692	Bacteria	1781
412	Ga0495649_0002161	3300046694	Bacteria	14071
413	Ga0495660_0076201	3300046810	Bacteria	1767
414	Ga0495687_001027	3300047443	Bacteria	27802
415	Ga0495673_0225061	3300047469	Bacteria	693
416	Ga0495684_0219676	3300047471	Bacteria	1394
417	Ga0495686_0001940	3300047472	Bacteria	20588
418	Ga0495626_0053851	3300048091	Bacteria	1850
419	Ga0495626_0062028	3300048091	Bacteria	1699
420	Ga0496101_0402177	3300048904	Bacteria	1078
421	Ga0496108_0667257	3300048911	Bacteria	903
422	Ga0496108_0824701	3300048911	Bacteria	799
423	Ga0496109_0044338	3300048912	Bacteria	4035
424	Ga0496109_0148920	3300048912	Bacteria	2191
425	Ga0496110_0370404	3300048913	Bacteria	1305
426	Ga0496114_0363019	3300048917	Bacteria	1281
427	nmdc:mga03n38_253717_c1	3300050490	Bacteria	930
428	nmdc:mga0k408_145755_c1	3300050493	Bacteria	1410
429	nmdc:mga0k408_173623_c1	3300050493	Bacteria	1285
430	nmdc:mga0k408_17615_c1	3300050493	Bacteria	3981
431	nmdc:mga0k408_19160_c1	3300050493	Bacteria	3822
432	nmdc:mga0k408_207977_c1	3300050493	Bacteria	1168
433	nmdc:mga0k408_334978_c1	3300050493	Bacteria	902
434	nmdc:mga0k408_35940_c2	3300050493	Bacteria	2129
435	nmdc:mga0k408_565_c1	3300050493	Bacteria	20434
436	nmdc:mga0k408_603_c1	3300050493	Bacteria	19842
437	nmdc:mga0k408_74194_c1	3300050493	Bacteria	1988
438	nmdc:mga0k408_83688_c1	3300050493	Bacteria	1871
439	nmdc:mga0k408_90107_c1	3300050493	Bacteria	1801
440	nmdc:mga06z11_150105_c1	3300050494	Bacteria	1324
441	nmdc:mga06z11_46212_c1	3300050494	Bacteria	2205
442	nmdc:mga04h51_95792_c1	3300050495	Bacteria	1075
443	nmdc:mga07m45_109560_c1	3300050496	Bacteria	1590
444	nmdc:mga07m45_20702_c1	3300050496	Bacteria	3575
445	nmdc:mga07m45_31119_c2	3300050496	Bacteria	2600
446	nmdc:mga07m45_5077_c1	3300050496	Bacteria	6512
447	nmdc:mga07m45_7796_c1	3300050496	Bacteria	5480
448	nmdc:mga07m45_9342_c1	3300050496	Bacteria	5083
449	nmdc:mga0sz30_164255_c1	3300050516	Bacteria	984
450	Ga0495619_0070414	3300053085	Bacteria	2339
451	Ga0500644_0025555	3300053088	Bacteria	1819
452	Ga0500652_017134	3300053131	Bacteria	2652
453	Ga0500658_0001020	3300053134	Bacteria	11428
454	Ga0500559_0091022	3300053136	Bacteria	1397
455	Ga0500564_115683	3300053138	Bacteria	1173
456	Ga0500619_000048	3300053154	Bacteria	37454
457	Ga0500622_0007498	3300053156	Bacteria	6192

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300025986	Ga0207658_10056850	Ga0207658_100568504	171
2	3300031824	Ga0307413_10148802	Ga0307413_101488023	178
3	3300031507	Ga0307509_10009555	Ga0307509_100095557	185
4	3300031649	Ga0307514_10217656	Ga0307514_102176562	185
5	3300030522	Ga0307512_10061720	Ga0307512_100617202	188
6	3300033180	Ga0307510_10041455	Ga0307510_100414552	189
7	3300053156	Ga0500622_0007498	Ga0500622_0007498_1579_2289	189
8	3300005331	Ga0070670_100137665	Ga0070670_1001376652	190
9	3300005344	Ga0070661_100379167	Ga0070661_1003791671	190
10	3300005355	Ga0070671_100374405	Ga0070671_1003744052	190
11	3300005364	Ga0070673_100106767	Ga0070673_1001067672	190
12	3300005455	Ga0070663_100404569	Ga0070663_1004045691	190
13	3300009176	Ga0105242_11248658	Ga0105242_112486582	190
14	3300013297	Ga0157378_11720503	Ga0157378_117205031	190
15	3300042876	Ga0451577_0057907	Ga0451577_0057907_505_1206	190
16	3300048911	Ga0496108_0824701	Ga0496108_0824701_23_622	190
17	3300048917	Ga0496114_0363019	Ga0496114_0363019_67_666	190
18	3300031911	Ga0307412_10129177	Ga0307412_101291772	191
19	3300044712	Ga0453684_0197580	Ga0453684_0197580_1559_2260	191
20	3300046519	Ga0495632_0217730	Ga0495632_0217730_211_840	191
21	3300046524	Ga0495648_0297337	Ga0495648_0297337_157_738	192
22	3300005547	Ga0070693_100612651	Ga0070693_1006126511	195
23	3300005614	Ga0068856_100016853	Ga0068856_1000168533	195
24	3300013307	Ga0157372_10246847	Ga0157372_102468472	195
25	3300026078	Ga0207702_10307710	Ga0207702_103077102	195
26	3300031730	Ga0307516_10055082	Ga0307516_100550824	195
27	3300041511	Ga0451855_0440974	Ga0451855_0440974_224_934	195
28	3300047472	Ga0495686_0001940	Ga0495686_0001940_16218_16943	197
29	3300025940	Ga0207691_10243543	Ga0207691_102435432	200
30	3300026089	Ga0207648_10108805	Ga0207648_101088052	200
31	3300026118	Ga0207675_100980854	Ga0207675_1009808541	200
32	3300046454	Ga0495592_0000153	Ga0495592_0000153_3460_4113	202
33	3300053138	Ga0500564_115683	Ga0500564_115683_497_1150	202
34	3300009148	Ga0105243_10037161	Ga0105243_100371613	204
35	3300005328	Ga0070676_10001883	Ga0070676_100018838	206
36	3300005334	Ga0068869_100081244	Ga0068869_1000812443	206
37	3300005338	Ga0068868_100210332	Ga0068868_1002103322	206
38	3300005355	Ga0070671_100022927	Ga0070671_1000229278	206
39	3300005356	Ga0070674_100214140	Ga0070674_1002141402	206
40	3300005367	Ga0070667_100190369	Ga0070667_1001903692	206
41	3300005455	Ga0070663_100238017	Ga0070663_1002380172	206
42	3300005457	Ga0070662_100064032	Ga0070662_1000640322	206
43	3300005459	Ga0068867_100038202	Ga0068867_1000382026	206
44	3300005543	Ga0070672_100044935	Ga0070672_1000449352	206
45	3300005548	Ga0070665_100015847	Ga0070665_1000158475	206
46	3300005564	Ga0070664_100288852	Ga0070664_1002888522	206
47	3300005577	Ga0068857_100041838	Ga0068857_1000418384	206
48	3300005578	Ga0068854_100527065	Ga0068854_1005270651	206
49	3300005617	Ga0068859_100271860	Ga0068859_1002718602	206
50	3300005618	Ga0068864_100680181	Ga0068864_1006801812	206
51	3300006931	Ga0097620_100271858	Ga0097620_1002718582	206
52	3300009093	Ga0105240_10411110	Ga0105240_104111102	206
53	3300013297	Ga0157378_10147081	Ga0157378_101470814	206
54	3300014325	Ga0163163_10279051	Ga0163163_102790512	206
55	3300025893	Ga0207682_10097328	Ga0207682_100973282	206
56	3300025907	Ga0207645_10008719	Ga0207645_100087195	206
57	3300025908	Ga0207643_10058991	Ga0207643_100589912	206
58	3300025926	Ga0207659_10023849	Ga0207659_100238492	206
59	3300025931	Ga0207644_10030822	Ga0207644_100308222	206
60	3300025933	Ga0207706_10037591	Ga0207706_100375912	206
61	3300025935	Ga0207709_10020126	Ga0207709_100201263	206
62	3300025937	Ga0207669_10644759	Ga0207669_106447592	206
63	3300025938	Ga0207704_10031460	Ga0207704_100314604	206
64	3300025940	Ga0207691_10061538	Ga0207691_100615384	206
65	3300026089	Ga0207648_10007326	Ga0207648_100073262	206
66	3300026116	Ga0207674_10041528	Ga0207674_100415288	206
67	3300026121	Ga0207683_10192191	Ga0207683_101921912	206
68	3300028379	Ga0268266_10015567	Ga0268266_100155678	206
69	3300050493	nmdc:mga0k408_145755_c1	nmdc:mga0k408_145755_c1_548_1174	206
70	3300050493	nmdc:mga0k408_17615_c1	nmdc:mga0k408_17615_c1_2747_3373	206
71	3300050493	nmdc:mga0k408_35940_c2	nmdc:mga0k408_35940_c2_333_992	206
72	3300050496	nmdc:mga07m45_9342_c1	nmdc:mga07m45_9342_c1_3576_4202	206
73	3300041452	Ga0451793_0286320	Ga0451793_0286320_169_798	207
74	3300046692	Ga0495671_0066016	Ga0495671_0066016_515_1144	207
75	3300005328	Ga0070676_10145622	Ga0070676_101456222	209
76	3300005331	Ga0070670_100007394	Ga0070670_1000073949	209
77	3300005333	Ga0070677_10008030	Ga0070677_100080302	209
78	3300005338	Ga0068868_100052358	Ga0068868_1000523584	209
79	3300005344	Ga0070661_100383071	Ga0070661_1003830712	209
80	3300005347	Ga0070668_100212251	Ga0070668_1002122511	209
81	3300005354	Ga0070675_100009273	Ga0070675_1000092736	209
82	3300005355	Ga0070671_100007158	Ga0070671_1000071587	209
83	3300005356	Ga0070674_100002407	Ga0070674_1000024074	209
84	3300005364	Ga0070673_100010080	Ga0070673_1000100806	209
85	3300005367	Ga0070667_100139274	Ga0070667_1001392741	209
86	3300005456	Ga0070678_100004379	Ga0070678_1000043797	209
87	3300005459	Ga0068867_100034791	Ga0068867_1000347915	209
88	3300005543	Ga0070672_100014240	Ga0070672_1000142404	209
89	3300005616	Ga0068852_100037378	Ga0068852_1000373783	209
90	3300005618	Ga0068864_100017128	Ga0068864_1000171286	209
91	3300005840	Ga0068870_10008654	Ga0068870_100086544	209
92	3300006237	Ga0097621_100962794	Ga0097621_1009627942	209
93	3300013306	Ga0163162_10268858	Ga0163162_102688582	209
94	3300014969	Ga0157376_10839732	Ga0157376_108397322	209
95	3300025315	Ga0207697_10078310	Ga0207697_100783102	209
96	3300025893	Ga0207682_10041731	Ga0207682_100417312	209
97	3300025907	Ga0207645_10105987	Ga0207645_101059873	209
98	3300025908	Ga0207643_10040836	Ga0207643_100408362	209
99	3300025920	Ga0207649_10286034	Ga0207649_102860341	209
100	3300025923	Ga0207681_10006812	Ga0207681_100068122	209
101	3300025925	Ga0207650_10029526	Ga0207650_100295263	209
102	3300025926	Ga0207659_10001102	Ga0207659_100011028	209
103	3300025931	Ga0207644_10000537	Ga0207644_1000053719	209
104	3300025937	Ga0207669_10028040	Ga0207669_100280403	209
105	3300025937	Ga0207669_10043995	Ga0207669_100439952	209
106	3300025940	Ga0207691_10028304	Ga0207691_100283044	209
107	3300025960	Ga0207651_10046201	Ga0207651_100462013	209
108	3300026023	Ga0207677_10014089	Ga0207677_100140893	209
109	3300026089	Ga0207648_10012759	Ga0207648_100127596	209
110	3300026089	Ga0207648_10013271	Ga0207648_100132715	209
111	3300026095	Ga0207676_10084736	Ga0207676_100847362	209
112	3300026121	Ga0207683_10118324	Ga0207683_101183242	209
113	3300026121	Ga0207683_10632104	Ga0207683_106321042	209
114	3300026142	Ga0207698_10025142	Ga0207698_100251424	209
115	3300033180	Ga0307510_10000122	Ga0307510_1000012258	209
116	3300045051	Ga0451576_0006110	Ga0451576_0006110_3536_4174	209
117	3300046519	Ga0495632_0232780	Ga0495632_0232780_12_644	209
118	3300046683	Ga0495658_0035930	Ga0495658_0035930_1412_2044	209
119	3300047469	Ga0495673_0225061	Ga0495673_0225061_45_677	209
120	3300048091	Ga0495626_0062028	Ga0495626_0062028_1052_1684	209
121	3300050493	nmdc:mga0k408_334978_c1	nmdc:mga0k408_334978_c1_210_854	209
122	3300050496	nmdc:mga07m45_31119_c2	nmdc:mga07m45_31119_c2_1223_1855	209
123	3300053136	Ga0500559_0091022	Ga0500559_0091022_100_732	209
124	3300053154	Ga0500619_000048	Ga0500619_000048_1160_1792	209
125	3300005347	Ga0070668_100138587	Ga0070668_1001385872	210
126	3300005356	Ga0070674_100152941	Ga0070674_1001529412	210
127	3300005459	Ga0068867_100432861	Ga0068867_1004328612	210
128	3300005719	Ga0068861_100045999	Ga0068861_1000459993	210
129	3300009553	Ga0105249_10014728	Ga0105249_100147286	210
130	3300013306	Ga0163162_10235391	Ga0163162_102353914	210
131	3300014326	Ga0157380_10073990	Ga0157380_100739902	210
132	3300017792	Ga0163161_10262096	Ga0163161_102620962	210
133	3300025934	Ga0207686_10086723	Ga0207686_100867234	210
134	3300025938	Ga0207704_10133027	Ga0207704_101330272	210
135	3300025961	Ga0207712_10073003	Ga0207712_100730034	210
136	3300025972	Ga0207668_10129756	Ga0207668_101297562	210
137	3300026089	Ga0207648_10245474	Ga0207648_102454742	210
138	3300026118	Ga0207675_100018382	Ga0207675_1000183823	210
139	3300005457	Ga0070662_100115959	Ga0070662_1001159592	211
140	3300005577	Ga0068857_100006256	Ga0068857_1000062566	211
141	3300005616	Ga0068852_100186012	Ga0068852_1001860122	211
142	3300005843	Ga0068860_100527007	Ga0068860_1005270072	211
143	3300006038	Ga0075365_10128483	Ga0075365_101284833	211
144	3300006038	Ga0075365_10241881	Ga0075365_102418812	211
145	3300006042	Ga0075368_10144194	Ga0075368_101441942	211
146	3300006042	Ga0075368_10180595	Ga0075368_101805952	211
147	3300006048	Ga0075363_100079230	Ga0075363_1000792302	211
148	3300006048	Ga0075363_100131356	Ga0075363_1001313562	211
149	3300006051	Ga0075364_10025873	Ga0075364_100258732	211
150	3300006177	Ga0075362_10201676	Ga0075362_102016762	211
151	3300006178	Ga0075367_10013431	Ga0075367_100134315	211
152	3300006178	Ga0075367_10060128	Ga0075367_100601282	211
153	3300006178	Ga0075367_10316186	Ga0075367_103161862	211
154	3300006186	Ga0075369_10047437	Ga0075369_100474372	211
155	3300006195	Ga0075366_10000238	Ga0075366_100002382	211
156	3300006195	Ga0075366_10002285	Ga0075366_100022858	211
157	3300006195	Ga0075366_10017161	Ga0075366_100171612	211
158	3300006195	Ga0075366_10105244	Ga0075366_101052442	211
159	3300006195	Ga0075366_10457451	Ga0075366_104574512	211
160	3300006353	Ga0075370_10003402	Ga0075370_100034023	211
161	3300006353	Ga0075370_10003622	Ga0075370_100036227	211
162	3300006353	Ga0075370_10007889	Ga0075370_100078894	211
163	3300006353	Ga0075370_10167143	Ga0075370_101671432	211
164	3300009545	Ga0105237_10026456	Ga0105237_100264563	211
165	3300010375	Ga0105239_10084454	Ga0105239_100844544	211
166	3300013297	Ga0157378_10517925	Ga0157378_105179252	211
167	3300025913	Ga0207695_10340732	Ga0207695_103407322	211
168	3300025914	Ga0207671_10020453	Ga0207671_100204532	211
169	3300025933	Ga0207706_10160655	Ga0207706_101606553	211
170	3300025933	Ga0207706_10386829	Ga0207706_103868292	211
171	3300025935	Ga0207709_10688963	Ga0207709_106889631	211
172	3300025938	Ga0207704_10077266	Ga0207704_100772661	211
173	3300025938	Ga0207704_10305273	Ga0207704_103052732	211
174	3300025942	Ga0207689_10105664	Ga0207689_101056643	211
175	3300025949	Ga0207667_10386266	Ga0207667_103862662	211
176	3300026023	Ga0207677_10370963	Ga0207677_103709632	211
177	3300026067	Ga0207678_10417589	Ga0207678_104175891	211
178	3300026088	Ga0207641_10386292	Ga0207641_103862922	211
179	3300026089	Ga0207648_10166075	Ga0207648_101660753	211
180	3300026116	Ga0207674_10024496	Ga0207674_100244965	211
181	3300026142	Ga0207698_10573072	Ga0207698_105730721	211
182	3300028794	Ga0307515_10242174	Ga0307515_102421742	211
183	3300031730	Ga0307516_10084353	Ga0307516_100843534	211
184	3300046457	Ga0495590_0018945	Ga0495590_0018945_437_1144	211
185	3300046512	Ga0495610_0059607	Ga0495610_0059607_363_1070	211
186	3300046519	Ga0495632_0008136	Ga0495632_0008136_2319_3026	211
187	3300046528	Ga0495642_0042450	Ga0495642_0042450_650_1357	211
188	3300046542	Ga0495597_0019840	Ga0495597_0019840_2400_3107	211
189	3300046694	Ga0495649_0002161	Ga0495649_0002161_9969_10676	211
190	3300046810	Ga0495660_0076201	Ga0495660_0076201_71_778	211
191	3300047443	Ga0495687_001027	Ga0495687_001027_3394_4101	211
192	3300048091	Ga0495626_0053851	Ga0495626_0053851_149_856	211
193	3300050490	nmdc:mga03n38_253717_c1	nmdc:mga03n38_253717_c1_11_718	211
194	3300050493	nmdc:mga0k408_19160_c1	nmdc:mga0k408_19160_c1_1230_1937	211
195	3300050493	nmdc:mga0k408_565_c1	nmdc:mga0k408_565_c1_12460_13167	211
196	3300050493	nmdc:mga0k408_603_c1	nmdc:mga0k408_603_c1_18184_18891	211
197	3300050493	nmdc:mga0k408_83688_c1	nmdc:mga0k408_83688_c1_81_788	211
198	3300050493	nmdc:mga0k408_90107_c1	nmdc:mga0k408_90107_c1_154_861	211
199	3300050494	nmdc:mga06z11_46212_c1	nmdc:mga06z11_46212_c1_1303_2010	211
200	3300050495	nmdc:mga04h51_95792_c1	nmdc:mga04h51_95792_c1_53_760	211
201	3300050496	nmdc:mga07m45_109560_c1	nmdc:mga07m45_109560_c1_616_1269	211
202	3300050496	nmdc:mga07m45_20702_c1	nmdc:mga07m45_20702_c1_93_800	211
203	3300050496	nmdc:mga07m45_5077_c1	nmdc:mga07m45_5077_c1_2169_2876	211
204	3300050496	nmdc:mga07m45_7796_c1	nmdc:mga07m45_7796_c1_1982_2689	211
205	3300050516	nmdc:mga0sz30_164255_c1	nmdc:mga0sz30_164255_c1_17_724	211
206	3300053134	Ga0500658_0001020	Ga0500658_0001020_8220_8927	211
207	3300027876	Ga0209974_10006891	Ga0209974_100068915	212
208	3300028794	Ga0307515_10044865	Ga0307515_100448654	212
209	3300031456	Ga0307513_10014677	Ga0307513_100146778	212
210	3300031507	Ga0307509_10110851	Ga0307509_101108514	212
211	3300031616	Ga0307508_10000271	Ga0307508_1000027144	212
212	3300031731	Ga0307405_10321520	Ga0307405_103215202	212
213	3300032002	Ga0307416_100851012	Ga0307416_1008510121	212
214	3300046683	Ga0495658_0528160	Ga0495658_0528160_35_745	212
215	3300048904	Ga0496101_0402177	Ga0496101_0402177_323_1027	212
216	3300053088	Ga0500644_0025555	Ga0500644_0025555_14_724	212
217	iso_pu_bacteria	2585428062	2587754152	212
218	3300005331	Ga0070670_100025563	Ga0070670_1000255636	213
219	3300005331	Ga0070670_100095992	Ga0070670_1000959922	213
220	3300005331	Ga0070670_100128726	Ga0070670_1001287261	213
221	3300005333	Ga0070677_10055583	Ga0070677_100555832	213
222	3300005354	Ga0070675_100096698	Ga0070675_1000966984	213
223	3300005356	Ga0070674_100159021	Ga0070674_1001590212	213
224	3300005356	Ga0070674_100451940	Ga0070674_1004519402	213
225	3300005456	Ga0070678_100089307	Ga0070678_1000893073	213
226	3300005456	Ga0070678_100161814	Ga0070678_1001618142	213
227	3300005543	Ga0070672_100492625	Ga0070672_1004926252	213
228	3300005564	Ga0070664_100054435	Ga0070664_1000544353	213
229	3300005616	Ga0068852_100013659	Ga0068852_1000136595	213
230	3300005616	Ga0068852_100129111	Ga0068852_1001291112	213
231	3300006881	Ga0068865_100378061	Ga0068865_1003780612	213
232	3300009094	Ga0111539_11442987	Ga0111539_114429871	213
233	3300009177	Ga0105248_10837726	Ga0105248_108377261	213
234	3300013297	Ga0157378_10162588	Ga0157378_101625883	213
235	3300017792	Ga0163161_10239523	Ga0163161_102395232	213
236	3300025893	Ga0207682_10035940	Ga0207682_100359402	213
237	3300025908	Ga0207643_10056482	Ga0207643_100564822	213
238	3300025925	Ga0207650_10011105	Ga0207650_100111058	213
239	3300025926	Ga0207659_10159735	Ga0207659_101597352	213
240	3300025933	Ga0207706_10188878	Ga0207706_101888783	213
241	3300025940	Ga0207691_10312715	Ga0207691_103127152	213
242	3300025945	Ga0207679_10397826	Ga0207679_103978262	213
243	3300025945	Ga0207679_10443406	Ga0207679_104434062	213
244	3300025960	Ga0207651_10050035	Ga0207651_100500352	213
245	3300025981	Ga0207640_10836114	Ga0207640_108361141	213
246	3300026041	Ga0207639_10772625	Ga0207639_107726252	213
247	3300026067	Ga0207678_10010974	Ga0207678_100109747	213
248	3300026089	Ga0207648_10726896	Ga0207648_107268962	213
249	3300026142	Ga0207698_10107245	Ga0207698_101072454	213
250	3300026142	Ga0207698_10298628	Ga0207698_102986282	213
251	3300035724	Ga0373933_0481730	Ga0373933_0481730_53_781	213
252	3300036401	Ga0373937_0766318	Ga0373937_0766318_140_868	213
253	3300037068	Ga0373925_0065554	Ga0373925_0065554_1131_1859	213
254	3300046459	Ga0495629_0229391	Ga0495629_0229391_129_857	213
255	3300046689	Ga0495613_0426883	Ga0495613_0426883_96_824	213
256	3300047471	Ga0495684_0219676	Ga0495684_0219676_552_1280	213
257	3300048912	Ga0496109_0148920	Ga0496109_0148920_467_1189	213
258	3300048913	Ga0496110_0370404	Ga0496110_0370404_144_866	213
259	3300053085	Ga0495619_0070414	Ga0495619_0070414_280_1008	213
260	3300005328	Ga0070676_10035138	Ga0070676_100351384	214
261	3300005331	Ga0070670_100010949	Ga0070670_1000109495	214
262	3300005331	Ga0070670_100787784	Ga0070670_1007877841	214
263	3300005333	Ga0070677_10105842	Ga0070677_101058422	214
264	3300005334	Ga0068869_100440207	Ga0068869_1004402071	214
265	3300005335	Ga0070666_10085571	Ga0070666_100855714	214
266	3300005338	Ga0068868_100090342	Ga0068868_1000903424	214
267	3300005338	Ga0068868_100184473	Ga0068868_1001844732	214
268	3300005354	Ga0070675_100080091	Ga0070675_1000800914	214
269	3300005355	Ga0070671_100008311	Ga0070671_1000083115	214
270	3300005355	Ga0070671_100038584	Ga0070671_1000385843	214
271	3300005355	Ga0070671_100111150	Ga0070671_1001111503	214
272	3300005364	Ga0070673_100312379	Ga0070673_1003123791	214
273	3300005364	Ga0070673_100366109	Ga0070673_1003661092	214
274	3300005364	Ga0070673_100522238	Ga0070673_1005222381	214
275	3300005365	Ga0070688_100071491	Ga0070688_1000714912	214
276	3300005367	Ga0070667_100075751	Ga0070667_1000757514	214
277	3300005367	Ga0070667_100116971	Ga0070667_1001169711	214
278	3300005445	Ga0070708_100751488	Ga0070708_1007514882	214
279	3300005455	Ga0070663_100232892	Ga0070663_1002328922	214
280	3300005456	Ga0070678_100041326	Ga0070678_1000413262	214
281	3300005456	Ga0070678_100202851	Ga0070678_1002028511	214
282	3300005456	Ga0070678_100253386	Ga0070678_1002533862	214
283	3300005459	Ga0068867_100011197	Ga0068867_1000111974	214
284	3300005467	Ga0070706_100016850	Ga0070706_1000168506	214
285	3300005468	Ga0070707_100007656	Ga0070707_1000076568	214
286	3300005471	Ga0070698_100144170	Ga0070698_1001441702	214
287	3300005539	Ga0068853_100618966	Ga0068853_1006189662	214
288	3300005543	Ga0070672_100011799	Ga0070672_1000117995	214
289	3300005548	Ga0070665_100076667	Ga0070665_1000766674	214
290	3300005564	Ga0070664_100254587	Ga0070664_1002545872	214
291	3300005578	Ga0068854_100067480	Ga0068854_1000674803	214
292	3300005614	Ga0068856_100794910	Ga0068856_1007949102	214
293	3300005616	Ga0068852_100351402	Ga0068852_1003514022	214
294	3300005616	Ga0068852_100640771	Ga0068852_1006407711	214
295	3300005617	Ga0068859_100028879	Ga0068859_1000288794	214
296	3300005617	Ga0068859_100039493	Ga0068859_1000394934	214
297	3300005618	Ga0068864_100002333	Ga0068864_1000023338	214
298	3300005618	Ga0068864_100012150	Ga0068864_1000121504	214
299	3300005618	Ga0068864_100076316	Ga0068864_1000763162	214
300	3300005841	Ga0068863_100122401	Ga0068863_1001224012	214
301	3300005842	Ga0068858_100785575	Ga0068858_1007855751	214
302	3300005843	Ga0068860_100233488	Ga0068860_1002334882	214
303	3300005843	Ga0068860_100243889	Ga0068860_1002438892	214
304	3300006178	Ga0075367_10006801	Ga0075367_100068018	214
305	3300006186	Ga0075369_10016233	Ga0075369_100162332	214
306	3300006195	Ga0075366_10015694	Ga0075366_100156942	214
307	3300006195	Ga0075366_10060801	Ga0075366_100608012	214
308	3300006237	Ga0097621_100062486	Ga0097621_1000624862	214
309	3300006353	Ga0075370_10072907	Ga0075370_100729071	214
310	3300006353	Ga0075370_10136654	Ga0075370_101366542	214
311	3300006358	Ga0068871_100019122	Ga0068871_1000191224	214
312	3300006358	Ga0068871_100028313	Ga0068871_1000283132	214
313	3300006358	Ga0068871_100803333	Ga0068871_1008033331	214
314	3300006881	Ga0068865_100043562	Ga0068865_1000435623	214
315	3300006931	Ga0097620_100028878	Ga0097620_1000288784	214
316	3300006931	Ga0097620_100039493	Ga0097620_1000394934	214
317	3300009098	Ga0105245_10059345	Ga0105245_100593451	214
318	3300009098	Ga0105245_10478371	Ga0105245_104783712	214
319	3300009177	Ga0105248_10055987	Ga0105248_100559878	214
320	3300009177	Ga0105248_10220975	Ga0105248_102209753	214
321	3300013297	Ga0157378_10253214	Ga0157378_102532142	214
322	3300013306	Ga0163162_10239017	Ga0163162_102390172	214
323	3300013308	Ga0157375_10023553	Ga0157375_100235534	214
324	3300013308	Ga0157375_10132268	Ga0157375_101322684	214
325	3300013308	Ga0157375_10457112	Ga0157375_104571122	214
326	3300014968	Ga0157379_10057966	Ga0157379_100579662	214
327	3300014968	Ga0157379_10089615	Ga0157379_100896154	214
328	3300014969	Ga0157376_10008366	Ga0157376_100083666	214
329	3300014969	Ga0157376_10083623	Ga0157376_100836234	214
330	3300014969	Ga0157376_10085329	Ga0157376_100853292	214
331	3300017792	Ga0163161_10154788	Ga0163161_101547882	214
332	3300025903	Ga0207680_10101286	Ga0207680_101012861	214
333	3300025907	Ga0207645_10040896	Ga0207645_100408964	214
334	3300025910	Ga0207684_10018036	Ga0207684_100180363	214
335	3300025922	Ga0207646_10026212	Ga0207646_100262125	214
336	3300025925	Ga0207650_10206965	Ga0207650_102069652	214
337	3300025926	Ga0207659_10006244	Ga0207659_100062445	214
338	3300025926	Ga0207659_10007533	Ga0207659_100075338	214
339	3300025931	Ga0207644_10022107	Ga0207644_100221074	214
340	3300025931	Ga0207644_10027110	Ga0207644_100271102	214
341	3300025933	Ga0207706_10176643	Ga0207706_101766432	214
342	3300025933	Ga0207706_10706563	Ga0207706_107065631	214
343	3300025938	Ga0207704_10340880	Ga0207704_103408802	214
344	3300025940	Ga0207691_10008879	Ga0207691_100088797	214
345	3300025940	Ga0207691_10648672	Ga0207691_106486721	214
346	3300025941	Ga0207711_10031153	Ga0207711_100311535	214
347	3300025942	Ga0207689_10504849	Ga0207689_105048492	214
348	3300025945	Ga0207679_10064155	Ga0207679_100641552	214
349	3300025960	Ga0207651_10039936	Ga0207651_100399362	214
350	3300025972	Ga0207668_10444626	Ga0207668_104446262	214
351	3300025981	Ga0207640_10286617	Ga0207640_102866172	214
352	3300025986	Ga0207658_10017804	Ga0207658_100178045	214
353	3300025986	Ga0207658_10079124	Ga0207658_100791243	214
354	3300026023	Ga0207677_10049143	Ga0207677_100491434	214
355	3300026023	Ga0207677_10277201	Ga0207677_102772012	214
356	3300026035	Ga0207703_10019767	Ga0207703_100197672	214
357	3300026041	Ga0207639_10558359	Ga0207639_105583592	214
358	3300026067	Ga0207678_10266400	Ga0207678_102664002	214
359	3300026088	Ga0207641_10068981	Ga0207641_100689813	214
360	3300026088	Ga0207641_10486253	Ga0207641_104862532	214
361	3300026089	Ga0207648_10031382	Ga0207648_100313825	214
362	3300026095	Ga0207676_10093166	Ga0207676_100931662	214
363	3300026095	Ga0207676_10981821	Ga0207676_109818211	214
364	3300026118	Ga0207675_100091829	Ga0207675_1000918294	214
365	3300026121	Ga0207683_10022475	Ga0207683_100224755	214
366	3300026121	Ga0207683_10030166	Ga0207683_100301661	214
367	3300026142	Ga0207698_10271699	Ga0207698_102716992	214
368	3300026142	Ga0207698_10288000	Ga0207698_102880002	214
369	3300026142	Ga0207698_10361531	Ga0207698_103615312	214
370	3300028381	Ga0268264_10151932	Ga0268264_101519324	214
371	3300028381	Ga0268264_10209556	Ga0268264_102095562	214
372	3300028786	Ga0307517_10001975	Ga0307517_1000197518	214
373	3300028786	Ga0307517_10132884	Ga0307517_101328842	214
374	3300028794	Ga0307515_10038558	Ga0307515_100385588	214
375	3300030522	Ga0307512_10083347	Ga0307512_100833472	214
376	3300031456	Ga0307513_10062278	Ga0307513_100622784	214
377	3300031456	Ga0307513_10165534	Ga0307513_101655342	214
378	3300031507	Ga0307509_10027173	Ga0307509_100271735	214
379	3300031507	Ga0307509_10070485	Ga0307509_100704856	214
380	3300031507	Ga0307509_10077519	Ga0307509_100775194	214
381	3300031507	Ga0307509_10094110	Ga0307509_100941102	214
382	3300031507	Ga0307509_10228896	Ga0307509_102288962	214
383	3300031616	Ga0307508_10003497	Ga0307508_1000349711	214
384	3300031616	Ga0307508_10064405	Ga0307508_100644052	214
385	3300031730	Ga0307516_10025523	Ga0307516_100255232	214
386	3300031824	Ga0307413_10237493	Ga0307413_102374932	214
387	3300031903	Ga0307407_10071972	Ga0307407_100719722	214
388	3300031911	Ga0307412_10007679	Ga0307412_100076794	214
389	3300032004	Ga0307414_10236679	Ga0307414_102366791	214
390	3300032005	Ga0307411_10007510	Ga0307411_100075103	214
391	3300032126	Ga0307415_100096040	Ga0307415_1000960403	214
392	3300033179	Ga0307507_10037515	Ga0307507_100375156	214
393	3300035084	Ga0373928_0022705	Ga0373928_0022705_236_898	214
394	3300035691	Ga0373931_0033445	Ga0373931_0033445_330_992	214
395	3300035691	Ga0373931_0411864	Ga0373931_0411864_168_827	214
396	3300035695	Ga0373927_0229861	Ga0373927_0229861_461_1177	214
397	3300036401	Ga0373937_0125495	Ga0373937_0125495_466_1182	214
398	3300045051	Ga0451576_0083596	Ga0451576_0083596_1701_2435	214
399	3300045051	Ga0451576_0274636	Ga0451576_0274636_554_1270	214
400	3300046460	Ga0495638_0116566	Ga0495638_0116566_328_1038	214
401	3300046539	Ga0495621_0085488	Ga0495621_0085488_183_926	214
402	3300046660	Ga0495625_0079571	Ga0495625_0079571_125_835	214
403	3300048911	Ga0496108_0667257	Ga0496108_0667257_102_845	214
404	3300048912	Ga0496109_0044338	Ga0496109_0044338_938_1666	214
405	3300050493	nmdc:mga0k408_207977_c1	nmdc:mga0k408_207977_c1_428_1150	214
406	3300053131	Ga0500652_017134	Ga0500652_017134_1482_2171	214
407	iso_pu_bacteria	2643221654	2644302992	214
408	3300005295	Ga0065707_10255445	Ga0065707_102554452	215
409	3300005328	Ga0070676_10188568	Ga0070676_101885682	215
410	3300005347	Ga0070668_100539175	Ga0070668_1005391751	215
411	3300005355	Ga0070671_100098910	Ga0070671_1000989104	215
412	3300005441	Ga0070700_100043013	Ga0070700_1000430134	215
413	3300005456	Ga0070678_100151611	Ga0070678_1001516111	215
414	3300005459	Ga0068867_100004202	Ga0068867_1000042028	215
415	3300005617	Ga0068859_100111783	Ga0068859_1001117832	215
416	3300005718	Ga0068866_10065718	Ga0068866_100657182	215
417	3300005719	Ga0068861_100014317	Ga0068861_1000143172	215
418	3300005719	Ga0068861_100379983	Ga0068861_1003799832	215
419	3300005842	Ga0068858_100026016	Ga0068858_1000260162	215
420	3300005843	Ga0068860_100007532	Ga0068860_1000075323	215
421	3300005843	Ga0068860_100187707	Ga0068860_1001877072	215
422	3300005844	Ga0068862_100010243	Ga0068862_1000102435	215
423	3300005844	Ga0068862_100031437	Ga0068862_1000314378	215
424	3300005937	Ga0081455_10169083	Ga0081455_101690833	215
425	3300006177	Ga0075362_10051002	Ga0075362_100510022	215
426	3300006178	Ga0075367_10135770	Ga0075367_101357702	215
427	3300006195	Ga0075366_10174966	Ga0075366_101749662	215
428	3300006881	Ga0068865_100322769	Ga0068865_1003227692	215
429	3300006931	Ga0097620_100111780	Ga0097620_1001117802	215
430	3300009176	Ga0105242_11119799	Ga0105242_111197992	215
431	3300009553	Ga0105249_10051022	Ga0105249_100510223	215
432	3300013297	Ga0157378_10012503	Ga0157378_100125033	215
433	3300013306	Ga0163162_10006024	Ga0163162_1000602411	215
434	3300013308	Ga0157375_10170608	Ga0157375_101706082	215
435	3300014326	Ga0157380_10135766	Ga0157380_101357662	215
436	3300014968	Ga0157379_10035363	Ga0157379_100353635	215
437	3300017792	Ga0163161_10069213	Ga0163161_100692132	215
438	3300025899	Ga0207642_10066266	Ga0207642_100662661	215
439	3300025935	Ga0207709_10156553	Ga0207709_101565532	215
440	3300025938	Ga0207704_10049657	Ga0207704_100496574	215
441	3300025972	Ga0207668_10024966	Ga0207668_100249663	215
442	3300025986	Ga0207658_10091282	Ga0207658_100912822	215
443	3300026035	Ga0207703_10457403	Ga0207703_104574031	215
444	3300026067	Ga0207678_10140693	Ga0207678_101406932	215
445	3300026075	Ga0207708_10014402	Ga0207708_100144025	215
446	3300026089	Ga0207648_10002847	Ga0207648_1000284714	215
447	3300026118	Ga0207675_100000437	Ga0207675_10000043713	215
448	3300026118	Ga0207675_100237136	Ga0207675_1002371363	215
449	3300026121	Ga0207683_10671045	Ga0207683_106710452	215
450	3300028380	Ga0268265_10013143	Ga0268265_100131435	215
451	3300028381	Ga0268264_10026487	Ga0268264_100264875	215
452	3300031548	Ga0307408_100257267	Ga0307408_1002572672	215
453	3300035083	Ga0373926_0048605	Ga0373926_0048605_794_1468	215
454	3300037068	Ga0373925_0011887	Ga0373925_0011887_4621_5295	215
455	3300046477	Ga0495664_0098230	Ga0495664_0098230_274_921	215
456	3300046683	Ga0495658_0079803	Ga0495658_0079803_983_1657	215
457	3300050493	nmdc:mga0k408_173623_c1	nmdc:mga0k408_173623_c1_260_907	215
458	3300050493	nmdc:mga0k408_74194_c1	nmdc:mga0k408_74194_c1_1232_1906	215
459	3300050494	nmdc:mga06z11_150105_c1	nmdc:mga06z11_150105_c1_271_918	215

Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
2b7k-assembly3.cif.gz_C	crystal structure of yeast sco1	0.7725	59	206
4bpy-assembly1.cif.gz_A	crystal structure of the c90a mutant of the sco copper chaperone protein from streptomyces lividans	0.7701	55	203
1wp0-assembly1.cif.gz_A	human sco1	0.7688	68	206
2b7j-assembly3.cif.gz_C	crystal structure of yeast sco1 with copper bound	0.7605	59	206
2b7j-assembly4.cif.gz_D	crystal structure of yeast sco1 with copper bound	0.743	61	206

ID	Description	Score	Start	End	Superfamily
af_Q54TT7_154_312_3.40.30.10	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.7851	65	206	3.40.30.10
af_B4FLA5_101_276_3.40.30.10	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.7833	60	207	3.40.30.10
4bpyA00	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.7658	55	203	3.40.30.10
af_Q4DE34_85_262_3.40.30.10	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.7645	59	206	3.40.30.10
af_Q8IC00_108_304_3.40.30.10	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.7608	59	209	3.40.30.10

ID	Description	Score	Start	End
AF-A0A536VIA3-F1-model_v4	Cytochrome C oxidase subunit I	0.9178	73	207
AF-A0A4V0X9I9-F1-model_v4	Thioredoxin peroxidase	0.9149	62	207
AF-A0A536VIA3-F1-model_v4	Cytochrome C oxidase subunit I	0.8918	73	207
AF-A0A6J4NYK0-F1-model_v4	Transmembrane protein	0.8897	27	215
AF-A0A1I1JRY1-F1-model_v4	Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC family	0.8889	26	215

Feature Viewer

pLDDT	pTM	Quality
84.18	0.72	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F448370

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map