F448343

General Info

Members Datasets Scaffolds Average Seq Length
459 231 918 395

Family's Representative Sequence

Representative Sequence 3300006914|Ga0075436_100001628|Ga0075436_1000016287
Length 459
Sequence LGEPTSQRANAIIEYGDLHRKDFKILGLTLPSLQPRLISAAQCCFQMPPAAAKLAANERTFMPDRRIYLDHSATTPVDPRVAEALARSLAENFGNPSSVHAFGQRARAAVDRARREVAALINARPNEIIFTSGGTEANNLAIRGICEASAAHGKHIVTSAIEHPSVHGVCSALEQRGWEVTRLPVYENGVVRIEGVRDAIRLDTVLVTVMLANNEIGTIQPINEIGELIRERRANGQKHLFLHTDAVQAAGRMALNVDELGCDLLTMSAHKLYAPKGIGALYVRRGVRLVGQNIGGHQERERRAGTENVPGIVAFGEAAKLARKELRERTVHDASLRDDFERKVSDAIPELVFNGDRIRRLPHLSNISFRYIEGEGLLINLDLQGVAVSTGSACSSGTLEPSPVIRALGVDDEIARGSIRFSFGKDNTDADVDYTVNVLAQAVERLRALSPLTRPLVAS

Samples

Sample ID Description Type Environment
1 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
112 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
113 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
114 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
173 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
174 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
175 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
178 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
179 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
182 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
183 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
184 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
185 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
188 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
189 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
192 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
196 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
207 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
208 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
209 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
210 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
211 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
212 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
213 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
214 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
215 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
216 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
217 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
218 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
219 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
220 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
229 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
230 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
231 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.44
Nodule 0
Rhizoplane 0.44
Rhizosphere 96.95
Stem 0
Stem Tuber 0
Unclassified 12.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075436_100001628 3300006914 Bacteria 15372
2 CNAas_1000011 3300000532 Bacteria 11080
3 JGI24748J21848_1000008 3300002074 Bacteria 191483
4 JGI24034J26672_10000002 3300002239 Bacteria 925353
5 JGI24751J29686_10000137 3300002459 Bacteria 36592
6 rootH1_10034215 3300003323 Bacteria 4981
7 rootH1_10153182 3300003323 Bacteria 8518
8 Ga0065704_10072426 3300005289 Bacteria 8542
9 Ga0065712_10000127 3300005290 Bacteria 117106
10 Ga0065712_10018890 3300005290 Bacteria 2067
11 Ga0065715_10018897 3300005293 Unclassified 1884
12 Ga0065715_10090628 3300005293 Bacteria 6707
13 Ga0065707_10002546 3300005295 Bacteria 6257
14 Ga0070658_10047974 3300005327 Bacteria 3457
15 Ga0070676_10000064 3300005328 Bacteria 35148
16 Ga0070676_10127554 3300005328 Bacteria 1605
17 Ga0070690_100095677 3300005330 Bacteria 1962
18 Ga0070690_100214529 3300005330 Bacteria 1346
19 Ga0070670_100004087 3300005331 Bacteria 12190
20 Ga0070670_100005843 3300005331 Bacteria 10403
21 Ga0068869_100101473 3300005334 Bacteria 2177
22 Ga0068869_100156091 3300005334 Bacteria 1773
23 Ga0070666_10000558 3300005335 Bacteria 22499
24 Ga0070680_100000719 3300005336 Bacteria 23013
25 Ga0070680_100015070 3300005336 Bacteria 6052
26 Ga0070680_100020943 3300005336 Bacteria 5192
27 Ga0070680_100025770 3300005336 Bacteria 4701
28 Ga0070680_100156780 3300005336 Bacteria 1913
29 Ga0070682_100000714 3300005337 Bacteria 19932
30 Ga0070682_100006506 3300005337 Bacteria 6558
31 Ga0070682_100035230 3300005337 Bacteria 3054
32 Ga0068868_100003442 3300005338 Bacteria 11021
33 Ga0068868_100024403 3300005338 Unclassified 4587
34 Ga0068868_100046943 3300005338 Unclassified 3381
35 Ga0070660_100010393 3300005339 Bacteria 6580
36 Ga0070689_100001418 3300005340 Bacteria 15284
37 Ga0070691_10008429 3300005341 Bacteria 4717
38 Ga0070687_100063627 3300005343 Bacteria 1957
39 Ga0070661_100004333 3300005344 Bacteria 9790
40 Ga0070692_10030458 3300005345 Bacteria 2698
41 Ga0070692_10048610 3300005345 Bacteria 2198
42 Ga0070668_100000222 3300005347 Bacteria 36600
43 Ga0070668_100002758 3300005347 Bacteria 12916
44 Ga0070669_100030004 3300005353 Archaea 3921
45 Ga0070669_100175067 3300005353 Bacteria 1675
46 Ga0070675_100020159 3300005354 Bacteria 5320
47 Ga0070671_100114639 3300005355 Bacteria 2265
48 Ga0070673_100072083 3300005364 Bacteria 2777
49 Ga0070673_100097013 3300005364 Bacteria 2420
50 Ga0070673_100211204 3300005364 Bacteria 1676
51 Ga0070659_100002545 3300005366 Bacteria 12966
52 Ga0070667_100000240 3300005367 Bacteria 62100
53 Ga0070703_10006697 3300005406 Bacteria 3228
54 Ga0070705_100042145 3300005440 Bacteria 2608
55 Ga0070705_100191628 3300005440 Bacteria 1394
56 Ga0070700_100000155 3300005441 Bacteria 39898
57 Ga0070700_100023873 3300005441 Unclassified 3583
58 Ga0070700_100034934 3300005441 Bacteria 3039
59 Ga0070700_100066641 3300005441 Bacteria 2286
60 Ga0070694_100003337 3300005444 Bacteria 9605
61 Ga0070694_100016541 3300005444 Bacteria 4644
62 Ga0070694_100078337 3300005444 Bacteria 2292
63 Ga0070708_100000123 3300005445 Bacteria 52148
64 Ga0070678_100060727 3300005456 Bacteria 2784
65 Ga0070662_100066278 3300005457 Bacteria 2649
66 Ga0070681_10001930 3300005458 Bacteria 18715
67 Ga0070681_10002427 3300005458 Bacteria 17048
68 Ga0070681_10309025 3300005458 Bacteria 1490
69 Ga0068867_100006068 3300005459 Bacteria 8566
70 Ga0068867_100154097 3300005459 Unclassified 1807
71 Ga0070706_100008396 3300005467 Bacteria 9624
72 Ga0070706_100054354 3300005467 Bacteria 3696
73 Ga0070706_100109769 3300005467 Bacteria 2567
74 Ga0070707_100002790 3300005468 Bacteria 16625
75 Ga0070707_100010939 3300005468 Bacteria 8451
76 Ga0070707_100010940 3300005468 Bacteria 8450
77 Ga0070707_100042696 3300005468 Unclassified 4342
78 Ga0070707_100174298 3300005468 Bacteria 2096
79 Ga0070698_100023164 3300005471 Bacteria 6492
80 Ga0070698_100338011 3300005471 Bacteria 1437
81 Ga0070699_100001511 3300005518 Bacteria 21274
82 Ga0070679_100002600 3300005530 Bacteria 16416
83 Ga0070679_100014018 3300005530 Bacteria 7685
84 Ga0070679_100065262 3300005530 Unclassified 3628
85 Ga0070684_100105022 3300005535 Bacteria 2527
86 Ga0070684_100154973 3300005535 Unclassified 2077
87 Ga0070697_100010672 3300005536 Bacteria 7169
88 Ga0070697_100189274 3300005536 Bacteria 1746
89 Ga0068853_100002992 3300005539 Bacteria 12892
90 Ga0068853_100131422 3300005539 Unclassified 2241
91 Ga0068853_100371110 3300005539 Bacteria 1335
92 Ga0070672_100000235 3300005543 Bacteria 30880
93 Ga0070686_100102690 3300005544 Bacteria 1934
94 Ga0070695_100014248 3300005545 Bacteria 4791
95 Ga0070695_100044279 3300005545 Bacteria 2833
96 Ga0070693_100040388 3300005547 Unclassified 2619
97 Ga0070693_100068938 3300005547 Bacteria 2077
98 Ga0070665_100000805 3300005548 Bacteria 41003
99 Ga0070704_100001584 3300005549 Bacteria 12287
100 Ga0070704_100030017 3300005549 Unclassified 3638
101 Ga0068855_100040141 3300005563 Bacteria 5556
102 Ga0068855_100087782 3300005563 Bacteria 3593
103 Ga0070664_100001677 3300005564 Bacteria 17745
104 Ga0068857_100016059 3300005577 Bacteria 6560
105 Ga0068857_100313536 3300005577 Bacteria 1447
106 Ga0068854_100092422 3300005578 Bacteria 2254
107 Ga0068854_100102865 3300005578 Bacteria 2144
108 Ga0068856_100218655 3300005614 Bacteria 1920
109 Ga0068852_100162177 3300005616 Bacteria 2088
110 Ga0068859_100030004 3300005617 Bacteria 5455
111 Ga0068859_100037472 3300005617 Unclassified 4866
112 Ga0068859_100050028 3300005617 Bacteria 4198
113 Ga0068859_100181535 3300005617 Bacteria 2187
114 Ga0068859_100285157 3300005617 Bacteria 1744
115 Ga0068859_100438042 3300005617 Bacteria 1403
116 Ga0068864_100004594 3300005618 Bacteria 11326
117 Ga0068864_100029688 3300005618 Bacteria 4633
118 Ga0068864_100127184 3300005618 Bacteria 2285
119 Ga0068866_10006481 3300005718 Unclassified 4877
120 Ga0068861_100005133 3300005719 Bacteria 8827
121 Ga0068861_100015362 3300005719 Bacteria 5394
122 Ga0068861_100047625 3300005719 Bacteria 3237
123 Ga0068861_100099177 3300005719 Unclassified 2313
124 Ga0068851_10014057 3300005834 Unclassified 3795
125 Ga0068851_10016502 3300005834 Bacteria 3534
126 Ga0068863_100000854 3300005841 Bacteria 30394
127 Ga0068863_100017361 3300005841 Bacteria 6899
128 Ga0068863_100052618 3300005841 Unclassified 3859
129 Ga0068863_100115656 3300005841 Bacteria 2556
130 Ga0068858_100000055 3300005842 Bacteria 118619
131 Ga0068858_100000889 3300005842 Bacteria 31013
132 Ga0068858_100051992 3300005842 Bacteria 3791
133 Ga0068858_100055545 3300005842 Bacteria 3661
134 Ga0068860_100002327 3300005843 Bacteria 19952
135 Ga0068860_100011603 3300005843 Bacteria 8690
136 Ga0068860_100021040 3300005843 Bacteria 6320
137 Ga0068860_100072911 3300005843 Bacteria 3264
138 Ga0068860_100077596 3300005843 Bacteria 3159
139 Ga0068860_100132014 3300005843 Bacteria 2397
140 Ga0068860_100183019 3300005843 Unclassified 2025
141 Ga0068860_100197513 3300005843 Unclassified 1949
142 Ga0068860_100200715 3300005843 Unclassified 1932
143 Ga0068862_100037089 3300005844 Bacteria 4131
144 Ga0068862_100094831 3300005844 Bacteria 2603
145 Ga0081539_10000476 3300005985 Bacteria 84955
146 Ga0081539_10001446 3300005985 Bacteria 40634
147 Ga0081539_10004173 3300005985 Bacteria 16388
148 Ga0081539_10011509 3300005985 Bacteria 6982
149 Ga0070715_10000035 3300006163 Bacteria 78855
150 Ga0070716_100000011 3300006173 Bacteria 143884
151 Ga0097621_100017958 3300006237 Bacteria 5389
152 Ga0097621_100020349 3300006237 Bacteria 5112
153 Ga0097621_100057101 3300006237 Bacteria 3191
154 Ga0097621_100058408 3300006237 Unclassified 3156
155 Ga0097621_100181124 3300006237 Bacteria 1821
156 Ga0068871_100012958 3300006358 Bacteria 6174
157 Ga0068871_100028102 3300006358 Bacteria 4406
158 Ga0068871_100042696 3300006358 Bacteria 3641
159 Ga0075428_100144328 3300006844 Bacteria 2587
160 Ga0075430_100199906 3300006846 Unclassified 1660
161 Ga0075433_10009642 3300006852 Bacteria 7727
162 Ga0075433_10011225 3300006852 Bacteria 7210
163 Ga0075433_10071139 3300006852 Bacteria 3058
164 Ga0075433_10082518 3300006852 Unclassified 2835
165 Ga0075434_100033635 3300006871 Bacteria 5062
166 Ga0075434_100169411 3300006871 Unclassified 2204
167 Ga0075429_100070692 3300006880 Bacteria 3039
168 Ga0075429_100159530 3300006880 Bacteria 1975
169 Ga0068865_100012759 3300006881 Bacteria 5297
170 Ga0075436_100000040 3300006914 Bacteria 81162
171 Ga0097620_100030005 3300006931 Bacteria 5455
172 Ga0097620_100037472 3300006931 Unclassified 4866
173 Ga0097620_100043642 3300006931 Bacteria 4507
174 Ga0097620_100050028 3300006931 Bacteria 4198
175 Ga0097620_100181523 3300006931 Bacteria 2187
176 Ga0097620_100285147 3300006931 Bacteria 1744
177 Ga0097620_100438095 3300006931 Bacteria 1403
178 Ga0075435_100001431 3300007076 Bacteria 15356
179 Ga0105240_10001298 3300009093 Bacteria 43175
180 Ga0105240_10003717 3300009093 Bacteria 23572
181 Ga0105240_10024542 3300009093 Bacteria 7945
182 Ga0105240_10051760 3300009093 Bacteria 5166
183 Ga0105240_10084217 3300009093 Bacteria 3899
184 Ga0111539_10000227 3300009094 Bacteria 67567
185 Ga0111539_10007271 3300009094 Bacteria 14177
186 Ga0111539_10371708 3300009094 Bacteria 1664
187 Ga0105245_10022460 3300009098 Bacteria 5538
188 Ga0105245_10089511 3300009098 Unclassified 2830
189 Ga0105247_10000001 3300009101 Bacteria 739726
190 Ga0105247_10002410 3300009101 Bacteria 12715
191 Ga0105247_10026866 3300009101 Bacteria 3479
192 Ga0114129_10000353 3300009147 Bacteria 53286
193 Ga0114129_10004840 3300009147 Bacteria 19014
194 Ga0114129_10006354 3300009147 Bacteria 16753
195 Ga0114129_10017737 3300009147 Bacteria 10136
196 Ga0114129_10036140 3300009147 Bacteria 6976
197 Ga0114129_10046357 3300009147 Bacteria 6109
198 Ga0114129_10235876 3300009147 Bacteria 2461
199 Ga0105243_10025346 3300009148 Unclassified 4530
200 Ga0105243_10066879 3300009148 Bacteria 2892
201 Ga0105243_10067641 3300009148 Archaea 2877
202 Ga0105243_10145628 3300009148 Bacteria 2026
203 Ga0105241_10042584 3300009174 Bacteria 3436
204 Ga0105241_10144226 3300009174 Bacteria 1942
205 Ga0105241_10248091 3300009174 Bacteria 1508
206 Ga0105242_10013156 3300009176 Bacteria 6386
207 Ga0105242_10021434 3300009176 Bacteria 5075
208 Ga0105248_10016561 3300009177 Bacteria 8117
209 Ga0105248_10097227 3300009177 Unclassified 3317
210 Ga0105248_10164675 3300009177 Bacteria 2500
211 Ga0105248_10387614 3300009177 Bacteria 1573
212 Ga0105237_10002034 3300009545 Bacteria 25707
213 Ga0105237_10009952 3300009545 Bacteria 10145
214 Ga0105237_10112061 3300009545 Bacteria 2720
215 Ga0105238_10010728 3300009551 Bacteria 9201
216 Ga0105238_10035945 3300009551 Bacteria 5036
217 Ga0105238_10050745 3300009551 Bacteria 4175
218 Ga0105249_10000381 3300009553 Bacteria 44082
219 Ga0105249_10056754 3300009553 Bacteria 3585
220 Ga0105239_10074825 3300010375 Bacteria 3724
221 Ga0105239_10086882 3300010375 Unclassified 3447
222 Ga0105239_10465747 3300010375 Bacteria 1435
223 Ga0105246_10012340 3300011119 Bacteria 5328
224 Ga0157373_10005784 3300013100 Bacteria 9263
225 Ga0157373_10016983 3300013100 Bacteria 5301
226 Ga0157371_10228900 3300013102 Bacteria 1336
227 Ga0157370_10248568 3300013104 Bacteria 1645
228 Ga0157374_10000311 3300013296 Bacteria 45181
229 Ga0157378_10000015 3300013297 Bacteria 143601
230 Ga0157378_10003455 3300013297 Bacteria 14018
231 Ga0157378_10032406 3300013297 Unclassified 4618
232 Ga0157378_10094435 3300013297 Unclassified 2723
233 Ga0157378_10197806 3300013297 Bacteria 1899
234 Ga0157378_10202124 3300013297 Bacteria 1880
235 Ga0157378_10231096 3300013297 Unclassified 1762
236 Ga0157378_10242348 3300013297 Bacteria 1723
237 Ga0163162_10000023 3300013306 Bacteria 193395
238 Ga0163162_10000542 3300013306 Bacteria 34914
239 Ga0163162_10003809 3300013306 Bacteria 14465
240 Ga0163162_10039126 3300013306 Bacteria 4737
241 Ga0163162_10043713 3300013306 Unclassified 4486
242 Ga0157375_10000748 3300013308 Bacteria 28547
243 Ga0157375_10005898 3300013308 Bacteria 10674
244 Ga0157375_10018129 3300013308 Bacteria 6379
245 Ga0157375_10018618 3300013308 Bacteria 6301
246 Ga0157375_10070757 3300013308 Bacteria 3500
247 Ga0157375_10131120 3300013308 Bacteria 2626
248 Ga0163163_10000369 3300014325 Bacteria 43150
249 Ga0163163_10000674 3300014325 Bacteria 29178
250 Ga0163163_10001143 3300014325 Bacteria 22584
251 Ga0163163_10002341 3300014325 Bacteria 16030
252 Ga0163163_10004240 3300014325 Bacteria 12219
253 Ga0163163_10033362 3300014325 Bacteria 4979
254 Ga0157380_10000565 3300014326 Bacteria 22763
255 Ga0157380_10007254 3300014326 Bacteria 7863
256 Ga0157380_10141184 3300014326 Bacteria 2070
257 Ga0157380_10206644 3300014326 Bacteria 1746
258 Ga0157379_10002034 3300014968 Bacteria 16785
259 Ga0157379_10081709 3300014968 Bacteria 2895
260 Ga0157379_10146609 3300014968 Bacteria 2128
261 Ga0157376_10000636 3300014969 Bacteria 22723
262 Ga0163161_10006114 3300017792 Bacteria 8343
263 Ga0163161_10012789 3300017792 Bacteria 5830
264 Ga0163161_10078088 3300017792 Unclassified 2433
265 Ga0206352_11178820 3300020078 Bacteria 1532
266 Ga0213876_10000159 3300021384 Bacteria 70556
267 Ga0213876_10009208 3300021384 Bacteria 5318
268 Ga0213876_10017670 3300021384 Bacteria 3763
269 Ga0213875_10021016 3300021388 Bacteria 3130
270 Ga0228598_1012282 3300024227 Bacteria 1702
271 Ga0207672_1000167 3300025223 Bacteria 9023
272 Ga0207656_10008376 3300025321 Unclassified 3804
273 Ga0207656_10010497 3300025321 Bacteria 3472
274 Ga0207642_10051152 3300025899 Bacteria 1868
275 Ga0207642_10111789 3300025899 Bacteria 1392
276 Ga0207710_10000003 3300025900 Bacteria 1071597
277 Ga0207710_10000653 3300025900 Bacteria 19615
278 Ga0207710_10018464 3300025900 Bacteria 2966
279 Ga0207680_10001370 3300025903 Bacteria 11548
280 Ga0207647_10005632 3300025904 Bacteria 9147
281 Ga0207647_10043959 3300025904 Unclassified 2793
282 Ga0207685_10000019 3300025905 Bacteria 145568
283 Ga0207645_10004495 3300025907 Bacteria 10315
284 Ga0207705_10011530 3300025909 Bacteria 6394
285 Ga0207684_10030709 3300025910 Bacteria 4573
286 Ga0207684_10060514 3300025910 Bacteria 3216
287 Ga0207684_10128758 3300025910 Bacteria 2173
288 Ga0207707_10000080 3300025912 Bacteria 96693
289 Ga0207707_10000299 3300025912 Bacteria 52083
290 Ga0207707_10014827 3300025912 Bacteria 6788
291 Ga0207695_10011537 3300025913 Bacteria 10692
292 Ga0207695_10143709 3300025913 Bacteria 2332
293 Ga0207695_10166588 3300025913 Unclassified 2131
294 Ga0207695_10366201 3300025913 Bacteria 1328
295 Ga0207671_10013835 3300025914 Bacteria 6408
296 Ga0207660_10012574 3300025917 Bacteria 5543
297 Ga0207660_10022900 3300025917 Unclassified 4212
298 Ga0207660_10100312 3300025917 Bacteria 2162
299 Ga0207660_10146526 3300025917 Bacteria 1810
300 Ga0207662_10089520 3300025918 Unclassified 1891
301 Ga0207657_10149300 3300025919 Bacteria 1905
302 Ga0207652_10000234 3300025921 Bacteria 58103
303 Ga0207652_10001259 3300025921 Bacteria 22539
304 Ga0207652_10019934 3300025921 Bacteria 5522
305 Ga0207646_10001340 3300025922 Bacteria 30583
306 Ga0207646_10003588 3300025922 Bacteria 17390
307 Ga0207646_10013974 3300025922 Bacteria 7645
308 Ga0207681_10161122 3300025923 Archaea 1691
309 Ga0207694_10005310 3300025924 Bacteria 9925
310 Ga0207694_10077703 3300025924 Bacteria 2601
311 Ga0207650_10000041 3300025925 Bacteria 197115
312 Ga0207659_10244683 3300025926 Bacteria 1453
313 Ga0207687_10023223 3300025927 Bacteria 4132
314 Ga0207687_10168995 3300025927 Bacteria 1685
315 Ga0207644_10001427 3300025931 Bacteria 15394
316 Ga0207690_10005003 3300025932 Bacteria 7829
317 Ga0207706_10011576 3300025933 Bacteria 8032
318 Ga0207706_10060266 3300025933 Bacteria 3342
319 Ga0207686_10000753 3300025934 Bacteria 19965
320 Ga0207686_10024399 3300025934 Archaea 3504
321 Ga0207709_10005324 3300025935 Bacteria 7315
322 Ga0207709_10006609 3300025935 Bacteria 6507
323 Ga0207709_10016069 3300025935 Unclassified 4155
324 Ga0207670_10000595 3300025936 Bacteria 19771
325 Ga0207704_10004498 3300025938 Bacteria 6374
326 Ga0207665_10000057 3300025939 Bacteria 73138
327 Ga0207665_10014640 3300025939 Bacteria 5163
328 Ga0207691_10000076 3300025940 Bacteria 83005
329 Ga0207691_10103052 3300025940 Bacteria 2545
330 Ga0207711_10009307 3300025941 Bacteria 8200
331 Ga0207711_10017875 3300025941 Bacteria 5891
332 Ga0207689_10002378 3300025942 Bacteria 17562
333 Ga0207689_10028511 3300025942 Bacteria 4671
334 Ga0207689_10068827 3300025942 Unclassified 2909
335 Ga0207661_10062729 3300025944 Bacteria 3008
336 Ga0207679_10010507 3300025945 Bacteria 5964
337 Ga0207679_10243731 3300025945 Bacteria 1524
338 Ga0207667_10032809 3300025949 Bacteria 5590
339 Ga0207667_10502447 3300025949 Bacteria 1230
340 Ga0207651_10177888 3300025960 Bacteria 1684
341 Ga0207712_10000214 3300025961 Bacteria 57860
342 Ga0207668_10000318 3300025972 Bacteria 31353
343 Ga0207668_10003584 3300025972 Bacteria 9124
344 Ga0207640_10084935 3300025981 Bacteria 2175
345 Ga0207658_10000312 3300025986 Bacteria 49332
346 Ga0207658_10028943 3300025986 Unclassified 3906
347 Ga0207677_10001545 3300026023 Bacteria 12177
348 Ga0207703_10000118 3300026035 Bacteria 95317
349 Ga0207703_10001961 3300026035 Bacteria 18184
350 Ga0207703_10011527 3300026035 Bacteria 6877
351 Ga0207703_10029950 3300026035 Bacteria 4297
352 Ga0207639_10001444 3300026041 Bacteria 15995
353 Ga0207678_10123936 3300026067 Bacteria 2205
354 Ga0207708_10000188 3300026075 Bacteria 48769
355 Ga0207708_10006777 3300026075 Bacteria 8476
356 Ga0207708_10046265 3300026075 Unclassified 3314
357 Ga0207708_10084924 3300026075 Bacteria 2435
358 Ga0207702_10235980 3300026078 Bacteria 1711
359 Ga0207641_10081473 3300026088 Unclassified 2810
360 Ga0207641_10092161 3300026088 Bacteria 2654
361 Ga0207648_10004784 3300026089 Bacteria 13830
362 Ga0207648_10047132 3300026089 Unclassified 3778
363 Ga0207676_10025498 3300026095 Bacteria 4386
364 Ga0207676_10059269 3300026095 Bacteria 3022
365 Ga0207676_10191337 3300026095 Bacteria 1800
366 Ga0207674_10000212 3300026116 Bacteria 71941
367 Ga0207674_10075915 3300026116 Unclassified 3370
368 Ga0207675_100003349 3300026118 Bacteria 15674
369 Ga0207675_100011828 3300026118 Bacteria 8159
370 Ga0207675_100054082 3300026118 Bacteria 3745
371 Ga0207675_100255550 3300026118 Bacteria 1697
372 Ga0207698_10179857 3300026142 Bacteria 1872
373 Ga0207428_10009215 3300027907 Bacteria 8868
374 Ga0207428_10063155 3300027907 Bacteria 2926
375 Ga0268266_10134973 3300028379 Bacteria 2209
376 Ga0268265_10052399 3300028380 Bacteria 3086
377 Ga0268265_10127115 3300028380 Bacteria 2111
378 Ga0268264_10003951 3300028381 Bacteria 12698
379 Ga0268264_10078606 3300028381 Bacteria 2813
380 Ga0268264_10124803 3300028381 Unclassified 2274
381 Ga0268264_10175641 3300028381 Bacteria 1941
382 Ga0268264_10175856 3300028381 Bacteria 1940
383 Ga0265338_10024074 3300028800 Bacteria 6232
384 Ga0265338_10032794 3300028800 Bacteria 5056
385 Ga0307513_10000792 3300031456 Bacteria 45967
386 Ga0307408_100043533 3300031548 Unclassified 3195
387 Ga0316576_10001128 3300031727 Bacteria 14001
388 Ga0307405_10036125 3300031731 Unclassified 2958
389 Ga0307405_10089413 3300031731 Unclassified 2034
390 Ga0307406_10001711 3300031901 Bacteria 12061
391 Ga0307407_10025764 3300031903 Bacteria 3105
392 Ga0307412_10026939 3300031911 Bacteria 3579
393 Ga0307412_10160888 3300031911 Bacteria 1668
394 Ga0307416_100117180 3300032002 Unclassified 2363
395 Ga0307415_100019571 3300032126 Bacteria 4113
396 Ga0373940_0043924 3300035088 Bacteria 1237
397 Ga0373951_0002644 3300035091 Bacteria 4496
398 Ga0316574_0071674 3300035398 Bacteria 2189
399 Ga0436364_1074929 3300037853 Bacteria 14867
400 Ga0395901_0111212 3300038443 Bacteria 2877
401 Ga0242420_002390 3300038996 Bacteria 2675
402 Ga0436365_0915988 3300039437 Bacteria 51495
403 Ga0436365_1218124 3300039437 Bacteria 5496
404 Ga0466957_0133032 3300044842 Unclassified 1596
405 Ga0451576_0057253 3300045051 Bacteria 4074
406 Ga0495634_0155911 3300046642 Unclassified 1442
407 Ga0495600_0147599 3300046809 Bacteria 1524
408 Ga0496106_0104304 3300048909 Bacteria 2202
409 Ga0496109_0020638 3300048912 Bacteria 5821
410 Ga0501292_001201 3300049515 Unclassified 3189
411 Ga0501033_0131303 3300049570 Bacteria 1814
412 Ga0501034_0028490 3300049571 Bacteria 5684
413 Ga0501034_0192156 3300049571 Unclassified 2003
414 Ga0501038_0001415 3300049574 Bacteria 21957
415 Ga0501040_0222798 3300049576 Bacteria 1342
416 Ga0501041_0015602 3300049577 Bacteria 4512
417 Ga0501042_0019742 3300049578 Bacteria 4685
418 Ga0501043_0009476 3300049579 Bacteria 7637
419 Ga0501046_0042803 3300049580 Bacteria 3610
420 Ga0501046_0129638 3300049580 Bacteria 1913
421 Ga0501047_0007719 3300049581 Bacteria 10130
422 Ga0501047_0068916 3300049581 Bacteria 3407
423 Ga0501047_0214027 3300049581 Bacteria 1785
424 Ga0501048_0140482 3300049582 Bacteria 1708
425 Ga0501070_0003237 3300049586 Bacteria 14159
426 Ga0501070_0299742 3300049586 Bacteria 1309
427 Ga0501075_0111891 3300049591 Bacteria 2076
428 Ga0501076_0076323 3300049592 Bacteria 2687
429 Ga0501202_009596 3300049652 Bacteria 1783
430 Ga0501217_002013 3300049661 Bacteria 3927
431 Ga0501227_011871 3300049665 Bacteria 1903
432 Ga0501235_012272 3300049669 Unclassified 1883
433 Ga0501235_022105 3300049669 Bacteria 1414
434 Ga0501239_007328 3300049672 Bacteria 1153
435 Ga0501225_0008384 3300049705 Bacteria 2966
436 Ga0501079_0138972 3300049741 Bacteria 1892
437 Ga0501080_0085636 3300049742 Bacteria 2928
438 Ga0501081_0011092 3300049743 Bacteria 5893
439 Ga0501083_0079830 3300049744 Bacteria 2169
440 Ga0501283_000670 3300049779 Bacteria 4523
441 Ga0501044_0032608 3300049823 Bacteria 5475
442 Ga0501044_0184341 3300049823 Bacteria 2053
443 Ga0501045_0021655 3300049824 Bacteria 4601
444 nmdc:mga05p37_142933_c1 3300050507 Bacteria 2931
445 nmdc:mga05p37_226992_c1 3300050507 Bacteria 2251
446 nmdc:mga05p37_53536_c1 3300050507 Bacteria 4963
447 nmdc:mga09592_31392_c1 3300050508 Bacteria 4426
448 nmdc:mga08y16_267263_c1 3300050511 Unclassified 1766
449 nmdc:mga08y16_6445_c1 3300050511 Bacteria 12307
450 nmdc:mga08y16_94460_c1 3300050511 Bacteria 3115
451 nmdc:mga0n895_126943_c1 3300050512 Bacteria 2575
452 nmdc:mga0n895_154716_c1 3300050512 Bacteria 2323
453 nmdc:mga0rr50_690_c2 3300050513 Bacteria 16407
454 nmdc:mga08x19_850_c1 3300050514 Bacteria 18151
455 nmdc:mga08x19_8_c1 3300050514 Bacteria 427794
456 nmdc:mga0a205_78289_c1 3300050515 Unclassified 3194
457 Ga0500616_0001097 3300053153 Bacteria 28109
458 Ga0500637_0040997 3300053178 Unclassified 2617
459 Ga0501084_0093301 3300054114 Bacteria 2527
460 Ga0075436_100001628
461 CNAas_1000011
462 JGI24748J21848_1000008
463 JGI24034J26672_10000002
464 JGI24751J29686_10000137
465 rootH1_10034215
466 rootH1_10153182
467 Ga0065704_10072426
468 Ga0065712_10000127
469 Ga0065712_10018890
470 Ga0065715_10018897
471 Ga0065715_10090628
472 Ga0065707_10002546
473 Ga0070658_10047974
474 Ga0070676_10000064
475 Ga0070676_10127554
476 Ga0070690_100095677
477 Ga0070690_100214529
478 Ga0070670_100004087
479 Ga0070670_100005843
480 Ga0068869_100101473
481 Ga0068869_100156091
482 Ga0070666_10000558
483 Ga0070680_100000719
484 Ga0070680_100015070
485 Ga0070680_100020943
486 Ga0070680_100025770
487 Ga0070680_100156780
488 Ga0070682_100000714
489 Ga0070682_100006506
490 Ga0070682_100035230
491 Ga0068868_100003442
492 Ga0068868_100024403
493 Ga0068868_100046943
494 Ga0070660_100010393
495 Ga0070689_100001418
496 Ga0070691_10008429
497 Ga0070687_100063627
498 Ga0070661_100004333
499 Ga0070692_10030458
500 Ga0070692_10048610
501 Ga0070668_100000222
502 Ga0070668_100002758
503 Ga0070669_100030004
504 Ga0070669_100175067
505 Ga0070675_100020159
506 Ga0070671_100114639
507 Ga0070673_100072083
508 Ga0070673_100097013
509 Ga0070673_100211204
510 Ga0070659_100002545
511 Ga0070667_100000240
512 Ga0070703_10006697
513 Ga0070705_100042145
514 Ga0070705_100191628
515 Ga0070700_100000155
516 Ga0070700_100023873
517 Ga0070700_100034934
518 Ga0070700_100066641
519 Ga0070694_100003337
520 Ga0070694_100016541
521 Ga0070694_100078337
522 Ga0070708_100000123
523 Ga0070678_100060727
524 Ga0070662_100066278
525 Ga0070681_10001930
526 Ga0070681_10002427
527 Ga0070681_10309025
528 Ga0068867_100006068
529 Ga0068867_100154097
530 Ga0070706_100008396
531 Ga0070706_100054354
532 Ga0070706_100109769
533 Ga0070707_100002790
534 Ga0070707_100010939
535 Ga0070707_100010940
536 Ga0070707_100042696
537 Ga0070707_100174298
538 Ga0070698_100023164
539 Ga0070698_100338011
540 Ga0070699_100001511
541 Ga0070679_100002600
542 Ga0070679_100014018
543 Ga0070679_100065262
544 Ga0070684_100105022
545 Ga0070684_100154973
546 Ga0070697_100010672
547 Ga0070697_100189274
548 Ga0068853_100002992
549 Ga0068853_100131422
550 Ga0068853_100371110
551 Ga0070672_100000235
552 Ga0070686_100102690
553 Ga0070695_100014248
554 Ga0070695_100044279
555 Ga0070693_100040388
556 Ga0070693_100068938
557 Ga0070665_100000805
558 Ga0070704_100001584
559 Ga0070704_100030017
560 Ga0068855_100040141
561 Ga0068855_100087782
562 Ga0070664_100001677
563 Ga0068857_100016059
564 Ga0068857_100313536
565 Ga0068854_100092422
566 Ga0068854_100102865
567 Ga0068856_100218655
568 Ga0068852_100162177
569 Ga0068859_100030004
570 Ga0068859_100037472
571 Ga0068859_100050028
572 Ga0068859_100181535
573 Ga0068859_100285157
574 Ga0068859_100438042
575 Ga0068864_100004594
576 Ga0068864_100029688
577 Ga0068864_100127184
578 Ga0068866_10006481
579 Ga0068861_100005133
580 Ga0068861_100015362
581 Ga0068861_100047625
582 Ga0068861_100099177
583 Ga0068851_10014057
584 Ga0068851_10016502
585 Ga0068863_100000854
586 Ga0068863_100017361
587 Ga0068863_100052618
588 Ga0068863_100115656
589 Ga0068858_100000055
590 Ga0068858_100000889
591 Ga0068858_100051992
592 Ga0068858_100055545
593 Ga0068860_100002327
594 Ga0068860_100011603
595 Ga0068860_100021040
596 Ga0068860_100072911
597 Ga0068860_100077596
598 Ga0068860_100132014
599 Ga0068860_100183019
600 Ga0068860_100197513
601 Ga0068860_100200715
602 Ga0068862_100037089
603 Ga0068862_100094831
604 Ga0081539_10000476
605 Ga0081539_10001446
606 Ga0081539_10004173
607 Ga0081539_10011509
608 Ga0070715_10000035
609 Ga0070716_100000011
610 Ga0097621_100017958
611 Ga0097621_100020349
612 Ga0097621_100057101
613 Ga0097621_100058408
614 Ga0097621_100181124
615 Ga0068871_100012958
616 Ga0068871_100028102
617 Ga0068871_100042696
618 Ga0075428_100144328
619 Ga0075430_100199906
620 Ga0075433_10009642
621 Ga0075433_10011225
622 Ga0075433_10071139
623 Ga0075433_10082518
624 Ga0075434_100033635
625 Ga0075434_100169411
626 Ga0075429_100070692
627 Ga0075429_100159530
628 Ga0068865_100012759
629 Ga0075436_100000040
630 Ga0097620_100030005
631 Ga0097620_100037472
632 Ga0097620_100043642
633 Ga0097620_100050028
634 Ga0097620_100181523
635 Ga0097620_100285147
636 Ga0097620_100438095
637 Ga0075435_100001431
638 Ga0105240_10001298
639 Ga0105240_10003717
640 Ga0105240_10024542
641 Ga0105240_10051760
642 Ga0105240_10084217
643 Ga0111539_10000227
644 Ga0111539_10007271
645 Ga0111539_10371708
646 Ga0105245_10022460
647 Ga0105245_10089511
648 Ga0105247_10000001
649 Ga0105247_10002410
650 Ga0105247_10026866
651 Ga0114129_10000353
652 Ga0114129_10004840
653 Ga0114129_10006354
654 Ga0114129_10017737
655 Ga0114129_10036140
656 Ga0114129_10046357
657 Ga0114129_10235876
658 Ga0105243_10025346
659 Ga0105243_10066879
660 Ga0105243_10067641
661 Ga0105243_10145628
662 Ga0105241_10042584
663 Ga0105241_10144226
664 Ga0105241_10248091
665 Ga0105242_10013156
666 Ga0105242_10021434
667 Ga0105248_10016561
668 Ga0105248_10097227
669 Ga0105248_10164675
670 Ga0105248_10387614
671 Ga0105237_10002034
672 Ga0105237_10009952
673 Ga0105237_10112061
674 Ga0105238_10010728
675 Ga0105238_10035945
676 Ga0105238_10050745
677 Ga0105249_10000381
678 Ga0105249_10056754
679 Ga0105239_10074825
680 Ga0105239_10086882
681 Ga0105239_10465747
682 Ga0105246_10012340
683 Ga0157373_10005784
684 Ga0157373_10016983
685 Ga0157371_10228900
686 Ga0157370_10248568
687 Ga0157374_10000311
688 Ga0157378_10000015
689 Ga0157378_10003455
690 Ga0157378_10032406
691 Ga0157378_10094435
692 Ga0157378_10197806
693 Ga0157378_10202124
694 Ga0157378_10231096
695 Ga0157378_10242348
696 Ga0163162_10000023
697 Ga0163162_10000542
698 Ga0163162_10003809
699 Ga0163162_10039126
700 Ga0163162_10043713
701 Ga0157375_10000748
702 Ga0157375_10005898
703 Ga0157375_10018129
704 Ga0157375_10018618
705 Ga0157375_10070757
706 Ga0157375_10131120
707 Ga0163163_10000369
708 Ga0163163_10000674
709 Ga0163163_10001143
710 Ga0163163_10002341
711 Ga0163163_10004240
712 Ga0163163_10033362
713 Ga0157380_10000565
714 Ga0157380_10007254
715 Ga0157380_10141184
716 Ga0157380_10206644
717 Ga0157379_10002034
718 Ga0157379_10081709
719 Ga0157379_10146609
720 Ga0157376_10000636
721 Ga0163161_10006114
722 Ga0163161_10012789
723 Ga0163161_10078088
724 Ga0206352_11178820
725 Ga0213876_10000159
726 Ga0213876_10009208
727 Ga0213876_10017670
728 Ga0213875_10021016
729 Ga0228598_1012282
730 Ga0207672_1000167
731 Ga0207656_10008376
732 Ga0207656_10010497
733 Ga0207642_10051152
734 Ga0207642_10111789
735 Ga0207710_10000003
736 Ga0207710_10000653
737 Ga0207710_10018464
738 Ga0207680_10001370
739 Ga0207647_10005632
740 Ga0207647_10043959
741 Ga0207685_10000019
742 Ga0207645_10004495
743 Ga0207705_10011530
744 Ga0207684_10030709
745 Ga0207684_10060514
746 Ga0207684_10128758
747 Ga0207707_10000080
748 Ga0207707_10000299
749 Ga0207707_10014827
750 Ga0207695_10011537
751 Ga0207695_10143709
752 Ga0207695_10166588
753 Ga0207695_10366201
754 Ga0207671_10013835
755 Ga0207660_10012574
756 Ga0207660_10022900
757 Ga0207660_10100312
758 Ga0207660_10146526
759 Ga0207662_10089520
760 Ga0207657_10149300
761 Ga0207652_10000234
762 Ga0207652_10001259
763 Ga0207652_10019934
764 Ga0207646_10001340
765 Ga0207646_10003588
766 Ga0207646_10013974
767 Ga0207681_10161122
768 Ga0207694_10005310
769 Ga0207694_10077703
770 Ga0207650_10000041
771 Ga0207659_10244683
772 Ga0207687_10023223
773 Ga0207687_10168995
774 Ga0207644_10001427
775 Ga0207690_10005003
776 Ga0207706_10011576
777 Ga0207706_10060266
778 Ga0207686_10000753
779 Ga0207686_10024399
780 Ga0207709_10005324
781 Ga0207709_10006609
782 Ga0207709_10016069
783 Ga0207670_10000595
784 Ga0207704_10004498
785 Ga0207665_10000057
786 Ga0207665_10014640
787 Ga0207691_10000076
788 Ga0207691_10103052
789 Ga0207711_10009307
790 Ga0207711_10017875
791 Ga0207689_10002378
792 Ga0207689_10028511
793 Ga0207689_10068827
794 Ga0207661_10062729
795 Ga0207679_10010507
796 Ga0207679_10243731
797 Ga0207667_10032809
798 Ga0207667_10502447
799 Ga0207651_10177888
800 Ga0207712_10000214
801 Ga0207668_10000318
802 Ga0207668_10003584
803 Ga0207640_10084935
804 Ga0207658_10000312
805 Ga0207658_10028943
806 Ga0207677_10001545
807 Ga0207703_10000118
808 Ga0207703_10001961
809 Ga0207703_10011527
810 Ga0207703_10029950
811 Ga0207639_10001444
812 Ga0207678_10123936
813 Ga0207708_10000188
814 Ga0207708_10006777
815 Ga0207708_10046265
816 Ga0207708_10084924
817 Ga0207702_10235980
818 Ga0207641_10081473
819 Ga0207641_10092161
820 Ga0207648_10004784
821 Ga0207648_10047132
822 Ga0207676_10025498
823 Ga0207676_10059269
824 Ga0207676_10191337
825 Ga0207674_10000212
826 Ga0207674_10075915
827 Ga0207675_100003349
828 Ga0207675_100011828
829 Ga0207675_100054082
830 Ga0207675_100255550
831 Ga0207698_10179857
832 Ga0207428_10009215
833 Ga0207428_10063155
834 Ga0268266_10134973
835 Ga0268265_10052399
836 Ga0268265_10127115
837 Ga0268264_10003951
838 Ga0268264_10078606
839 Ga0268264_10124803
840 Ga0268264_10175641
841 Ga0268264_10175856
842 Ga0265338_10024074
843 Ga0265338_10032794
844 Ga0307513_10000792
845 Ga0307408_100043533
846 Ga0316576_10001128
847 Ga0307405_10036125
848 Ga0307405_10089413
849 Ga0307406_10001711
850 Ga0307407_10025764
851 Ga0307412_10026939
852 Ga0307412_10160888
853 Ga0307416_100117180
854 Ga0307415_100019571
855 Ga0373940_0043924
856 Ga0373951_0002644
857 Ga0316574_0071674
858 Ga0436364_1074929
859 Ga0395901_0111212
860 Ga0242420_002390
861 Ga0436365_0915988
862 Ga0436365_1218124
863 Ga0466957_0133032
864 Ga0451576_0057253
865 Ga0495634_0155911
866 Ga0495600_0147599
867 Ga0496106_0104304
868 Ga0496109_0020638
869 Ga0501292_001201
870 Ga0501033_0131303
871 Ga0501034_0028490
872 Ga0501034_0192156
873 Ga0501038_0001415
874 Ga0501040_0222798
875 Ga0501041_0015602
876 Ga0501042_0019742
877 Ga0501043_0009476
878 Ga0501046_0042803
879 Ga0501046_0129638
880 Ga0501047_0007719
881 Ga0501047_0068916
882 Ga0501047_0214027
883 Ga0501048_0140482
884 Ga0501070_0003237
885 Ga0501070_0299742
886 Ga0501075_0111891
887 Ga0501076_0076323
888 Ga0501202_009596
889 Ga0501217_002013
890 Ga0501227_011871
891 Ga0501235_012272
892 Ga0501235_022105
893 Ga0501239_007328
894 Ga0501225_0008384
895 Ga0501079_0138972
896 Ga0501080_0085636
897 Ga0501081_0011092
898 Ga0501083_0079830
899 Ga0501283_000670
900 Ga0501044_0032608
901 Ga0501044_0184341
902 Ga0501045_0021655
903 nmdc:mga05p37_142933_c1
904 nmdc:mga05p37_226992_c1
905 nmdc:mga05p37_53536_c1
906 nmdc:mga09592_31392_c1
907 nmdc:mga08y16_267263_c1
908 nmdc:mga08y16_6445_c1
909 nmdc:mga08y16_94460_c1
910 nmdc:mga0n895_126943_c1
911 nmdc:mga0n895_154716_c1
912 nmdc:mga0rr50_690_c2
913 nmdc:mga08x19_850_c1
914 nmdc:mga08x19_8_c1
915 nmdc:mga0a205_78289_c1
916 Ga0500616_0001097
917 Ga0500637_0040997
918 Ga0501084_0093301

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00266

Aminotran_5

Aminotransferase class-V

67

435

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ecx-assembly1.cif.gz_A nifs-like protein 0.9741 4 383
1ecx-assembly1.cif.gz_B nifs-like protein 0.9725 4 383
1ecx-assembly1.cif.gz_A nifs-like protein 0.9715 4 383
1ecx-assembly1.cif.gz_B nifs-like protein 0.9699 4 383
7rtk-assembly1.cif.gz_A structure of the (niau)2 complex with n-terminal mutation of iscu2 y35d at 2.5 a resolution 0.9679 4 389
ID Description Score Start End Superfamily
af_Q2FXV4_2_370_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9676 6 376 3.40.640.10
3a9zA02 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain); 0.9639 17 59 1.10.260.50
4r5fA01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9617 265 378 3.90.1150.10
1eg5A02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9613 17 262 3.40.640.10
af_Q2FXV4_28_254_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.961 32 260 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A2V8LH43-F1-model_v4 cysteine desulfurase (EC 2.8.1.7) 0.9939 4 389 GO:0016226
GO:0031071
GO:0046872
GO:0051536
AF-A0A7V8Z7N6-F1-model_v4 Aminotransferase class V-fold PLP-dependent enzyme 0.9901 8 200 GO:0008483
GO:0016226
AF-A0A2V8RIM7-F1-model_v4 cysteine desulfurase (EC 2.8.1.7) 0.9886 4 388 GO:0016226
GO:0031071
GO:0046872
GO:0051536
AF-A0A846PCC9-F1-model_v4 cysteine desulfurase (EC 2.8.1.7) 0.9886 4 387 GO:0008483
GO:0016226
GO:0046872
GO:0051536
AF-A0A3M9ZPB6-F1-model_v4 Cysteine desulfurase 0.9884 6 390 GO:0016226
GO:0031071
GO:0046872
GO:0051536

Map