F448332

General Info

Members Datasets Scaffolds Average Seq Length
459 199 918 279

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10001062|Ga0081455_1000106222
Length 325
Sequence MRPPEALPTYEEGPPTGTELEPGPPPEVPRDPSRIAWTRRRASAGRIWRTYRKNTLGMIGLAVLILFALVAIFAPLLANKEGLKATCPCNGIPFSPPSLQYPLGTDNYGRSVLTLTIWGSRVSLTVGLLATAISMVIGSFIGIVAGYRGGVSESVLMRLTDWFLVIPFLPLAIVLASVLSPSLGVIIVVIGITSWPSTARIVRAQVLSVKTRPYVERSRALGASGWHLNTRHILPNVGPLIFANTILTVAVAILSESTLAFLGLGDPLSTSWGTILENAFGTGAAYAGQWXXXXPPGLAIVFVVLAFTLCGFALDEILNPKLRQR

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
96 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
97 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
98 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
99 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
100 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
101 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
102 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
103 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
105 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
106 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
115 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
116 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
117 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
118 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
119 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
120 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
121 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
122 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
123 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
124 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
125 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
126 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
127 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
128 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
129 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
130 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
131 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
132 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
133 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
134 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
135 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
136 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
137 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
138 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
139 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
140 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
141 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
145 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
146 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
147 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
148 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
153 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
168 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
171 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
172 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
173 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
174 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
175 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
176 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
177 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
180 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
184 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
187 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
188 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
192 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
193 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
195 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
196 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
197 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
198 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
199 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.44
Nodule 0
Rhizoplane 3.92
Rhizosphere 95.21
Stem 0
Stem Tuber 0
Unclassified 2.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10001062 3300005937 Bacteria 34599
2 JGI24751J29686_10000690 3300002459 Bacteria 8379
3 JGI25407J50210_10004064 3300003373 Bacteria 3553
4 Ga0070676_10206578 3300005328 Bacteria 1290
5 Ga0070683_100187911 3300005329 Bacteria 1961
6 Ga0070670_100014414 3300005331 Bacteria 6783
7 Ga0070670_100203727 3300005331 Bacteria 1719
8 Ga0068869_100030994 3300005334 Bacteria 3760
9 Ga0068868_100034145 3300005338 Bacteria 3926
10 Ga0070691_10021053 3300005341 Bacteria 3015
11 Ga0070661_100013100 3300005344 Bacteria 5818
12 Ga0070668_100083018 3300005347 Bacteria 2514
13 Ga0070674_100369203 3300005356 Bacteria 1164
14 Ga0070703_10036381 3300005406 Bacteria 1512
15 Ga0070711_100411259 3300005439 Bacteria 1100
16 Ga0070705_100072527 3300005440 Bacteria 2086
17 Ga0070700_100026481 3300005441 Bacteria 3425
18 Ga0070700_100027988 3300005441 Bacteria 3348
19 Ga0070694_100063987 3300005444 Bacteria 2517
20 Ga0070663_100005999 3300005455 Bacteria 7269
21 Ga0070706_100453681 3300005467 Bacteria 1193
22 Ga0070698_100398022 3300005471 Bacteria 1310
23 Ga0070699_100176258 3300005518 Unclassified 1896
24 Ga0070679_100067631 3300005530 Bacteria 3563
25 Ga0070684_100140233 3300005535 Bacteria 2186
26 Ga0068853_100024437 3300005539 Bacteria 5066
27 Ga0070695_100266949 3300005545 Bacteria 1252
28 Ga0070696_100207562 3300005546 Bacteria 1465
29 Ga0070665_100356276 3300005548 Bacteria 1469
30 Ga0070704_100043282 3300005549 Bacteria 3121
31 Ga0070704_100324446 3300005549 Bacteria 1291
32 Ga0070664_100450111 3300005564 Bacteria 1182
33 Ga0068857_100014706 3300005577 Bacteria 6829
34 Ga0068857_100521644 3300005577 Bacteria 1117
35 Ga0068864_100011129 3300005618 Bacteria 7437
36 Ga0068864_100083838 3300005618 Bacteria 2800
37 Ga0068866_10033246 3300005718 Bacteria 2500
38 Ga0068861_100003472 3300005719 Bacteria 10458
39 Ga0068861_100157151 3300005719 Bacteria 1872
40 Ga0068870_10008426 3300005840 Bacteria 4637
41 Ga0068863_100015515 3300005841 Bacteria 7320
42 Ga0068858_100125495 3300005842 Bacteria 2403
43 Ga0081455_10001325 3300005937 Bacteria 30612
44 Ga0081455_10002837 3300005937 Bacteria 20397
45 Ga0081455_10014155 3300005937 Bacteria 7836
46 Ga0081455_10016849 3300005937 Bacteria 7027
47 Ga0081455_10216770 3300005937 Bacteria 1422
48 Ga0081455_10233926 3300005937 Bacteria 1354
49 Ga0081455_10244358 3300005937 Bacteria 1317
50 Ga0081538_10002537 3300005981 Bacteria 17779
51 Ga0081538_10003592 3300005981 Bacteria 14574
52 Ga0081538_10010039 3300005981 Bacteria 7808
53 Ga0081538_10012381 3300005981 Bacteria 6837
54 Ga0081538_10055658 3300005981 Bacteria 2326
55 Ga0081538_10075630 3300005981 Bacteria 1826
56 Ga0081538_10093029 3300005981 Bacteria 1550
57 Ga0081538_10099798 3300005981 Bacteria 1466
58 Ga0075432_10022003 3300006058 Bacteria 2180
59 Ga0070716_100014109 3300006173 Bacteria 4087
60 Ga0097621_100009181 3300006237 Bacteria 7168
61 Ga0075428_100006752 3300006844 Bacteria 12764
62 Ga0075428_100022003 3300006844 Bacteria 7057
63 Ga0075428_100031823 3300006844 Bacteria 5827
64 Ga0075428_100177229 3300006844 Bacteria 2308
65 Ga0075428_100297992 3300006844 Bacteria 1734
66 Ga0075428_100344891 3300006844 Bacteria 1599
67 Ga0075428_100449855 3300006844 Unclassified 1380
68 Ga0075430_100028055 3300006846 Bacteria 4782
69 Ga0075430_100064376 3300006846 Bacteria 3080
70 Ga0075431_100005374 3300006847 Bacteria 12643
71 Ga0075431_100211011 3300006847 Bacteria 1983
72 Ga0075431_100274577 3300006847 Bacteria 1707
73 Ga0075433_10008006 3300006852 Bacteria 8414
74 Ga0075433_10147743 3300006852 Bacteria 2090
75 Ga0075433_10343704 3300006852 Bacteria 1319
76 Ga0075434_100196289 3300006871 Bacteria 2038
77 Ga0075434_100231742 3300006871 Bacteria 1866
78 Ga0075429_100008228 3300006880 Bacteria 9068
79 Ga0075429_100012812 3300006880 Bacteria 7274
80 Ga0075429_100044306 3300006880 Bacteria 3871
81 Ga0075429_100185294 3300006880 Bacteria 1824
82 Ga0075429_100340420 3300006880 Bacteria 1313
83 Ga0068865_100101846 3300006881 Bacteria 2104
84 Ga0111539_10001896 3300009094 Bacteria 27833
85 Ga0111539_10003040 3300009094 Bacteria 22223
86 Ga0111539_10006071 3300009094 Bacteria 15596
87 Ga0111539_10301824 3300009094 Bacteria 1864
88 Ga0105245_10002345 3300009098 Bacteria 17128
89 Ga0105245_10123767 3300009098 Bacteria 2418
90 Ga0105247_10032329 3300009101 Bacteria 3179
91 Ga0114129_10001439 3300009147 Bacteria 32122
92 Ga0114129_10004546 3300009147 Bacteria 19586
93 Ga0114129_10011809 3300009147 Bacteria 12426
94 Ga0114129_10025106 3300009147 Bacteria 8446
95 Ga0114129_10034290 3300009147 Bacteria 7168
96 Ga0105243_10025266 3300009148 Bacteria 4537
97 Ga0105242_10345712 3300009176 Bacteria 1372
98 Ga0105248_10051174 3300009177 Bacteria 4635
99 Ga0105249_10001575 3300009553 Bacteria 20013
100 Ga0105249_10330580 3300009553 Bacteria 1538
101 Ga0105239_10042448 3300010375 Bacteria 4984
102 Ga0105239_10439186 3300010375 Bacteria 1480
103 Ga0157370_10074748 3300013104 Bacteria 3196
104 Ga0157369_10131338 3300013105 Bacteria 2654
105 Ga0157374_10289831 3300013296 Bacteria 1618
106 Ga0157378_10326668 3300013297 Bacteria 1492
107 Ga0163162_10099198 3300013306 Bacteria 3003
108 Ga0157375_10222413 3300013308 Bacteria 2046
109 Ga0163163_10023868 3300014325 Bacteria 5813
110 Ga0163163_10027687 3300014325 Bacteria 5433
111 Ga0157377_10102074 3300014745 Bacteria 1711
112 Ga0157379_10005525 3300014968 Bacteria 10861
113 Ga0157376_10018013 3300014969 Bacteria 5403
114 Ga0207645_10266387 3300025907 Bacteria 1135
115 Ga0207643_10015470 3300025908 Bacteria 4153
116 Ga0207693_10105650 3300025915 Bacteria 2208
117 Ga0207649_10020350 3300025920 Bacteria 3805
118 Ga0207650_10033340 3300025925 Bacteria 3729
119 Ga0207650_10047405 3300025925 Bacteria 3166
120 Ga0207687_10008408 3300025927 Bacteria 6749
121 Ga0207687_10103041 3300025927 Bacteria 2104
122 Ga0207700_10147728 3300025928 Bacteria 1939
123 Ga0207700_10332446 3300025928 Bacteria 1319
124 Ga0207664_10089295 3300025929 Bacteria 2523
125 Ga0207706_10000601 3300025933 Bacteria 38297
126 Ga0207706_10469054 3300025933 Bacteria 1088
127 Ga0207686_10198007 3300025934 Bacteria 1437
128 Ga0207709_10005279 3300025935 Bacteria 7348
129 Ga0207704_10032968 3300025938 Bacteria 2940
130 Ga0207665_10010808 3300025939 Bacteria 5992
131 Ga0207689_10044410 3300025942 Bacteria 3674
132 Ga0207712_10125290 3300025961 Bacteria 1950
133 Ga0207712_10278578 3300025961 Bacteria 1364
134 Ga0207668_10028444 3300025972 Bacteria 3655
135 Ga0207677_10069078 3300026023 Bacteria 2483
136 Ga0207703_10251991 3300026035 Bacteria 1592
137 Ga0207703_10285766 3300026035 Bacteria 1500
138 Ga0207639_10004238 3300026041 Bacteria 9662
139 Ga0207708_10002549 3300026075 Bacteria 13401
140 Ga0207702_10164697 3300026078 Bacteria 2027
141 Ga0207641_10007025 3300026088 Bacteria 9411
142 Ga0207676_10011660 3300026095 Bacteria 6286
143 Ga0207676_10338383 3300026095 Bacteria 1387
144 Ga0207674_10005022 3300026116 Bacteria 15803
145 Ga0207674_10031740 3300026116 Bacteria 5546
146 Ga0207675_100000799 3300026118 Bacteria 31265
147 Ga0207675_100004075 3300026118 Bacteria 14147
148 Ga0207675_100012861 3300026118 Bacteria 7817
149 Ga0207683_10426863 3300026121 Bacteria 1221
150 Ga0207428_10005464 3300027907 Bacteria 11850
151 Ga0207428_10026280 3300027907 Bacteria 4860
152 Ga0268265_10158021 3300028380 Bacteria 1921
153 Ga0307513_10006063 3300031456 Bacteria 15865
154 Ga0373938_0025437 3300034957 Bacteria 1232
155 Ga0373926_0012149 3300035083 Bacteria 2908
156 Ga0373932_0056650 3300035112 Bacteria 1179
157 Ga0373939_0008206 3300035114 Bacteria 2557
158 Ga0373953_0016021 3300035117 Bacteria 2729
159 Ga0373962_0047877 3300035242 Bacteria 1224
160 Ga0316574_0021477 3300035398 Bacteria 3834
161 Ga0316574_0033082 3300035398 Bacteria 3147
162 Ga0373935_0231298 3300035692 Bacteria 1287
163 Ga0373933_0121442 3300035724 Bacteria 1636
164 Ga0373947_0000013 3300035725 Bacteria 145159
165 Ga0316584_0053277 3300036712 Bacteria 3028
166 Ga0395899_0010734 3300037312 Bacteria 7023
167 Ga0395899_0048662 3300037312 Bacteria 3154
168 Ga0395900_0031687 3300037418 Bacteria 5434
169 Ga0395900_0096368 3300037418 Bacteria 3039
170 Ga0395898_0095403 3300037466 Bacteria 2858
171 Ga0395898_0188810 3300037466 Bacteria 1969
172 Ga0395898_0426589 3300037466 Unclassified 1263
173 Ga0395905_0069979 3300037471 Bacteria 3287
174 Ga0395905_0194226 3300037471 Bacteria 1903
175 Ga0395901_0001550 3300038443 Bacteria 23811
176 Ga0439463_049417 3300042016 Bacteria 1072
177 Ga0466963_0028295 3300044694 Bacteria 3597
178 Ga0466963_0075926 3300044694 Bacteria 2269
179 Ga0466963_0087829 3300044694 Bacteria 2115
180 Ga0466963_0174402 3300044694 Bacteria 1500
181 Ga0466963_0197103 3300044694 Bacteria 1408
182 Ga0466964_0012542 3300044706 Bacteria 3208
183 Ga0466964_0087038 3300044706 Bacteria 1353
184 Ga0466960_0158629 3300044901 Bacteria 1213
185 Ga0466959_0080282 3300045049 Bacteria 2352
186 Ga0466958_0004439 3300045836 Bacteria 7408
187 Ga0466967_0004903 3300045976 Bacteria 9142
188 Ga0466967_0009242 3300045976 Bacteria 7298
189 Ga0466967_0019862 3300045976 Bacteria 5414
190 Ga0466967_0025473 3300045976 Bacteria 4879
191 Ga0466967_0118048 3300045976 Bacteria 2446
192 Ga0466967_0348216 3300045976 Bacteria 1433
193 Ga0495603_0195364 3300046455 Bacteria 1170
194 Ga0495641_0031099 3300046461 Bacteria 2553
195 Ga0495641_0071848 3300046461 Bacteria 1553
196 Ga0495580_0036397 3300046472 Bacteria 3534
197 Ga0495580_0175935 3300046472 Bacteria 1478
198 Ga0495639_0097370 3300046475 Bacteria 1386
199 Ga0495639_0160685 3300046475 Bacteria 1087
200 Ga0495585_0161308 3300046492 Bacteria 1163
201 Ga0495594_0015156 3300046499 Bacteria 4047
202 Ga0495596_0114250 3300046500 Bacteria 1049
203 Ga0495607_0093009 3300046501 Bacteria 1630
204 Ga0495583_0113438 3300046506 Bacteria 1147
205 Ga0495606_0042247 3300046507 Bacteria 3050
206 Ga0495637_0069587 3300046520 Bacteria 1423
207 Ga0495642_0047219 3300046528 Unclassified 1763
208 Ga0495652_0264268 3300046529 Bacteria 1268
209 Ga0495668_0001738 3300046616 Bacteria 20033
210 Ga0495625_0000608 3300046660 Bacteria 51927
211 Ga0495659_0043676 3300046664 Bacteria 1609
212 Ga0495588_0037667 3300046674 Bacteria 2458
213 Ga0495588_0080402 3300046674 Bacteria 1701
214 Ga0495658_0020200 3300046683 Bacteria 3492
215 Ga0495658_0312527 3300046683 Bacteria 995
216 Ga0495671_0114050 3300046692 Unclassified 1320
217 Ga0495581_0284588 3300047315 Bacteria 966
218 Ga0495683_0041444 3300047323 Bacteria 2323
219 Ga0495686_0001705 3300047472 Bacteria 22707
220 Ga0495686_0045282 3300047472 Bacteria 2784
221 Ga0495626_0000118 3300048091 Bacteria 103373
222 Ga0496102_0252813 3300048905 Bacteria 1662
223 Ga0496102_0271768 3300048905 Bacteria 1598
224 Ga0496104_0003923 3300048907 Bacteria 12875
225 Ga0496105_0169967 3300048908 Bacteria 1787
226 Ga0496105_0190714 3300048908 Bacteria 1676
227 Ga0496108_0055544 3300048911 Bacteria 3325
228 Ga0496108_0218902 3300048911 Bacteria 1654
229 Ga0496109_0015377 3300048912 Bacteria 6668
230 Ga0496109_0044244 3300048912 Bacteria 4039
231 Ga0496109_0125366 3300048912 Bacteria 2394
232 Ga0496109_0353466 3300048912 Bacteria 1388
233 Ga0496110_0009988 3300048913 Bacteria 7700
234 Ga0496110_0147398 3300048913 Bacteria 2130
235 Ga0496111_0011931 3300048914 Bacteria 5872
236 Ga0496111_0063740 3300048914 Bacteria 2673
237 Ga0496112_0181225 3300048915 Bacteria 2070
238 Ga0496114_0119263 3300048917 Bacteria 2268
239 Ga0496115_0411255 3300048918 Bacteria 1097
240 Ga0496126_0073640 3300048929 Bacteria 3036
241 Ga0501031_0000707 3300049568 Bacteria 19927
242 Ga0501031_0001109 3300049568 Bacteria 16425
243 Ga0501031_0193299 3300049568 Bacteria 1328
244 Ga0501032_0023816 3300049569 Bacteria 4227
245 Ga0501032_0131918 3300049569 Unclassified 1648
246 Ga0501033_0050250 3300049570 Bacteria 3094
247 Ga0501033_0148473 3300049570 Bacteria 1692
248 Ga0501033_0300540 3300049570 Bacteria 1130
249 Ga0501034_0120914 3300049571 Bacteria 2605
250 Ga0501036_0001512 3300049572 Bacteria 17936
251 Ga0501036_0036743 3300049572 Bacteria 4145
252 Ga0501036_0069030 3300049572 Bacteria 2991
253 Ga0501036_0144281 3300049572 Bacteria 2008
254 Ga0501036_0166341 3300049572 Bacteria 1859
255 Ga0501036_0276108 3300049572 Bacteria 1407
256 Ga0501036_0398748 3300049572 Bacteria 1148
257 Ga0501036_0436380 3300049572 Bacteria 1091
258 Ga0501037_0005632 3300049573 Bacteria 9131
259 Ga0501038_0004239 3300049574 Bacteria 13328
260 Ga0501038_0035427 3300049574 Bacteria 4381
261 Ga0501038_0265058 3300049574 Bacteria 1356
262 Ga0501039_0009553 3300049575 Bacteria 7392
263 Ga0501039_0013677 3300049575 Bacteria 6207
264 Ga0501039_0028888 3300049575 Bacteria 4270
265 Ga0501039_0060903 3300049575 Bacteria 2923
266 Ga0501039_0372218 3300049575 Bacteria 1122
267 Ga0501040_0001987 3300049576 Bacteria 13196
268 Ga0501040_0024944 3300049576 Bacteria 4018
269 Ga0501040_0026367 3300049576 Bacteria 3908
270 Ga0501040_0051619 3300049576 Bacteria 2813
271 Ga0501040_0073108 3300049576 Bacteria 2369
272 Ga0501040_0173286 3300049576 Bacteria 1528
273 Ga0501040_0240366 3300049576 Bacteria 1291
274 Ga0501041_0000441 3300049577 Bacteria 21027
275 Ga0501041_0002868 3300049577 Bacteria 9865
276 Ga0501041_0011885 3300049577 Bacteria 5156
277 Ga0501041_0012668 3300049577 Bacteria 4996
278 Ga0501041_0024068 3300049577 Bacteria 3654
279 Ga0501041_0039497 3300049577 Bacteria 2865
280 Ga0501041_0082678 3300049577 Bacteria 1979
281 Ga0501041_0130102 3300049577 Bacteria 1568
282 Ga0501041_0254530 3300049577 Bacteria 1104
283 Ga0501042_0007189 3300049578 Bacteria 7285
284 Ga0501042_0021194 3300049578 Bacteria 4526
285 Ga0501042_0050720 3300049578 Bacteria 2960
286 Ga0501042_0105873 3300049578 Bacteria 2024
287 Ga0501042_0130849 3300049578 Bacteria 1809
288 Ga0501042_0194618 3300049578 Bacteria 1462
289 Ga0501042_0208397 3300049578 Bacteria 1409
290 Ga0501043_0014985 3300049579 Bacteria 6071
291 Ga0501043_0261278 3300049579 Archaea 1331
292 Ga0501043_0265279 3300049579 Bacteria 1320
293 Ga0501043_0487928 3300049579 Bacteria 922
294 Ga0501046_0002392 3300049580 Bacteria 17632
295 Ga0501046_0005027 3300049580 Bacteria 11870
296 Ga0501046_0049073 3300049580 Bacteria 3340
297 Ga0501046_0207431 3300049580 Bacteria 1456
298 Ga0501046_0302799 3300049580 Unclassified 1167
299 Ga0501046_0466129 3300049580 Bacteria 907
300 Ga0501048_0001293 3300049582 Bacteria 18990
301 Ga0501048_0033491 3300049582 Bacteria 3712
302 Ga0501048_0075416 3300049582 Bacteria 2379
303 Ga0501048_0172618 3300049582 Bacteria 1532
304 Ga0501048_0338611 3300049582 Bacteria 1072
305 Ga0501048_0408426 3300049582 Unclassified 971
306 Ga0501068_0008430 3300049584 Bacteria 5735
307 Ga0501068_0017955 3300049584 Bacteria 4095
308 Ga0501068_0033521 3300049584 Bacteria 3058
309 Ga0501068_0187636 3300049584 Bacteria 1309
310 Ga0501069_0000946 3300049585 Bacteria 13846
311 Ga0501070_0017072 3300049586 Bacteria 6091
312 Ga0501070_0035766 3300049586 Bacteria 4148
313 Ga0501070_0064881 3300049586 Bacteria 3024
314 Ga0501071_0004986 3300049587 Bacteria 8485
315 Ga0501071_0011137 3300049587 Bacteria 6047
316 Ga0501071_0024733 3300049587 Bacteria 4200
317 Ga0501071_0029454 3300049587 Bacteria 3875
318 Ga0501071_0040545 3300049587 Bacteria 3332
319 Ga0501071_0048948 3300049587 Bacteria 3041
320 Ga0501071_0133526 3300049587 Bacteria 1845
321 Ga0501071_0150723 3300049587 Bacteria 1734
322 Ga0501071_0159262 3300049587 Bacteria 1687
323 Ga0501072_0001079 3300049588 Bacteria 20269
324 Ga0501072_0006995 3300049588 Bacteria 8565
325 Ga0501072_0011166 3300049588 Bacteria 6856
326 Ga0501072_0033828 3300049588 Bacteria 4005
327 Ga0501072_0039859 3300049588 Bacteria 3687
328 Ga0501072_0082649 3300049588 Bacteria 2546
329 Ga0501072_0144844 3300049588 Bacteria 1894
330 Ga0501072_0151382 3300049588 Bacteria 1850
331 Ga0501072_0190320 3300049588 Bacteria 1637
332 Ga0501072_0219638 3300049588 Bacteria 1515
333 Ga0501072_0295703 3300049588 Bacteria 1287
334 Ga0501073_0031985 3300049589 Bacteria 3753
335 Ga0501074_0043886 3300049590 Bacteria 3236
336 Ga0501074_0119320 3300049590 Bacteria 1886
337 Ga0501074_0132109 3300049590 Bacteria 1786
338 Ga0501074_0355030 3300049590 Bacteria 1040
339 Ga0501075_0001064 3300049591 Bacteria 17655
340 Ga0501075_0018690 3300049591 Bacteria 5019
341 Ga0501075_0025223 3300049591 Bacteria 4368
342 Ga0501075_0037103 3300049591 Bacteria 3640
343 Ga0501075_0040648 3300049591 Bacteria 3483
344 Ga0501075_0077820 3300049591 Bacteria 2510
345 Ga0501075_0117402 3300049591 Bacteria 2023
346 Ga0501075_0125491 3300049591 Bacteria 1954
347 Ga0501075_0322794 3300049591 Bacteria 1176
348 Ga0501076_0001094 3300049592 Bacteria 17834
349 Ga0501076_0001647 3300049592 Bacteria 15076
350 Ga0501076_0020005 3300049592 Bacteria 5120
351 Ga0501076_0020340 3300049592 Bacteria 5080
352 Ga0501076_0021064 3300049592 Bacteria 4996
353 Ga0501076_0030553 3300049592 Bacteria 4196
354 Ga0501076_0053687 3300049592 Bacteria 3194
355 Ga0501076_0056441 3300049592 Bacteria 3117
356 Ga0501076_0090629 3300049592 Bacteria 2459
357 Ga0501076_0113675 3300049592 Bacteria 2190
358 Ga0501076_0125681 3300049592 Bacteria 2078
359 Ga0501076_0144093 3300049592 Bacteria 1937
360 Ga0501076_0324791 3300049592 Bacteria 1262
361 Ga0501077_0037079 3300049593 Bacteria 3106
362 Ga0501077_0058378 3300049593 Bacteria 2450
363 Ga0501077_0071246 3300049593 Bacteria 2203
364 Ga0501077_0183177 3300049593 Bacteria 1331
365 Ga0501077_0273584 3300049593 Bacteria 1074
366 Ga0501079_0004491 3300049741 Bacteria 10350
367 Ga0501079_0010293 3300049741 Bacteria 7104
368 Ga0501079_0012114 3300049741 Bacteria 6583
369 Ga0501079_0015116 3300049741 Bacteria 5886
370 Ga0501079_0099289 3300049741 Bacteria 2256
371 Ga0501079_0123371 3300049741 Bacteria 2015
372 Ga0501079_0247257 3300049741 Bacteria 1394
373 Ga0501079_0263396 3300049741 Bacteria 1347
374 Ga0501079_0426891 3300049741 Bacteria 1041
375 Ga0501080_0014869 3300049742 Bacteria 7166
376 Ga0501080_0039641 3300049742 Bacteria 4397
377 Ga0501080_0216288 3300049742 Bacteria 1755
378 Ga0501081_0002235 3300049743 Bacteria 12176
379 Ga0501081_0009160 3300049743 Bacteria 6444
380 Ga0501081_0019387 3300049743 Bacteria 4529
381 Ga0501081_0044827 3300049743 Bacteria 3037
382 Ga0501081_0079014 3300049743 Bacteria 2301
383 Ga0501081_0131872 3300049743 Bacteria 1786
384 Ga0501081_0168595 3300049743 Bacteria 1580
385 Ga0501081_0185542 3300049743 Bacteria 1505
386 Ga0501081_0199265 3300049743 Bacteria 1452
387 Ga0501083_0001593 3300049744 Bacteria 15504
388 Ga0501083_0057646 3300049744 Bacteria 2600
389 Ga0501083_0095743 3300049744 Bacteria 1959
390 Ga0501035_0010952 3300049822 Bacteria 8398
391 Ga0501035_0043721 3300049822 Bacteria 4036
392 Ga0501035_0095134 3300049822 Bacteria 2619
393 Ga0501044_0087086 3300049823 Bacteria 3155
394 Ga0501045_0016803 3300049824 Bacteria 5197
395 Ga0501045_0032117 3300049824 Bacteria 3803
396 Ga0501045_0073074 3300049824 Bacteria 2525
397 Ga0501045_0112909 3300049824 Bacteria 2015
398 Ga0501045_0132775 3300049824 Bacteria 1851
399 Ga0501045_0136841 3300049824 Bacteria 1821
400 Ga0501045_0169522 3300049824 Bacteria 1626
401 Ga0501045_0232492 3300049824 Bacteria 1372
402 nmdc:mga0yw44_254124_c1 3300050492 Bacteria 1170
403 nmdc:mga05p37_132191_c1 3300050507 Bacteria 3062
404 nmdc:mga05p37_1354_c1 3300050507 Bacteria 28491
405 nmdc:mga05p37_13821_c1 3300050507 Bacteria 9672
406 nmdc:mga05p37_144015_c1 3300050507 Bacteria 2919
407 nmdc:mga05p37_94243_c1 3300050507 Bacteria 3689
408 nmdc:mga09592_113666_c1 3300050508 Bacteria 2323
409 nmdc:mga09592_269580_c1 3300050508 Bacteria 1476
410 nmdc:mga09592_54870_c1 3300050508 Bacteria 3367
411 nmdc:mga0qj67_129417_c1 3300050509 Bacteria 2044
412 nmdc:mga0qj67_145318_c1 3300050509 Bacteria 1923
413 nmdc:mga06r32_127390_c1 3300050510 Bacteria 2516
414 nmdc:mga06r32_2009_c1 3300050510 Bacteria 18190
415 nmdc:mga06r32_33806_c1 3300050510 Bacteria 4818
416 nmdc:mga06r32_477201_c1 3300050510 Bacteria 1225
417 nmdc:mga06r32_7504_c1 3300050510 Bacteria 9809
418 nmdc:mga08y16_27307_c1 3300050511 Bacteria 6013
419 nmdc:mga08y16_323097_c1 3300050511 Bacteria 1588
420 nmdc:mga08y16_845_c1 3300050511 Bacteria 29413
421 nmdc:mga0n895_188195_c1 3300050512 Bacteria 2095
422 nmdc:mga0n895_53168_c1 3300050512 Bacteria 3979
423 nmdc:mga08x19_413885_c1 3300050514 Bacteria 946
424 nmdc:mga0a205_425389_c1 3300050515 Unclassified 1190
425 nmdc:mga0a205_47123_c1 3300050515 Bacteria 4158
426 nmdc:mga0a205_53497_c1 3300050515 Bacteria 3897
427 Ga0500616_0001702 3300053153 Bacteria 20227
428 Ga0501084_0000010 3300054114 Bacteria 187712
429 Ga0501084_0026237 3300054114 Bacteria 4860
430 Ga0501084_0029506 3300054114 Bacteria 4587
431 Ga0501084_0046436 3300054114 Bacteria 3638
432 Ga0501084_0049822 3300054114 Bacteria 3506
433 Ga0501084_0104558 3300054114 Bacteria 2378
434 Ga0501084_0173289 3300054114 Bacteria 1821
435 Ga0501084_0189422 3300054114 Bacteria 1735
436 Ga0501084_0253117 3300054114 Bacteria 1486
437 Ga0501084_0634323 3300054114 Bacteria 902
438 Ga0590074_004639 3300059423 Bacteria 2271
439 Ga0590077_004790 3300059426 Bacteria 2768
440 Ga0501082_0011331 3300060353 Bacteria 7664
441 Ga0501082_0029903 3300060353 Bacteria 4693
442 Ga0501082_0031302 3300060353 Bacteria 4587
443 Ga0501082_0036036 3300060353 Bacteria 4263
444 Ga0501082_0070021 3300060353 Bacteria 3021
445 Ga0501082_0073484 3300060353 Bacteria 2945
446 Ga0501082_0111153 3300060353 Bacteria 2372
447 Ga0501082_0142940 3300060353 Bacteria 2076
448 Ga0501082_0156886 3300060353 Bacteria 1977
449 Ga0501082_0201120 3300060353 Bacteria 1733
450 Ga0501082_0271075 3300060353 Unclassified 1477
451 Ga0530510_0005774 3300061734 Bacteria 8576
452 Ga0530510_0007803 3300061734 Bacteria 7461
453 Ga0530510_0013383 3300061734 Bacteria 5767
454 Ga0530510_0024968 3300061734 Bacteria 4272
455 Ga0530510_0036232 3300061734 Bacteria 3556
456 Ga0530510_0059302 3300061734 Bacteria 2768
457 Ga0530510_0129837 3300061734 Bacteria 1853
458 Ga0530510_0172173 3300061734 Bacteria 1604
459 8001789057 8001781756 Bacteria 9586736
460 Ga0081455_10001062
461 JGI24751J29686_10000690
462 JGI25407J50210_10004064
463 Ga0070676_10206578
464 Ga0070683_100187911
465 Ga0070670_100014414
466 Ga0070670_100203727
467 Ga0068869_100030994
468 Ga0068868_100034145
469 Ga0070691_10021053
470 Ga0070661_100013100
471 Ga0070668_100083018
472 Ga0070674_100369203
473 Ga0070703_10036381
474 Ga0070711_100411259
475 Ga0070705_100072527
476 Ga0070700_100026481
477 Ga0070700_100027988
478 Ga0070694_100063987
479 Ga0070663_100005999
480 Ga0070706_100453681
481 Ga0070698_100398022
482 Ga0070699_100176258
483 Ga0070679_100067631
484 Ga0070684_100140233
485 Ga0068853_100024437
486 Ga0070695_100266949
487 Ga0070696_100207562
488 Ga0070665_100356276
489 Ga0070704_100043282
490 Ga0070704_100324446
491 Ga0070664_100450111
492 Ga0068857_100014706
493 Ga0068857_100521644
494 Ga0068864_100011129
495 Ga0068864_100083838
496 Ga0068866_10033246
497 Ga0068861_100003472
498 Ga0068861_100157151
499 Ga0068870_10008426
500 Ga0068863_100015515
501 Ga0068858_100125495
502 Ga0081455_10001325
503 Ga0081455_10002837
504 Ga0081455_10014155
505 Ga0081455_10016849
506 Ga0081455_10216770
507 Ga0081455_10233926
508 Ga0081455_10244358
509 Ga0081538_10002537
510 Ga0081538_10003592
511 Ga0081538_10010039
512 Ga0081538_10012381
513 Ga0081538_10055658
514 Ga0081538_10075630
515 Ga0081538_10093029
516 Ga0081538_10099798
517 Ga0075432_10022003
518 Ga0070716_100014109
519 Ga0097621_100009181
520 Ga0075428_100006752
521 Ga0075428_100022003
522 Ga0075428_100031823
523 Ga0075428_100177229
524 Ga0075428_100297992
525 Ga0075428_100344891
526 Ga0075428_100449855
527 Ga0075430_100028055
528 Ga0075430_100064376
529 Ga0075431_100005374
530 Ga0075431_100211011
531 Ga0075431_100274577
532 Ga0075433_10008006
533 Ga0075433_10147743
534 Ga0075433_10343704
535 Ga0075434_100196289
536 Ga0075434_100231742
537 Ga0075429_100008228
538 Ga0075429_100012812
539 Ga0075429_100044306
540 Ga0075429_100185294
541 Ga0075429_100340420
542 Ga0068865_100101846
543 Ga0111539_10001896
544 Ga0111539_10003040
545 Ga0111539_10006071
546 Ga0111539_10301824
547 Ga0105245_10002345
548 Ga0105245_10123767
549 Ga0105247_10032329
550 Ga0114129_10001439
551 Ga0114129_10004546
552 Ga0114129_10011809
553 Ga0114129_10025106
554 Ga0114129_10034290
555 Ga0105243_10025266
556 Ga0105242_10345712
557 Ga0105248_10051174
558 Ga0105249_10001575
559 Ga0105249_10330580
560 Ga0105239_10042448
561 Ga0105239_10439186
562 Ga0157370_10074748
563 Ga0157369_10131338
564 Ga0157374_10289831
565 Ga0157378_10326668
566 Ga0163162_10099198
567 Ga0157375_10222413
568 Ga0163163_10023868
569 Ga0163163_10027687
570 Ga0157377_10102074
571 Ga0157379_10005525
572 Ga0157376_10018013
573 Ga0207645_10266387
574 Ga0207643_10015470
575 Ga0207693_10105650
576 Ga0207649_10020350
577 Ga0207650_10033340
578 Ga0207650_10047405
579 Ga0207687_10008408
580 Ga0207687_10103041
581 Ga0207700_10147728
582 Ga0207700_10332446
583 Ga0207664_10089295
584 Ga0207706_10000601
585 Ga0207706_10469054
586 Ga0207686_10198007
587 Ga0207709_10005279
588 Ga0207704_10032968
589 Ga0207665_10010808
590 Ga0207689_10044410
591 Ga0207712_10125290
592 Ga0207712_10278578
593 Ga0207668_10028444
594 Ga0207677_10069078
595 Ga0207703_10251991
596 Ga0207703_10285766
597 Ga0207639_10004238
598 Ga0207708_10002549
599 Ga0207702_10164697
600 Ga0207641_10007025
601 Ga0207676_10011660
602 Ga0207676_10338383
603 Ga0207674_10005022
604 Ga0207674_10031740
605 Ga0207675_100000799
606 Ga0207675_100004075
607 Ga0207675_100012861
608 Ga0207683_10426863
609 Ga0207428_10005464
610 Ga0207428_10026280
611 Ga0268265_10158021
612 Ga0307513_10006063
613 Ga0373938_0025437
614 Ga0373926_0012149
615 Ga0373932_0056650
616 Ga0373939_0008206
617 Ga0373953_0016021
618 Ga0373962_0047877
619 Ga0316574_0021477
620 Ga0316574_0033082
621 Ga0373935_0231298
622 Ga0373933_0121442
623 Ga0373947_0000013
624 Ga0316584_0053277
625 Ga0395899_0010734
626 Ga0395899_0048662
627 Ga0395900_0031687
628 Ga0395900_0096368
629 Ga0395898_0095403
630 Ga0395898_0188810
631 Ga0395898_0426589
632 Ga0395905_0069979
633 Ga0395905_0194226
634 Ga0395901_0001550
635 Ga0439463_049417
636 Ga0466963_0028295
637 Ga0466963_0075926
638 Ga0466963_0087829
639 Ga0466963_0174402
640 Ga0466963_0197103
641 Ga0466964_0012542
642 Ga0466964_0087038
643 Ga0466960_0158629
644 Ga0466959_0080282
645 Ga0466958_0004439
646 Ga0466967_0004903
647 Ga0466967_0009242
648 Ga0466967_0019862
649 Ga0466967_0025473
650 Ga0466967_0118048
651 Ga0466967_0348216
652 Ga0495603_0195364
653 Ga0495641_0031099
654 Ga0495641_0071848
655 Ga0495580_0036397
656 Ga0495580_0175935
657 Ga0495639_0097370
658 Ga0495639_0160685
659 Ga0495585_0161308
660 Ga0495594_0015156
661 Ga0495596_0114250
662 Ga0495607_0093009
663 Ga0495583_0113438
664 Ga0495606_0042247
665 Ga0495637_0069587
666 Ga0495642_0047219
667 Ga0495652_0264268
668 Ga0495668_0001738
669 Ga0495625_0000608
670 Ga0495659_0043676
671 Ga0495588_0037667
672 Ga0495588_0080402
673 Ga0495658_0020200
674 Ga0495658_0312527
675 Ga0495671_0114050
676 Ga0495581_0284588
677 Ga0495683_0041444
678 Ga0495686_0001705
679 Ga0495686_0045282
680 Ga0495626_0000118
681 Ga0496102_0252813
682 Ga0496102_0271768
683 Ga0496104_0003923
684 Ga0496105_0169967
685 Ga0496105_0190714
686 Ga0496108_0055544
687 Ga0496108_0218902
688 Ga0496109_0015377
689 Ga0496109_0044244
690 Ga0496109_0125366
691 Ga0496109_0353466
692 Ga0496110_0009988
693 Ga0496110_0147398
694 Ga0496111_0011931
695 Ga0496111_0063740
696 Ga0496112_0181225
697 Ga0496114_0119263
698 Ga0496115_0411255
699 Ga0496126_0073640
700 Ga0501031_0000707
701 Ga0501031_0001109
702 Ga0501031_0193299
703 Ga0501032_0023816
704 Ga0501032_0131918
705 Ga0501033_0050250
706 Ga0501033_0148473
707 Ga0501033_0300540
708 Ga0501034_0120914
709 Ga0501036_0001512
710 Ga0501036_0036743
711 Ga0501036_0069030
712 Ga0501036_0144281
713 Ga0501036_0166341
714 Ga0501036_0276108
715 Ga0501036_0398748
716 Ga0501036_0436380
717 Ga0501037_0005632
718 Ga0501038_0004239
719 Ga0501038_0035427
720 Ga0501038_0265058
721 Ga0501039_0009553
722 Ga0501039_0013677
723 Ga0501039_0028888
724 Ga0501039_0060903
725 Ga0501039_0372218
726 Ga0501040_0001987
727 Ga0501040_0024944
728 Ga0501040_0026367
729 Ga0501040_0051619
730 Ga0501040_0073108
731 Ga0501040_0173286
732 Ga0501040_0240366
733 Ga0501041_0000441
734 Ga0501041_0002868
735 Ga0501041_0011885
736 Ga0501041_0012668
737 Ga0501041_0024068
738 Ga0501041_0039497
739 Ga0501041_0082678
740 Ga0501041_0130102
741 Ga0501041_0254530
742 Ga0501042_0007189
743 Ga0501042_0021194
744 Ga0501042_0050720
745 Ga0501042_0105873
746 Ga0501042_0130849
747 Ga0501042_0194618
748 Ga0501042_0208397
749 Ga0501043_0014985
750 Ga0501043_0261278
751 Ga0501043_0265279
752 Ga0501043_0487928
753 Ga0501046_0002392
754 Ga0501046_0005027
755 Ga0501046_0049073
756 Ga0501046_0207431
757 Ga0501046_0302799
758 Ga0501046_0466129
759 Ga0501048_0001293
760 Ga0501048_0033491
761 Ga0501048_0075416
762 Ga0501048_0172618
763 Ga0501048_0338611
764 Ga0501048_0408426
765 Ga0501068_0008430
766 Ga0501068_0017955
767 Ga0501068_0033521
768 Ga0501068_0187636
769 Ga0501069_0000946
770 Ga0501070_0017072
771 Ga0501070_0035766
772 Ga0501070_0064881
773 Ga0501071_0004986
774 Ga0501071_0011137
775 Ga0501071_0024733
776 Ga0501071_0029454
777 Ga0501071_0040545
778 Ga0501071_0048948
779 Ga0501071_0133526
780 Ga0501071_0150723
781 Ga0501071_0159262
782 Ga0501072_0001079
783 Ga0501072_0006995
784 Ga0501072_0011166
785 Ga0501072_0033828
786 Ga0501072_0039859
787 Ga0501072_0082649
788 Ga0501072_0144844
789 Ga0501072_0151382
790 Ga0501072_0190320
791 Ga0501072_0219638
792 Ga0501072_0295703
793 Ga0501073_0031985
794 Ga0501074_0043886
795 Ga0501074_0119320
796 Ga0501074_0132109
797 Ga0501074_0355030
798 Ga0501075_0001064
799 Ga0501075_0018690
800 Ga0501075_0025223
801 Ga0501075_0037103
802 Ga0501075_0040648
803 Ga0501075_0077820
804 Ga0501075_0117402
805 Ga0501075_0125491
806 Ga0501075_0322794
807 Ga0501076_0001094
808 Ga0501076_0001647
809 Ga0501076_0020005
810 Ga0501076_0020340
811 Ga0501076_0021064
812 Ga0501076_0030553
813 Ga0501076_0053687
814 Ga0501076_0056441
815 Ga0501076_0090629
816 Ga0501076_0113675
817 Ga0501076_0125681
818 Ga0501076_0144093
819 Ga0501076_0324791
820 Ga0501077_0037079
821 Ga0501077_0058378
822 Ga0501077_0071246
823 Ga0501077_0183177
824 Ga0501077_0273584
825 Ga0501079_0004491
826 Ga0501079_0010293
827 Ga0501079_0012114
828 Ga0501079_0015116
829 Ga0501079_0099289
830 Ga0501079_0123371
831 Ga0501079_0247257
832 Ga0501079_0263396
833 Ga0501079_0426891
834 Ga0501080_0014869
835 Ga0501080_0039641
836 Ga0501080_0216288
837 Ga0501081_0002235
838 Ga0501081_0009160
839 Ga0501081_0019387
840 Ga0501081_0044827
841 Ga0501081_0079014
842 Ga0501081_0131872
843 Ga0501081_0168595
844 Ga0501081_0185542
845 Ga0501081_0199265
846 Ga0501083_0001593
847 Ga0501083_0057646
848 Ga0501083_0095743
849 Ga0501035_0010952
850 Ga0501035_0043721
851 Ga0501035_0095134
852 Ga0501044_0087086
853 Ga0501045_0016803
854 Ga0501045_0032117
855 Ga0501045_0073074
856 Ga0501045_0112909
857 Ga0501045_0132775
858 Ga0501045_0136841
859 Ga0501045_0169522
860 Ga0501045_0232492
861 nmdc:mga0yw44_254124_c1
862 nmdc:mga05p37_132191_c1
863 nmdc:mga05p37_1354_c1
864 nmdc:mga05p37_13821_c1
865 nmdc:mga05p37_144015_c1
866 nmdc:mga05p37_94243_c1
867 nmdc:mga09592_113666_c1
868 nmdc:mga09592_269580_c1
869 nmdc:mga09592_54870_c1
870 nmdc:mga0qj67_129417_c1
871 nmdc:mga0qj67_145318_c1
872 nmdc:mga06r32_127390_c1
873 nmdc:mga06r32_2009_c1
874 nmdc:mga06r32_33806_c1
875 nmdc:mga06r32_477201_c1
876 nmdc:mga06r32_7504_c1
877 nmdc:mga08y16_27307_c1
878 nmdc:mga08y16_323097_c1
879 nmdc:mga08y16_845_c1
880 nmdc:mga0n895_188195_c1
881 nmdc:mga0n895_53168_c1
882 nmdc:mga08x19_413885_c1
883 nmdc:mga0a205_425389_c1
884 nmdc:mga0a205_47123_c1
885 nmdc:mga0a205_53497_c1
886 Ga0500616_0001702
887 Ga0501084_0000010
888 Ga0501084_0026237
889 Ga0501084_0029506
890 Ga0501084_0046436
891 Ga0501084_0049822
892 Ga0501084_0104558
893 Ga0501084_0173289
894 Ga0501084_0189422
895 Ga0501084_0253117
896 Ga0501084_0634323
897 Ga0590074_004639
898 Ga0590077_004790
899 Ga0501082_0011331
900 Ga0501082_0029903
901 Ga0501082_0031302
902 Ga0501082_0036036
903 Ga0501082_0070021
904 Ga0501082_0073484
905 Ga0501082_0111153
906 Ga0501082_0142940
907 Ga0501082_0156886
908 Ga0501082_0201120
909 Ga0501082_0271075
910 Ga0530510_0005774
911 Ga0530510_0007803
912 Ga0530510_0013383
913 Ga0530510_0024968
914 Ga0530510_0036232
915 Ga0530510_0059302
916 Ga0530510_0129837
917 Ga0530510_0172173
918 8001789057

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

138

324

0.93

PF12911

OppC_N

N-terminal TM domain of oligopeptide transport permease C

44

99

0.92

Map