F448329

General Info

Members Datasets Scaffolds Average Seq Length
459 201 918 224

Family's Representative Sequence

Representative Sequence 3300005615|Ga0070702_100145491|Ga0070702_1001454912
Length 233
Sequence MSSKVKELQLAGPVNHASSRGTLFVVSSPSGGGKGTIIRHVLDVVENLSYSVSFTTRAPRQTEVDGREYFFVSRETFDEMVGAGEFLEWACVHGNFYGTSKKQIMDETATGADIILEVDVQGAASVRQLLMDSVSIFILPPSYEVLRQRLIARGTDSPQELEVRLRNAPEELEQYSAFDYVILNDEVDRASAQLASIIYAERARCMRQEPLVREVINKFKSNQLQIDRPKEQR

Samples

Sample ID Description Type Environment
1 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
74 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
142 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
143 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
144 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
152 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
153 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
154 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
155 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
156 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
157 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
158 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
159 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
160 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
169 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
170 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
171 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
172 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
173 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
176 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
177 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
178 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
179 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
180 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
181 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
182 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
183 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
184 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
185 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
186 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
187 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
188 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
189 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
190 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
191 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
192 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
193 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
196 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
197 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
201 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.53
Rhizosphere 98.47
Stem 0
Stem Tuber 0
Unclassified 15.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070702_100145491 3300005615 Unclassified 1515
2 SwRhRL2b_contig_2994234 2162886007 Bacteria 1424
3 MBSR1b_contig_231005 2162886012 Bacteria 1085
4 JGI24736J21556_1025646 3300001904 Unclassified 917
5 JGI24751J29686_10000072 3300002459 Bacteria 57601
6 Ga0065714_10002183 3300005288 Bacteria 378167
7 Ga0065704_10011392 3300005289 Bacteria 1652
8 Ga0065712_10000030 3300005290 Bacteria 237869
9 Ga0065712_10013836 3300005290 Bacteria 2238
10 Ga0065712_10014704 3300005290 Bacteria 1823
11 Ga0065712_10069428 3300005290 Bacteria 7318
12 Ga0065715_10089414 3300005293 Bacteria 10379
13 Ga0065715_10102791 3300005293 Bacteria 3084
14 Ga0065715_10139832 3300005293 Bacteria 1870
15 Ga0065707_10001869 3300005295 Bacteria 5968
16 Ga0065707_10042641 3300005295 Bacteria 824
17 Ga0065707_10144825 3300005295 Bacteria 1727
18 Ga0065707_10169903 3300005295 Bacteria 1488
19 Ga0065707_10268869 3300005295 Unclassified 1077
20 Ga0070690_100002388 3300005330 Bacteria 10092
21 Ga0070670_100000057 3300005331 Bacteria 118540
22 Ga0070670_100013161 3300005331 Bacteria 7085
23 Ga0070670_100086225 3300005331 Bacteria 2698
24 Ga0070670_100103897 3300005331 Bacteria 2447
25 Ga0070670_100107287 3300005331 Bacteria 2407
26 Ga0068869_100287582 3300005334 Unclassified 1324
27 Ga0068869_100291042 3300005334 Bacteria 1316
28 Ga0070666_10053830 3300005335 Bacteria 2715
29 Ga0070666_10388450 3300005335 Bacteria 1002
30 Ga0070680_100164120 3300005336 Bacteria 1867
31 Ga0070680_100299698 3300005336 Bacteria 1363
32 Ga0070682_100005296 3300005337 Bacteria 7179
33 Ga0070682_100155424 3300005337 Bacteria 1574
34 Ga0068868_100330975 3300005338 Bacteria 1300
35 Ga0070689_100001847 3300005340 Bacteria 13635
36 Ga0070661_100027570 3300005344 Bacteria 4091
37 Ga0070692_10002225 3300005345 Bacteria 7434
38 Ga0070692_10010274 3300005345 Bacteria 4254
39 Ga0070692_10115887 3300005345 Bacteria 1488
40 Ga0070692_10229253 3300005345 Bacteria 1102
41 Ga0070669_100100934 3300005353 Bacteria 2177
42 Ga0070671_100010018 3300005355 Bacteria 7612
43 Ga0070673_100264048 3300005364 Bacteria 1505
44 Ga0070673_100348108 3300005364 Bacteria 1314
45 Ga0070673_100492367 3300005364 Bacteria 1108
46 Ga0070673_100568710 3300005364 Bacteria 1031
47 Ga0070688_100315753 3300005365 Bacteria 1134
48 Ga0070659_100002497 3300005366 Bacteria 13068
49 Ga0070703_10044058 3300005406 Bacteria 1402
50 Ga0070701_10019721 3300005438 Bacteria 3190
51 Ga0070705_100005101 3300005440 Bacteria 6384
52 Ga0070705_100473342 3300005440 Bacteria 945
53 Ga0070700_100000278 3300005441 Bacteria 27369
54 Ga0070700_100118151 3300005441 Unclassified 1773
55 Ga0070700_100351615 3300005441 Bacteria 1093
56 Ga0070694_100027669 3300005444 Bacteria 3685
57 Ga0070694_100034170 3300005444 Bacteria 3351
58 Ga0070694_100353714 3300005444 Bacteria 1139
59 Ga0070694_100621141 3300005444 Unclassified 872
60 Ga0070681_10002764 3300005458 Bacteria 16194
61 Ga0070681_10050439 3300005458 Bacteria 4152
62 Ga0068867_100048671 3300005459 Bacteria 3120
63 Ga0068867_100146968 3300005459 Bacteria 1848
64 Ga0068867_100169890 3300005459 Unclassified 1726
65 Ga0068867_100172863 3300005459 Bacteria 1712
66 Ga0068867_100199087 3300005459 Bacteria 1603
67 Ga0070685_10118192 3300005466 Bacteria 1643
68 Ga0070706_100000002 3300005467 Bacteria 326510
69 Ga0070706_100109299 3300005467 Bacteria 2573
70 Ga0070707_100256128 3300005468 Bacteria 1703
71 Ga0070698_100006293 3300005471 Bacteria 12897
72 Ga0070698_100018631 3300005471 Bacteria 7308
73 Ga0070698_100032523 3300005471 Bacteria 5402
74 Ga0070699_100017873 3300005518 Bacteria 6089
75 Ga0070699_100116537 3300005518 Bacteria 2348
76 Ga0070699_100464604 3300005518 Bacteria 1148
77 Ga0070679_100086293 3300005530 Bacteria 3125
78 Ga0070679_100088449 3300005530 Bacteria 3085
79 Ga0070697_100659077 3300005536 Bacteria 922
80 Ga0068853_100046331 3300005539 Bacteria 3728
81 Ga0068853_100047123 3300005539 Unclassified 3699
82 Ga0068853_100171117 3300005539 Bacteria 1965
83 Ga0068853_101241599 3300005539 Bacteria 720
84 Ga0070672_100221808 3300005543 Bacteria 1586
85 Ga0070686_100011538 3300005544 Bacteria 5014
86 Ga0070695_100054562 3300005545 Bacteria 2573
87 Ga0070695_100117394 3300005545 Bacteria 1815
88 Ga0070695_100150028 3300005545 Bacteria 1626
89 Ga0070695_100356253 3300005545 Unclassified 1098
90 Ga0070695_100445081 3300005545 Bacteria 991
91 Ga0070695_100528643 3300005545 Unclassified 916
92 Ga0070696_100181664 3300005546 Unclassified 1561
93 Ga0070696_100290869 3300005546 Bacteria 1248
94 Ga0070693_100036179 3300005547 Bacteria 2742
95 Ga0070693_100116471 3300005547 Bacteria 1652
96 Ga0070693_100155349 3300005547 Bacteria 1452
97 Ga0070693_100615586 3300005547 Bacteria 786
98 Ga0070665_101027839 3300005548 Unclassified 836
99 Ga0070704_100123323 3300005549 Bacteria 1995
100 Ga0070704_100129865 3300005549 Bacteria 1951
101 Ga0070704_100289337 3300005549 Bacteria 1361
102 Ga0070704_100606606 3300005549 Bacteria 962
103 Ga0068855_100233669 3300005563 Bacteria 2057
104 Ga0070664_100005385 3300005564 Bacteria 10273
105 Ga0068857_100001334 3300005577 Bacteria 19420
106 Ga0068857_100130153 3300005577 Bacteria 2269
107 Ga0068857_100385780 3300005577 Bacteria 1302
108 Ga0068854_100332155 3300005578 Unclassified 1239
109 Ga0068854_100362239 3300005578 Bacteria 1190
110 Ga0070702_100027462 3300005615 Bacteria 3071
111 Ga0070702_100041441 3300005615 Bacteria 2582
112 Ga0070702_100559132 3300005615 Unclassified 851
113 Ga0068859_100004884 3300005617 Bacteria 13652
114 Ga0068859_100017726 3300005617 Bacteria 7159
115 Ga0068859_100060217 3300005617 Bacteria 3826
116 Ga0068859_100069386 3300005617 Bacteria 3559
117 Ga0068859_100120595 3300005617 Bacteria 2689
118 Ga0068859_100131194 3300005617 Bacteria 2577
119 Ga0068859_100187676 3300005617 Bacteria 2151
120 Ga0068859_100187849 3300005617 Bacteria 2150
121 Ga0068859_100201998 3300005617 Bacteria 2072
122 Ga0068859_100319648 3300005617 Unclassified 1646
123 Ga0068859_101166524 3300005617 Bacteria 848
124 Ga0068864_100003399 3300005618 Bacteria 13154
125 Ga0068864_100020919 3300005618 Bacteria 5477
126 Ga0068864_100023146 3300005618 Bacteria 5216
127 Ga0068864_100080460 3300005618 Bacteria 2854
128 Ga0068861_100029392 3300005719 Bacteria 4021
129 Ga0068861_100096134 3300005719 Bacteria 2347
130 Ga0068851_10027747 3300005834 Bacteria 2792
131 Ga0068870_10003569 3300005840 Bacteria 6594
132 Ga0068863_100042835 3300005841 Bacteria 4300
133 Ga0068863_100065605 3300005841 Bacteria 3435
134 Ga0068863_100349911 3300005841 Bacteria 1439
135 Ga0068863_100473022 3300005841 Bacteria 1232
136 Ga0068858_100021302 3300005842 Bacteria 6055
137 Ga0068858_100025984 3300005842 Bacteria 5445
138 Ga0068858_100068936 3300005842 Bacteria 3278
139 Ga0068858_100078366 3300005842 Bacteria 3070
140 Ga0068858_100079203 3300005842 Bacteria 3053
141 Ga0068860_100009070 3300005843 Bacteria 9899
142 Ga0068860_100358291 3300005843 Bacteria 1437
143 Ga0068860_100604710 3300005843 Bacteria 1102
144 Ga0068860_101148650 3300005843 Bacteria 796
145 Ga0068862_100135688 3300005844 Bacteria 2180
146 Ga0068862_100373222 3300005844 Bacteria 1329
147 Ga0081455_10230110 3300005937 Bacteria 1368
148 Ga0081539_10000912 3300005985 Bacteria 55918
149 Ga0081539_10002816 3300005985 Bacteria 23236
150 Ga0081539_10061699 3300005985 Bacteria 2052
151 Ga0081539_10102455 3300005985 Bacteria 1456
152 Ga0070715_10000022 3300006163 Bacteria 118193
153 Ga0070716_100081982 3300006173 Unclassified 1928
154 Ga0097621_100003469 3300006237 Bacteria 10876
155 Ga0097621_100190999 3300006237 Bacteria 1774
156 Ga0068871_100001705 3300006358 Bacteria 14772
157 Ga0068871_100027952 3300006358 Bacteria 4416
158 Ga0075428_100099980 3300006844 Bacteria 3163
159 Ga0075431_100103072 3300006847 Bacteria 2945
160 Ga0075431_100160745 3300006847 Bacteria 2310
161 Ga0075433_10030102 3300006852 Bacteria 4630
162 Ga0075433_10151038 3300006852 Bacteria 2066
163 Ga0075433_10335118 3300006852 Bacteria 1337
164 Ga0075433_10470988 3300006852 Bacteria 1107
165 Ga0075434_100085614 3300006871 Bacteria 3151
166 Ga0075434_100150471 3300006871 Bacteria 2347
167 Ga0075434_100353436 3300006871 Bacteria 1490
168 Ga0075434_100600757 3300006871 Bacteria 1119
169 Ga0075434_101136623 3300006871 Unclassified 794
170 Ga0075429_100060463 3300006880 Bacteria 3300
171 Ga0075429_100209368 3300006880 Bacteria 1708
172 Ga0097620_100004884 3300006931 Bacteria 13652
173 Ga0097620_100017726 3300006931 Bacteria 7159
174 Ga0097620_100060217 3300006931 Bacteria 3826
175 Ga0097620_100069388 3300006931 Bacteria 3559
176 Ga0097620_100120595 3300006931 Bacteria 2689
177 Ga0097620_100131198 3300006931 Bacteria 2577
178 Ga0097620_100187676 3300006931 Bacteria 2151
179 Ga0097620_100187876 3300006931 Bacteria 2150
180 Ga0097620_100201989 3300006931 Bacteria 2072
181 Ga0097620_100319614 3300006931 Unclassified 1646
182 Ga0097620_100440247 3300006931 Bacteria 1399
183 Ga0097620_101166249 3300006931 Bacteria 848
184 Ga0105251_10023924 3300009011 Bacteria 3145
185 Ga0105251_10155218 3300009011 Bacteria 1033
186 Ga0105250_10058643 3300009092 Bacteria 1545
187 Ga0105240_10076039 3300009093 Bacteria 4141
188 Ga0105240_10987857 3300009093 Bacteria 901
189 Ga0111539_10000646 3300009094 Bacteria 45013
190 Ga0111539_10038433 3300009094 Bacteria 5772
191 Ga0111539_10504710 3300009094 Bacteria 1409
192 Ga0111539_11285414 3300009094 Unclassified 849
193 Ga0105247_10003890 3300009101 Bacteria 9648
194 Ga0105247_10052732 3300009101 Bacteria 2508
195 Ga0105247_10556719 3300009101 Bacteria 844
196 Ga0114129_10012499 3300009147 Bacteria 12087
197 Ga0114129_10026835 3300009147 Bacteria 8154
198 Ga0114129_10072766 3300009147 Bacteria 4791
199 Ga0114129_10163814 3300009147 Bacteria 3036
200 Ga0114129_10563495 3300009147 Unclassified 1480
201 Ga0105243_10428219 3300009148 Bacteria 1236
202 Ga0105243_10773030 3300009148 Unclassified 944
203 Ga0105241_10043919 3300009174 Bacteria 3386
204 Ga0105241_10081187 3300009174 Bacteria 2539
205 Ga0105241_10109786 3300009174 Bacteria 2206
206 Ga0105241_10129351 3300009174 Bacteria 2042
207 Ga0105241_10157128 3300009174 Bacteria 1866
208 Ga0105241_10206661 3300009174 Bacteria 1643
209 Ga0105241_10427250 3300009174 Bacteria 1167
210 Ga0105241_10442440 3300009174 Bacteria 1148
211 Ga0105241_10806696 3300009174 Unclassified 865
212 Ga0105241_10959405 3300009174 Bacteria 797
213 Ga0105242_10487944 3300009176 Bacteria 1169
214 Ga0105248_10026658 3300009177 Bacteria 6426
215 Ga0105248_10033009 3300009177 Bacteria 5782
216 Ga0105248_10059409 3300009177 Bacteria 4295
217 Ga0105248_10076054 3300009177 Bacteria 3774
218 Ga0105248_10315878 3300009177 Unclassified 1759
219 Ga0105237_10009251 3300009545 Bacteria 10563
220 Ga0105237_11097502 3300009545 Unclassified 802
221 Ga0105238_10153383 3300009551 Bacteria 2279
222 Ga0105249_10000227 3300009553 Bacteria 63667
223 Ga0105249_10014974 3300009553 Bacteria 6860
224 Ga0105249_10150833 3300009553 Bacteria 2238
225 Ga0105239_10369291 3300010375 Bacteria 1621
226 Ga0105239_10778508 3300010375 Bacteria 1096
227 Ga0105239_11104540 3300010375 Unclassified 913
228 Ga0105246_10015083 3300011119 Bacteria 4871
229 Ga0105246_10814071 3300011119 Unclassified 830
230 Ga0157373_10021668 3300013100 Bacteria 4663
231 Ga0157373_10067591 3300013100 Unclassified 2527
232 Ga0157373_10511188 3300013100 Bacteria 868
233 Ga0163162_10000047 3300013306 Bacteria 123541
234 Ga0163162_10010186 3300013306 Bacteria 9131
235 Ga0163162_10010314 3300013306 Bacteria 9080
236 Ga0163162_10051920 3300013306 Bacteria 4116
237 Ga0163162_10309107 3300013306 Unclassified 1713
238 Ga0163162_10337263 3300013306 Bacteria 1640
239 Ga0163162_10703977 3300013306 Unclassified 1132
240 Ga0157372_10082478 3300013307 Bacteria 3640
241 Ga0157372_10091285 3300013307 Bacteria 3464
242 Ga0157372_10168201 3300013307 Bacteria 2536
243 Ga0157375_10012145 3300013308 Bacteria 7632
244 Ga0157375_10469409 3300013308 Bacteria 1424
245 Ga0157375_10619769 3300013308 Bacteria 1240
246 Ga0163163_10001302 3300014325 Bacteria 21073
247 Ga0163163_10023488 3300014325 Bacteria 5852
248 Ga0163163_10143687 3300014325 Bacteria 2429
249 Ga0163163_10245518 3300014325 Bacteria 1841
250 Ga0163163_10396307 3300014325 Bacteria 1438
251 Ga0157380_10386827 3300014326 Unclassified 1322
252 Ga0157376_10783775 3300014969 Bacteria 965
253 Ga0207656_10064504 3300025321 Bacteria 1614
254 Ga0207653_10011648 3300025885 Bacteria 2744
255 Ga0207682_10036998 3300025893 Bacteria 1977
256 Ga0207710_10002205 3300025900 Bacteria 9152
257 Ga0207710_10087695 3300025900 Bacteria 1452
258 Ga0207710_10160359 3300025900 Bacteria 1095
259 Ga0207647_10004601 3300025904 Bacteria 10216
260 Ga0207647_10265929 3300025904 Unclassified 981
261 Ga0207685_10000015 3300025905 Bacteria 170813
262 Ga0207645_10072115 3300025907 Bacteria 2210
263 Ga0207643_10024676 3300025908 Bacteria 3317
264 Ga0207643_10027683 3300025908 Bacteria 3144
265 Ga0207684_10000076 3300025910 Bacteria 183107
266 Ga0207654_10051217 3300025911 Bacteria 2376
267 Ga0207654_10162765 3300025911 Bacteria 1443
268 Ga0207654_10201102 3300025911 Bacteria 1312
269 Ga0207654_10242728 3300025911 Bacteria 1204
270 Ga0207654_10462980 3300025911 Unclassified 891
271 Ga0207707_10029691 3300025912 Bacteria 4781
272 Ga0207695_10775311 3300025913 Bacteria 839
273 Ga0207671_10002962 3300025914 Bacteria 17467
274 Ga0207660_10050528 3300025917 Bacteria 2953
275 Ga0207662_10082121 3300025918 Bacteria 1968
276 Ga0207662_10110125 3300025918 Bacteria 1716
277 Ga0207657_10032308 3300025919 Bacteria 4731
278 Ga0207657_10305141 3300025919 Bacteria 1261
279 Ga0207649_10008384 3300025920 Bacteria 5633
280 Ga0207649_10260873 3300025920 Bacteria 1252
281 Ga0207649_10378504 3300025920 Bacteria 1054
282 Ga0207652_10111918 3300025921 Bacteria 2422
283 Ga0207652_10246913 3300025921 Unclassified 1609
284 Ga0207646_10248929 3300025922 Bacteria 1605
285 Ga0207681_10059187 3300025923 Bacteria 2625
286 Ga0207694_10022121 3300025924 Bacteria 4821
287 Ga0207694_10064143 3300025924 Bacteria 2863
288 Ga0207694_10238506 3300025924 Bacteria 1486
289 Ga0207650_10000027 3300025925 Bacteria 257466
290 Ga0207650_10166331 3300025925 Bacteria 1750
291 Ga0207650_10169062 3300025925 Bacteria 1737
292 Ga0207650_10258040 3300025925 Bacteria 1413
293 Ga0207690_10202143 3300025932 Bacteria 1510
294 Ga0207709_10180511 3300025935 Bacteria 1490
295 Ga0207709_10236779 3300025935 Unclassified 1325
296 Ga0207670_10000488 3300025936 Bacteria 21872
297 Ga0207665_10093265 3300025939 Unclassified 2090
298 Ga0207691_10346087 3300025940 Bacteria 1272
299 Ga0207711_10073293 3300025941 Unclassified 2976
300 Ga0207711_10101532 3300025941 Bacteria 2545
301 Ga0207711_10120351 3300025941 Bacteria 2343
302 Ga0207711_10122249 3300025941 Bacteria 2325
303 Ga0207711_10666072 3300025941 Unclassified 971
304 Ga0207711_10675426 3300025941 Unclassified 963
305 Ga0207689_10041298 3300025942 Unclassified 3817
306 Ga0207689_10201841 3300025942 Unclassified 1641
307 Ga0207689_10424622 3300025942 Unclassified 1109
308 Ga0207689_10443348 3300025942 Bacteria 1085
309 Ga0207679_10504130 3300025945 Bacteria 1080
310 Ga0207667_10620648 3300025949 Unclassified 1089
311 Ga0207712_10000209 3300025961 Bacteria 58339
312 Ga0207712_10006975 3300025961 Bacteria 7125
313 Ga0207668_10020083 3300025972 Bacteria 4237
314 Ga0207677_10289782 3300026023 Bacteria 1348
315 Ga0207703_10022601 3300026035 Bacteria 4935
316 Ga0207703_10062219 3300026035 Bacteria 3058
317 Ga0207703_10192655 3300026035 Bacteria 1807
318 Ga0207703_10202367 3300026035 Bacteria 1765
319 Ga0207639_10005370 3300026041 Bacteria 8660
320 Ga0207639_10053593 3300026041 Bacteria 3078
321 Ga0207639_10272997 3300026041 Unclassified 1484
322 Ga0207708_10000807 3300026075 Bacteria 23594
323 Ga0207708_10013600 3300026075 Bacteria 6082
324 Ga0207708_10026068 3300026075 Bacteria 4423
325 Ga0207708_10227402 3300026075 Bacteria 1497
326 Ga0207641_10061776 3300026088 Bacteria 3195
327 Ga0207641_10082822 3300026088 Bacteria 2788
328 Ga0207641_10115928 3300026088 Bacteria 2383
329 Ga0207641_10871913 3300026088 Bacteria 893
330 Ga0207648_10043812 3300026089 Bacteria 3928
331 Ga0207648_10119126 3300026089 Bacteria 2320
332 Ga0207648_10242555 3300026089 Bacteria 1605
333 Ga0207676_10063960 3300026095 Bacteria 2923
334 Ga0207676_10088321 3300026095 Bacteria 2537
335 Ga0207676_10104058 3300026095 Unclassified 2360
336 Ga0207676_10119518 3300026095 Unclassified 2219
337 Ga0207676_10491341 3300026095 Bacteria 1164
338 Ga0207676_10679214 3300026095 Bacteria 996
339 Ga0207676_10899920 3300026095 Bacteria 868
340 Ga0207674_10000392 3300026116 Bacteria 56723
341 Ga0207674_10129817 3300026116 Bacteria 2484
342 Ga0207674_10149514 3300026116 Bacteria 2293
343 Ga0207674_10310125 3300026116 Bacteria 1527
344 Ga0207674_10478212 3300026116 Bacteria 1204
345 Ga0207675_100044950 3300026118 Bacteria 4126
346 Ga0207675_100045831 3300026118 Bacteria 4084
347 Ga0207675_100116685 3300026118 Bacteria 2523
348 Ga0207428_10017526 3300027907 Bacteria 6142
349 Ga0268265_10283950 3300028380 Bacteria 1482
350 Ga0268264_10196479 3300028381 Bacteria 1842
351 Ga0268264_10323615 3300028381 Unclassified 1459
352 Ga0268264_10380371 3300028381 Bacteria 1352
353 Ga0268264_10582179 3300028381 Bacteria 1101
354 Ga0268264_10887478 3300028381 Unclassified 894
355 Ga0307408_100104486 3300031548 Bacteria 2164
356 Ga0307405_10035160 3300031731 Bacteria 2989
357 Ga0307405_10125098 3300031731 Unclassified 1766
358 Ga0307413_10122038 3300031824 Bacteria 1767
359 Ga0307406_10194578 3300031901 Unclassified 1487
360 Ga0307406_10584992 3300031901 Bacteria 918
361 Ga0307407_10314758 3300031903 Bacteria 1096
362 Ga0307412_10123024 3300031911 Bacteria 1871
363 Ga0307409_100160784 3300031995 Bacteria 1964
364 Ga0307409_100338148 3300031995 Unclassified 1415
365 Ga0307416_100139392 3300032002 Bacteria 2201
366 Ga0307416_100157209 3300032002 Bacteria 2095
367 Ga0307416_100437739 3300032002 Bacteria 1356
368 Ga0307414_10000777 3300032004 Bacteria 16349
369 Ga0307414_10033344 3300032004 Bacteria 3403
370 Ga0307411_10179093 3300032005 Bacteria 1607
371 Ga0307415_100009822 3300032126 Bacteria 5389
372 Ga0307415_100084524 3300032126 Bacteria 2277
373 Ga0307415_100178234 3300032126 Bacteria 1665
374 Ga0373949_0090969 3300035090 Bacteria 825
375 Ga0373951_0066989 3300035091 Unclassified 908
376 Ga0373939_0044731 3300035114 Bacteria 1349
377 Ga0373941_0010563 3300035115 Unclassified 2362
378 Ga0373941_0107207 3300035115 Bacteria 980
379 Ga0373961_0042013 3300035241 Bacteria 1324
380 Ga0373931_0171242 3300035691 Bacteria 1280
381 Ga0242419_005196 3300038698 Unclassified 923
382 Ga0242422_00110 3300038699 Bacteria 4026
383 Ga0242420_008859 3300038996 Bacteria 1641
384 Ga0242420_012780 3300038996 Bacteria 1425
385 Ga0439435_0046598 3300042436 Bacteria 1229
386 Ga0451576_0285594 3300045051 Unclassified 1725
387 Ga0496104_0140313 3300048907 Bacteria 2322
388 Ga0496106_0062994 3300048909 Bacteria 2817
389 Ga0496107_0287659 3300048910 Bacteria 1223
390 Ga0496108_0076392 3300048911 Bacteria 2831
391 Ga0496112_0259246 3300048915 Unclassified 1688
392 Ga0496112_0919998 3300048915 Bacteria 796
393 Ga0496113_0105443 3300048916 Bacteria 2189
394 Ga0501291_015153 3300049514 Bacteria 1162
395 Ga0501291_026641 3300049514 Unclassified 953
396 Ga0501295_016027 3300049518 Bacteria 1293
397 Ga0501296_000296 3300049519 Bacteria 5131
398 Ga0501296_003626 3300049519 Bacteria 1653
399 Ga0501298_004705 3300049521 Bacteria 2162
400 Ga0501298_013064 3300049521 Unclassified 1464
401 Ga0501298_033556 3300049521 Unclassified 1017
402 Ga0501300_017290 3300049523 Bacteria 1053
403 Ga0501303_012236 3300049526 Bacteria 825
404 Ga0501038_0003043 3300049574 Bacteria 15637
405 Ga0501198_013465 3300049649 Bacteria 1238
406 Ga0501201_017307 3300049651 Bacteria 743
407 Ga0501202_014097 3300049652 Bacteria 1527
408 Ga0501202_017893 3300049652 Bacteria 1388
409 Ga0501217_032732 3300049661 Bacteria 1288
410 Ga0501223_004967 3300049663 Bacteria 2815
411 Ga0501223_017544 3300049663 Bacteria 1412
412 Ga0501224_010056 3300049664 Bacteria 1386
413 Ga0501224_015440 3300049664 Bacteria 1132
414 Ga0501224_020501 3300049664 Bacteria 985
415 Ga0501227_003230 3300049665 Bacteria 3540
416 Ga0501227_004338 3300049665 Bacteria 3050
417 Ga0501233_004590 3300049668 Bacteria 2538
418 Ga0501233_018121 3300049668 Bacteria 1478
419 Ga0501233_039384 3300049668 Unclassified 1104
420 Ga0501233_058518 3300049668 Unclassified 951
421 Ga0501235_015911 3300049669 Bacteria 1660
422 Ga0501235_024126 3300049669 Bacteria 1358
423 Ga0501235_063743 3300049669 Unclassified 865
424 Ga0501239_005572 3300049672 Bacteria 1272
425 Ga0501240_006020 3300049673 Bacteria 1477
426 Ga0501249_024214 3300049679 Bacteria 1337
427 Ga0501249_050183 3300049679 Unclassified 957
428 Ga0501257_003836 3300049686 Bacteria 3253
429 Ga0501219_006230 3300049703 Unclassified 854
430 Ga0501221_035637 3300049704 Unclassified 1062
431 Ga0501225_0001263 3300049705 Bacteria 7854
432 Ga0501225_0030751 3300049705 Bacteria 1477
433 Ga0501234_004665 3300049707 Bacteria 2152
434 Ga0501234_013310 3300049707 Unclassified 1291
435 Ga0501272_001293 3300049769 Bacteria 2355
436 Ga0501272_008829 3300049769 Unclassified 1109
437 Ga0501283_000927 3300049779 Bacteria 3893
438 nmdc:mga05p37_1328297_c1 3300050507 Bacteria 730
439 nmdc:mga05p37_176317_c1 3300050507 Bacteria 2604
440 nmdc:mga05p37_229615_c1 3300050507 Bacteria 2237
441 nmdc:mga05p37_257843_c1 3300050507 Bacteria 2089
442 nmdc:mga05p37_406458_c1 3300050507 Bacteria 1588
443 nmdc:mga05p37_49936_c1 3300050507 Bacteria 5145
444 nmdc:mga05p37_771530_c1 3300050507 Unclassified 1056
445 nmdc:mga09592_57028_c1 3300050508 Bacteria 3300
446 nmdc:mga0qj67_134048_c1 3300050509 Bacteria 2007
447 nmdc:mga06r32_113644_c1 3300050510 Bacteria 2665
448 nmdc:mga06r32_154737_c1 3300050510 Bacteria 2273
449 nmdc:mga08y16_12562_c1 3300050511 Bacteria 8911
450 nmdc:mga0n895_1049387_c1 3300050512 Unclassified 794
451 nmdc:mga0n895_221524_c1 3300050512 Bacteria 1921
452 nmdc:mga0n895_297491_c1 3300050512 Bacteria 1636
453 nmdc:mga0n895_29889_c1 3300050512 Bacteria 5201
454 nmdc:mga0n895_333211_c1 3300050512 Bacteria 1537
455 nmdc:mga0rr50_12603_c1 3300050513 Bacteria 5473
456 nmdc:mga0a205_333337_c1 3300050515 Unclassified 1387
457 nmdc:mga0a205_471152_c1 3300050515 Bacteria 1115
458 nmdc:mga0a205_49699_c1 3300050515 Bacteria 4049
459 nmdc:mga0a205_59343_c1 3300050515 Bacteria 3696
460 Ga0070702_100145491
461 SwRhRL2b_contig_2994234
462 MBSR1b_contig_231005
463 JGI24736J21556_1025646
464 JGI24751J29686_10000072
465 Ga0065714_10002183
466 Ga0065704_10011392
467 Ga0065712_10000030
468 Ga0065712_10013836
469 Ga0065712_10014704
470 Ga0065712_10069428
471 Ga0065715_10089414
472 Ga0065715_10102791
473 Ga0065715_10139832
474 Ga0065707_10001869
475 Ga0065707_10042641
476 Ga0065707_10144825
477 Ga0065707_10169903
478 Ga0065707_10268869
479 Ga0070690_100002388
480 Ga0070670_100000057
481 Ga0070670_100013161
482 Ga0070670_100086225
483 Ga0070670_100103897
484 Ga0070670_100107287
485 Ga0068869_100287582
486 Ga0068869_100291042
487 Ga0070666_10053830
488 Ga0070666_10388450
489 Ga0070680_100164120
490 Ga0070680_100299698
491 Ga0070682_100005296
492 Ga0070682_100155424
493 Ga0068868_100330975
494 Ga0070689_100001847
495 Ga0070661_100027570
496 Ga0070692_10002225
497 Ga0070692_10010274
498 Ga0070692_10115887
499 Ga0070692_10229253
500 Ga0070669_100100934
501 Ga0070671_100010018
502 Ga0070673_100264048
503 Ga0070673_100348108
504 Ga0070673_100492367
505 Ga0070673_100568710
506 Ga0070688_100315753
507 Ga0070659_100002497
508 Ga0070703_10044058
509 Ga0070701_10019721
510 Ga0070705_100005101
511 Ga0070705_100473342
512 Ga0070700_100000278
513 Ga0070700_100118151
514 Ga0070700_100351615
515 Ga0070694_100027669
516 Ga0070694_100034170
517 Ga0070694_100353714
518 Ga0070694_100621141
519 Ga0070681_10002764
520 Ga0070681_10050439
521 Ga0068867_100048671
522 Ga0068867_100146968
523 Ga0068867_100169890
524 Ga0068867_100172863
525 Ga0068867_100199087
526 Ga0070685_10118192
527 Ga0070706_100000002
528 Ga0070706_100109299
529 Ga0070707_100256128
530 Ga0070698_100006293
531 Ga0070698_100018631
532 Ga0070698_100032523
533 Ga0070699_100017873
534 Ga0070699_100116537
535 Ga0070699_100464604
536 Ga0070679_100086293
537 Ga0070679_100088449
538 Ga0070697_100659077
539 Ga0068853_100046331
540 Ga0068853_100047123
541 Ga0068853_100171117
542 Ga0068853_101241599
543 Ga0070672_100221808
544 Ga0070686_100011538
545 Ga0070695_100054562
546 Ga0070695_100117394
547 Ga0070695_100150028
548 Ga0070695_100356253
549 Ga0070695_100445081
550 Ga0070695_100528643
551 Ga0070696_100181664
552 Ga0070696_100290869
553 Ga0070693_100036179
554 Ga0070693_100116471
555 Ga0070693_100155349
556 Ga0070693_100615586
557 Ga0070665_101027839
558 Ga0070704_100123323
559 Ga0070704_100129865
560 Ga0070704_100289337
561 Ga0070704_100606606
562 Ga0068855_100233669
563 Ga0070664_100005385
564 Ga0068857_100001334
565 Ga0068857_100130153
566 Ga0068857_100385780
567 Ga0068854_100332155
568 Ga0068854_100362239
569 Ga0070702_100027462
570 Ga0070702_100041441
571 Ga0070702_100559132
572 Ga0068859_100004884
573 Ga0068859_100017726
574 Ga0068859_100060217
575 Ga0068859_100069386
576 Ga0068859_100120595
577 Ga0068859_100131194
578 Ga0068859_100187676
579 Ga0068859_100187849
580 Ga0068859_100201998
581 Ga0068859_100319648
582 Ga0068859_101166524
583 Ga0068864_100003399
584 Ga0068864_100020919
585 Ga0068864_100023146
586 Ga0068864_100080460
587 Ga0068861_100029392
588 Ga0068861_100096134
589 Ga0068851_10027747
590 Ga0068870_10003569
591 Ga0068863_100042835
592 Ga0068863_100065605
593 Ga0068863_100349911
594 Ga0068863_100473022
595 Ga0068858_100021302
596 Ga0068858_100025984
597 Ga0068858_100068936
598 Ga0068858_100078366
599 Ga0068858_100079203
600 Ga0068860_100009070
601 Ga0068860_100358291
602 Ga0068860_100604710
603 Ga0068860_101148650
604 Ga0068862_100135688
605 Ga0068862_100373222
606 Ga0081455_10230110
607 Ga0081539_10000912
608 Ga0081539_10002816
609 Ga0081539_10061699
610 Ga0081539_10102455
611 Ga0070715_10000022
612 Ga0070716_100081982
613 Ga0097621_100003469
614 Ga0097621_100190999
615 Ga0068871_100001705
616 Ga0068871_100027952
617 Ga0075428_100099980
618 Ga0075431_100103072
619 Ga0075431_100160745
620 Ga0075433_10030102
621 Ga0075433_10151038
622 Ga0075433_10335118
623 Ga0075433_10470988
624 Ga0075434_100085614
625 Ga0075434_100150471
626 Ga0075434_100353436
627 Ga0075434_100600757
628 Ga0075434_101136623
629 Ga0075429_100060463
630 Ga0075429_100209368
631 Ga0097620_100004884
632 Ga0097620_100017726
633 Ga0097620_100060217
634 Ga0097620_100069388
635 Ga0097620_100120595
636 Ga0097620_100131198
637 Ga0097620_100187676
638 Ga0097620_100187876
639 Ga0097620_100201989
640 Ga0097620_100319614
641 Ga0097620_100440247
642 Ga0097620_101166249
643 Ga0105251_10023924
644 Ga0105251_10155218
645 Ga0105250_10058643
646 Ga0105240_10076039
647 Ga0105240_10987857
648 Ga0111539_10000646
649 Ga0111539_10038433
650 Ga0111539_10504710
651 Ga0111539_11285414
652 Ga0105247_10003890
653 Ga0105247_10052732
654 Ga0105247_10556719
655 Ga0114129_10012499
656 Ga0114129_10026835
657 Ga0114129_10072766
658 Ga0114129_10163814
659 Ga0114129_10563495
660 Ga0105243_10428219
661 Ga0105243_10773030
662 Ga0105241_10043919
663 Ga0105241_10081187
664 Ga0105241_10109786
665 Ga0105241_10129351
666 Ga0105241_10157128
667 Ga0105241_10206661
668 Ga0105241_10427250
669 Ga0105241_10442440
670 Ga0105241_10806696
671 Ga0105241_10959405
672 Ga0105242_10487944
673 Ga0105248_10026658
674 Ga0105248_10033009
675 Ga0105248_10059409
676 Ga0105248_10076054
677 Ga0105248_10315878
678 Ga0105237_10009251
679 Ga0105237_11097502
680 Ga0105238_10153383
681 Ga0105249_10000227
682 Ga0105249_10014974
683 Ga0105249_10150833
684 Ga0105239_10369291
685 Ga0105239_10778508
686 Ga0105239_11104540
687 Ga0105246_10015083
688 Ga0105246_10814071
689 Ga0157373_10021668
690 Ga0157373_10067591
691 Ga0157373_10511188
692 Ga0163162_10000047
693 Ga0163162_10010186
694 Ga0163162_10010314
695 Ga0163162_10051920
696 Ga0163162_10309107
697 Ga0163162_10337263
698 Ga0163162_10703977
699 Ga0157372_10082478
700 Ga0157372_10091285
701 Ga0157372_10168201
702 Ga0157375_10012145
703 Ga0157375_10469409
704 Ga0157375_10619769
705 Ga0163163_10001302
706 Ga0163163_10023488
707 Ga0163163_10143687
708 Ga0163163_10245518
709 Ga0163163_10396307
710 Ga0157380_10386827
711 Ga0157376_10783775
712 Ga0207656_10064504
713 Ga0207653_10011648
714 Ga0207682_10036998
715 Ga0207710_10002205
716 Ga0207710_10087695
717 Ga0207710_10160359
718 Ga0207647_10004601
719 Ga0207647_10265929
720 Ga0207685_10000015
721 Ga0207645_10072115
722 Ga0207643_10024676
723 Ga0207643_10027683
724 Ga0207684_10000076
725 Ga0207654_10051217
726 Ga0207654_10162765
727 Ga0207654_10201102
728 Ga0207654_10242728
729 Ga0207654_10462980
730 Ga0207707_10029691
731 Ga0207695_10775311
732 Ga0207671_10002962
733 Ga0207660_10050528
734 Ga0207662_10082121
735 Ga0207662_10110125
736 Ga0207657_10032308
737 Ga0207657_10305141
738 Ga0207649_10008384
739 Ga0207649_10260873
740 Ga0207649_10378504
741 Ga0207652_10111918
742 Ga0207652_10246913
743 Ga0207646_10248929
744 Ga0207681_10059187
745 Ga0207694_10022121
746 Ga0207694_10064143
747 Ga0207694_10238506
748 Ga0207650_10000027
749 Ga0207650_10166331
750 Ga0207650_10169062
751 Ga0207650_10258040
752 Ga0207690_10202143
753 Ga0207709_10180511
754 Ga0207709_10236779
755 Ga0207670_10000488
756 Ga0207665_10093265
757 Ga0207691_10346087
758 Ga0207711_10073293
759 Ga0207711_10101532
760 Ga0207711_10120351
761 Ga0207711_10122249
762 Ga0207711_10666072
763 Ga0207711_10675426
764 Ga0207689_10041298
765 Ga0207689_10201841
766 Ga0207689_10424622
767 Ga0207689_10443348
768 Ga0207679_10504130
769 Ga0207667_10620648
770 Ga0207712_10000209
771 Ga0207712_10006975
772 Ga0207668_10020083
773 Ga0207677_10289782
774 Ga0207703_10022601
775 Ga0207703_10062219
776 Ga0207703_10192655
777 Ga0207703_10202367
778 Ga0207639_10005370
779 Ga0207639_10053593
780 Ga0207639_10272997
781 Ga0207708_10000807
782 Ga0207708_10013600
783 Ga0207708_10026068
784 Ga0207708_10227402
785 Ga0207641_10061776
786 Ga0207641_10082822
787 Ga0207641_10115928
788 Ga0207641_10871913
789 Ga0207648_10043812
790 Ga0207648_10119126
791 Ga0207648_10242555
792 Ga0207676_10063960
793 Ga0207676_10088321
794 Ga0207676_10104058
795 Ga0207676_10119518
796 Ga0207676_10491341
797 Ga0207676_10679214
798 Ga0207676_10899920
799 Ga0207674_10000392
800 Ga0207674_10129817
801 Ga0207674_10149514
802 Ga0207674_10310125
803 Ga0207674_10478212
804 Ga0207675_100044950
805 Ga0207675_100045831
806 Ga0207675_100116685
807 Ga0207428_10017526
808 Ga0268265_10283950
809 Ga0268264_10196479
810 Ga0268264_10323615
811 Ga0268264_10380371
812 Ga0268264_10582179
813 Ga0268264_10887478
814 Ga0307408_100104486
815 Ga0307405_10035160
816 Ga0307405_10125098
817 Ga0307413_10122038
818 Ga0307406_10194578
819 Ga0307406_10584992
820 Ga0307407_10314758
821 Ga0307412_10123024
822 Ga0307409_100160784
823 Ga0307409_100338148
824 Ga0307416_100139392
825 Ga0307416_100157209
826 Ga0307416_100437739
827 Ga0307414_10000777
828 Ga0307414_10033344
829 Ga0307411_10179093
830 Ga0307415_100009822
831 Ga0307415_100084524
832 Ga0307415_100178234
833 Ga0373949_0090969
834 Ga0373951_0066989
835 Ga0373939_0044731
836 Ga0373941_0010563
837 Ga0373941_0107207
838 Ga0373961_0042013
839 Ga0373931_0171242
840 Ga0242419_005196
841 Ga0242422_00110
842 Ga0242420_008859
843 Ga0242420_012780
844 Ga0439435_0046598
845 Ga0451576_0285594
846 Ga0496104_0140313
847 Ga0496106_0062994
848 Ga0496107_0287659
849 Ga0496108_0076392
850 Ga0496112_0259246
851 Ga0496112_0919998
852 Ga0496113_0105443
853 Ga0501291_015153
854 Ga0501291_026641
855 Ga0501295_016027
856 Ga0501296_000296
857 Ga0501296_003626
858 Ga0501298_004705
859 Ga0501298_013064
860 Ga0501298_033556
861 Ga0501300_017290
862 Ga0501303_012236
863 Ga0501038_0003043
864 Ga0501198_013465
865 Ga0501201_017307
866 Ga0501202_014097
867 Ga0501202_017893
868 Ga0501217_032732
869 Ga0501223_004967
870 Ga0501223_017544
871 Ga0501224_010056
872 Ga0501224_015440
873 Ga0501224_020501
874 Ga0501227_003230
875 Ga0501227_004338
876 Ga0501233_004590
877 Ga0501233_018121
878 Ga0501233_039384
879 Ga0501233_058518
880 Ga0501235_015911
881 Ga0501235_024126
882 Ga0501235_063743
883 Ga0501239_005572
884 Ga0501240_006020
885 Ga0501249_024214
886 Ga0501249_050183
887 Ga0501257_003836
888 Ga0501219_006230
889 Ga0501221_035637
890 Ga0501225_0001263
891 Ga0501225_0030751
892 Ga0501234_004665
893 Ga0501234_013310
894 Ga0501272_001293
895 Ga0501272_008829
896 Ga0501283_000927
897 nmdc:mga05p37_1328297_c1
898 nmdc:mga05p37_176317_c1
899 nmdc:mga05p37_229615_c1
900 nmdc:mga05p37_257843_c1
901 nmdc:mga05p37_406458_c1
902 nmdc:mga05p37_49936_c1
903 nmdc:mga05p37_771530_c1
904 nmdc:mga09592_57028_c1
905 nmdc:mga0qj67_134048_c1
906 nmdc:mga06r32_113644_c1
907 nmdc:mga06r32_154737_c1
908 nmdc:mga08y16_12562_c1
909 nmdc:mga0n895_1049387_c1
910 nmdc:mga0n895_221524_c1
911 nmdc:mga0n895_297491_c1
912 nmdc:mga0n895_29889_c1
913 nmdc:mga0n895_333211_c1
914 nmdc:mga0rr50_12603_c1
915 nmdc:mga0a205_333337_c1
916 nmdc:mga0a205_471152_c1
917 nmdc:mga0a205_49699_c1
918 nmdc:mga0a205_59343_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00625

Guanylate_kin

Guanylate kinase

20

201

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7yki-assembly1.cif.gz_A crystal structure of magi2 pdz0-gk domain in complex with phospho-sapap1 gbr3 peptide 0.9665 52 101
2f3t-assembly1.cif.gz_C crystal structure of e.coli guanylate kinase in complex with ganciclovir monophosphate 0.8724 20 219
1z8f-assembly1.cif.gz_A guanylate kinase double mutant a58c, t157c from mycobacterium tuberculosis (rv1389) 0.8721 21 198
1znx-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis guanylate kinase in complex with gmp 0.8719 21 198
3ney-assembly5.cif.gz_F crystal structure of the kinase domain of mpp1/p55 0.8665 21 197
ID Description Score Start End Superfamily
af_Q94JM2_119_167_3.30.63.10 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.989 52 99 3.30.63.10
af_Q2QPW1_160_210_3.30.63.10 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9834 52 101 3.30.63.10
3neyE02 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9717 50 106 3.30.63.10
af_Q5TCQ9_142_196_3.30.63.10 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9687 52 101 3.30.63.10
1s96B02 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9638 52 106 3.30.63.10
ID Description Score Start End GO Terms
AF-A0A183DLB7-F1-model_v4 Guanylate kinase-like domain-containing protein 0.9389 50 107
AF-A0A091NKX5-F1-model_v4 55 kDa erythrocyte membrane protein 0.9264 30 129
AF-A0A5F5XH55-F1-model_v4 55 kDa erythrocyte membrane protein (Membrane protein, palmitoylated 1) 0.9108 17 119 GO:0005102
GO:0005886
GO:0005911
GO:0032420
AF-A0A2K9P5S6-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9057 18 202 GO:0004385
GO:0005524
GO:0005829
AF-A0A661LQU0-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9023 20 142 GO:0004385
GO:0005524
GO:0005829

Map