F448323

General Info

Members Datasets Scaffolds Average Seq Length
459 237 918 135

Family's Representative Sequence

Representative Sequence 3300005546|Ga0070696_100465472|Ga0070696_1004654722
Length 166
Sequence MCTSSAVGCGIMSRTAGLDNYPLLSYCPMTVPMMFQLNFKSGKAVYLQVVEQVRVAVASGTLHAGDALPSIRPLAEQLRVNRNTIAKAYTELESEGIIESIAGKGCFVRANNTPFKKEVRRKLLAESIDLAVVHAHHLQIDKADFLALAEERFTAFEHKRARSSQA

Samples

Sample ID Description Type Environment
1 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
84 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
159 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
160 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
161 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
162 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
166 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
174 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
175 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
176 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
177 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
178 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
179 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
183 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
184 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
185 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
186 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
187 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
188 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
189 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
190 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
191 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
192 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
193 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
194 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
195 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
196 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
199 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
200 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
201 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
202 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
203 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
204 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
205 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
216 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
219 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
220 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
223 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
224 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
225 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
226 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
234 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
235 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
236 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
237 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.44
Nodule 0
Rhizoplane 1.31
Rhizosphere 98.26
Stem 0
Stem Tuber 0
Unclassified 15.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070696_100465472 3300005546 Unclassified 1000
2 MRS1b_contig_633322 2162886011 Bacteria 912
3 MBSR1b_contig_12402573 2162886012 Bacteria 1068
4 MBSR1b_contig_9886596 2162886012 Bacteria 1013
5 JGI24751J29686_10027666 3300002459 Bacteria 1178
6 Ga0065714_10200187 3300005288 Bacteria 898
7 Ga0065712_10109598 3300005290 Bacteria 1852
8 Ga0065712_10149291 3300005290 Bacteria 1383
9 Ga0065712_10281014 3300005290 Bacteria 890
10 Ga0065715_10102415 3300005293 Bacteria 3102
11 Ga0065715_10535170 3300005293 Bacteria 752
12 Ga0065707_10032474 3300005295 Bacteria 1699
13 Ga0065707_10279315 3300005295 Bacteria 1052
14 Ga0065707_10431378 3300005295 Bacteria 820
15 Ga0070676_10007547 3300005328 Bacteria 5842
16 Ga0070690_100154010 3300005330 Bacteria 1570
17 Ga0070670_100003424 3300005331 Bacteria 13165
18 Ga0070670_100009179 3300005331 Bacteria 8455
19 Ga0070677_10404964 3300005333 Bacteria 720
20 Ga0068869_100383679 3300005334 Bacteria 1152
21 Ga0070666_10021934 3300005335 Bacteria 4142
22 Ga0070666_10059240 3300005335 Bacteria 2590
23 Ga0070682_100288823 3300005337 Bacteria 1199
24 Ga0068868_100893935 3300005338 Bacteria 807
25 Ga0070660_100138002 3300005339 Bacteria 1955
26 Ga0070660_100497561 3300005339 Bacteria 1014
27 Ga0070689_100008481 3300005340 Bacteria 7242
28 Ga0070689_100024511 3300005340 Bacteria 4526
29 Ga0070689_100069931 3300005340 Bacteria 2739
30 Ga0070689_100204255 3300005340 Unclassified 1614
31 Ga0070689_101132604 3300005340 Bacteria 700
32 Ga0070691_10734248 3300005341 Bacteria 596
33 Ga0070687_100004779 3300005343 Bacteria 5423
34 Ga0070661_101327248 3300005344 Bacteria 604
35 Ga0070692_10188958 3300005345 Bacteria 1199
36 Ga0070668_100033713 3300005347 Bacteria 3901
37 Ga0070668_100936657 3300005347 Bacteria 776
38 Ga0070668_101046884 3300005347 Bacteria 735
39 Ga0070668_102017517 3300005347 Unclassified 532
40 Ga0070669_100111046 3300005353 Bacteria 2080
41 Ga0070669_101063823 3300005353 Unclassified 696
42 Ga0070675_100119030 3300005354 Bacteria 2243
43 Ga0070675_100208697 3300005354 Bacteria 1697
44 Ga0070675_100355449 3300005354 Unclassified 1300
45 Ga0070675_100417222 3300005354 Unclassified 1200
46 Ga0070675_100558586 3300005354 Bacteria 1036
47 Ga0070671_100027966 3300005355 Bacteria 4643
48 Ga0070674_100026858 3300005356 Bacteria 3766
49 Ga0070674_100333641 3300005356 Bacteria 1219
50 Ga0070674_100562832 3300005356 Unclassified 958
51 Ga0070673_100030094 3300005364 Bacteria 4057
52 Ga0070673_100392771 3300005364 Unclassified 1239
53 Ga0070673_102347472 3300005364 Unclassified 507
54 Ga0070688_100004447 3300005365 Bacteria 7297
55 Ga0070688_100539026 3300005365 Bacteria 885
56 Ga0070659_100036200 3300005366 Bacteria 3846
57 Ga0070703_10427841 3300005406 Bacteria 582
58 Ga0070713_100457828 3300005436 Bacteria 1199
59 Ga0070701_10026675 3300005438 Bacteria 2820
60 Ga0070705_101358687 3300005440 Unclassified 591
61 Ga0070700_100077240 3300005441 Bacteria 2140
62 Ga0070700_100230800 3300005441 Bacteria 1317
63 Ga0070700_101045690 3300005441 Bacteria 674
64 Ga0070700_101619990 3300005441 Bacteria 553
65 Ga0070708_100017006 3300005445 Bacteria 6053
66 Ga0070708_101166795 3300005445 Bacteria 721
67 Ga0070663_100943185 3300005455 Bacteria 748
68 Ga0070663_101267151 3300005455 Bacteria 650
69 Ga0070678_100454029 3300005456 Bacteria 1123
70 Ga0070678_100679512 3300005456 Bacteria 926
71 Ga0070678_101514826 3300005456 Unclassified 628
72 Ga0070662_100099238 3300005457 Bacteria 2201
73 Ga0070681_10536749 3300005458 Bacteria 1083
74 Ga0070681_11085945 3300005458 Bacteria 721
75 Ga0068867_100046343 3300005459 Bacteria 3193
76 Ga0068867_100268824 3300005459 Bacteria 1393
77 Ga0070685_10021308 3300005466 Bacteria 3522
78 Ga0070685_10067490 3300005466 Bacteria 2110
79 Ga0070685_10240273 3300005466 Bacteria 1195
80 Ga0070698_100234546 3300005471 Bacteria 1768
81 Ga0070699_100948002 3300005518 Bacteria 789
82 Ga0070679_100428175 3300005530 Bacteria 1268
83 Ga0070697_100195111 3300005536 Bacteria 1719
84 Ga0070697_100361633 3300005536 Bacteria 1255
85 Ga0068853_100937983 3300005539 Bacteria 832
86 Ga0068853_101079125 3300005539 Bacteria 774
87 Ga0070672_100007696 3300005543 Bacteria 7337
88 Ga0070672_101410501 3300005543 Bacteria 623
89 Ga0070686_100049551 3300005544 Bacteria 2665
90 Ga0070686_100628563 3300005544 Bacteria 849
91 Ga0070686_101604097 3300005544 Bacteria 550
92 Ga0070695_100126704 3300005545 Bacteria 1754
93 Ga0070695_101098757 3300005545 Bacteria 651
94 Ga0070696_100593569 3300005546 Bacteria 892
95 Ga0070693_100015767 3300005547 Bacteria 3898
96 Ga0070693_100030947 3300005547 Bacteria 2930
97 Ga0070665_100040509 3300005548 Bacteria 4682
98 Ga0070704_100201420 3300005549 Bacteria 1607
99 Ga0070704_100953577 3300005549 Bacteria 774
100 Ga0068855_100104560 3300005563 Bacteria 3257
101 Ga0068855_101894856 3300005563 Unclassified 604
102 Ga0070664_100152442 3300005564 Bacteria 2041
103 Ga0070664_100884361 3300005564 Bacteria 837
104 Ga0068857_100052836 3300005577 Bacteria 3604
105 Ga0068857_100968009 3300005577 Unclassified 818
106 Ga0068854_100050773 3300005578 Bacteria 2969
107 Ga0068856_100967243 3300005614 Unclassified 870
108 Ga0070702_100217117 3300005615 Bacteria 1276
109 Ga0068852_100536766 3300005616 Bacteria 1168
110 Ga0068852_101706098 3300005616 Unclassified 652
111 Ga0068859_100337139 3300005617 Bacteria 1602
112 Ga0068859_100469814 3300005617 Bacteria 1353
113 Ga0068859_101958206 3300005617 Unclassified 647
114 Ga0068864_100481032 3300005618 Bacteria 1192
115 Ga0068864_100593447 3300005618 Unclassified 1074
116 Ga0068864_101013897 3300005618 Bacteria 824
117 Ga0068864_101080548 3300005618 Unclassified 798
118 Ga0068861_100083249 3300005719 Bacteria 2509
119 Ga0068861_100218657 3300005719 Bacteria 1609
120 Ga0068861_100355895 3300005719 Bacteria 1286
121 Ga0068861_100715692 3300005719 Bacteria 932
122 Ga0068861_101013812 3300005719 Bacteria 793
123 Ga0068870_11338216 3300005840 Bacteria 523
124 Ga0068863_100345398 3300005841 Unclassified 1448
125 Ga0068858_100134770 3300005842 Bacteria 2317
126 Ga0068858_100243493 3300005842 Bacteria 1707
127 Ga0068858_100289235 3300005842 Bacteria 1562
128 Ga0068858_100314996 3300005842 Bacteria 1494
129 Ga0068860_100026153 3300005843 Bacteria 5629
130 Ga0068860_100052472 3300005843 Unclassified 3879
131 Ga0068860_100242920 3300005843 Bacteria 1752
132 Ga0068862_100395667 3300005844 Bacteria 1291
133 Ga0068862_100688710 3300005844 Unclassified 989
134 Ga0068862_101071976 3300005844 Bacteria 800
135 Ga0070715_10216030 3300006163 Bacteria 983
136 Ga0070715_10413340 3300006163 Bacteria 753
137 Ga0070716_100724592 3300006173 Unclassified 762
138 Ga0070712_101259124 3300006175 Bacteria 644
139 Ga0075367_10149148 3300006178 Unclassified 1451
140 Ga0097621_100342289 3300006237 Bacteria 1328
141 Ga0097621_101375550 3300006237 Unclassified 668
142 Ga0075428_100001483 3300006844 Bacteria 25098
143 Ga0075428_100044508 3300006844 Bacteria 4878
144 Ga0075428_100558146 3300006844 Bacteria 1224
145 Ga0075428_101227695 3300006844 Bacteria 790
146 Ga0075430_100005258 3300006846 Bacteria 10915
147 Ga0075430_100018384 3300006846 Bacteria 5948
148 Ga0075430_100097137 3300006846 Bacteria 2461
149 Ga0075430_100390782 3300006846 Bacteria 1148
150 Ga0075430_101425011 3300006846 Bacteria 569
151 Ga0075431_100007468 3300006847 Bacteria 10884
152 Ga0075431_100078157 3300006847 Bacteria 3415
153 Ga0075431_100101648 3300006847 Unclassified 2966
154 Ga0075431_100181030 3300006847 Bacteria 2163
155 Ga0075431_100190517 3300006847 Bacteria 2101
156 Ga0075433_10044713 3300006852 Bacteria 3848
157 Ga0075433_11201676 3300006852 Unclassified 658
158 Ga0075434_100062702 3300006871 Unclassified 3701
159 Ga0075434_100514279 3300006871 Bacteria 1218
160 Ga0075434_100637630 3300006871 Bacteria 1084
161 Ga0075429_100008368 3300006880 Bacteria 9003
162 Ga0075429_100044147 3300006880 Bacteria 3877
163 Ga0075429_100212194 3300006880 Bacteria 1696
164 Ga0075436_100004675 3300006914 Bacteria 9388
165 Ga0075436_100137460 3300006914 Bacteria 1716
166 Ga0097620_100067613 3300006931 Bacteria 3608
167 Ga0097620_100337134 3300006931 Bacteria 1602
168 Ga0097620_100469798 3300006931 Bacteria 1353
169 Ga0097620_101957471 3300006931 Unclassified 647
170 Ga0075435_100001630 3300007076 Bacteria 14533
171 Ga0075435_100124588 3300007076 Bacteria 2153
172 Ga0075435_100126013 3300007076 Bacteria 2140
173 Ga0099794_10048766 3300007265 Bacteria 2034
174 Ga0105251_10299287 3300009011 Unclassified 729
175 Ga0105240_11028784 3300009093 Bacteria 880
176 Ga0111539_10002179 3300009094 Bacteria 26177
177 Ga0111539_10017242 3300009094 Bacteria 8936
178 Ga0111539_10090089 3300009094 Bacteria 3605
179 Ga0111539_10193929 3300009094 Bacteria 2370
180 Ga0111539_10459343 3300009094 Bacteria 1483
181 Ga0111539_10664965 3300009094 Bacteria 1213
182 Ga0111539_11182915 3300009094 Bacteria 888
183 Ga0111539_11352543 3300009094 Bacteria 826
184 Ga0111539_12408156 3300009094 Bacteria 611
185 Ga0105245_10017970 3300009098 Bacteria 6176
186 Ga0105245_10461423 3300009098 Bacteria 1280
187 Ga0105245_10545566 3300009098 Bacteria 1181
188 Ga0105245_11695836 3300009098 Bacteria 684
189 Ga0105247_10632976 3300009101 Unclassified 797
190 Ga0114129_10022461 3300009147 Bacteria 8955
191 Ga0114129_10026341 3300009147 Bacteria 8234
192 Ga0114129_10030232 3300009147 Bacteria 7669
193 Ga0114129_10045304 3300009147 Bacteria 6184
194 Ga0114129_10090884 3300009147 Bacteria 4231
195 Ga0114129_10122444 3300009147 Bacteria 3579
196 Ga0114129_10656517 3300009147 Bacteria 1353
197 Ga0114129_12337685 3300009147 Bacteria 641
198 Ga0105243_10317957 3300009148 Bacteria 1417
199 Ga0105243_11127913 3300009148 Bacteria 794
200 Ga0105243_11796933 3300009148 Bacteria 644
201 Ga0105242_10020834 3300009176 Bacteria 5143
202 Ga0105242_10849203 3300009176 Bacteria 908
203 Ga0105242_11776203 3300009176 Bacteria 655
204 Ga0105248_10389632 3300009177 Bacteria 1569
205 Ga0105248_10437865 3300009177 Bacteria 1472
206 Ga0105248_10634128 3300009177 Bacteria 1206
207 Ga0105248_11145452 3300009177 Unclassified 879
208 Ga0105248_11355588 3300009177 Bacteria 805
209 Ga0105248_11721779 3300009177 Bacteria 711
210 Ga0105248_12582338 3300009177 Unclassified 579
211 Ga0105237_11139078 3300009545 Bacteria 787
212 Ga0105237_11579286 3300009545 Unclassified 663
213 Ga0105238_11664630 3300009551 Bacteria 669
214 Ga0105249_10618775 3300009553 Bacteria 1139
215 Ga0105239_10119352 3300010375 Bacteria 2927
216 Ga0105239_11135932 3300010375 Bacteria 900
217 Ga0105246_10689889 3300011119 Bacteria 894
218 Ga0105246_10694360 3300011119 Unclassified 891
219 Ga0105246_12355608 3300011119 Unclassified 521
220 Ga0157370_11199899 3300013104 Bacteria 685
221 Ga0157378_10233902 3300013297 Bacteria 1752
222 Ga0157378_10286330 3300013297 Bacteria 1590
223 Ga0163162_10680590 3300013306 Bacteria 1151
224 Ga0163162_11994919 3300013306 Unclassified 665
225 Ga0163162_12410316 3300013306 Bacteria 605
226 Ga0163163_10878667 3300014325 Bacteria 960
227 Ga0157380_10302181 3300014326 Bacteria 1475
228 Ga0157380_10326244 3300014326 Bacteria 1425
229 Ga0157380_10522546 3300014326 Bacteria 1158
230 Ga0157380_11094220 3300014326 Bacteria 836
231 Ga0157379_10146624 3300014968 Bacteria 2128
232 Ga0157379_11655841 3300014968 Bacteria 626
233 Ga0157376_10499689 3300014969 Bacteria 1195
234 Ga0207653_10277638 3300025885 Bacteria 646
235 Ga0207682_10021217 3300025893 Bacteria 2554
236 Ga0207642_10298360 3300025899 Bacteria 933
237 Ga0207642_10437297 3300025899 Bacteria 790
238 Ga0207710_10189134 3300025900 Unclassified 1013
239 Ga0207688_10116086 3300025901 Bacteria 1558
240 Ga0207680_10048280 3300025903 Bacteria 2528
241 Ga0207680_10254313 3300025903 Bacteria 1214
242 Ga0207645_10007605 3300025907 Bacteria 7637
243 Ga0207645_10734087 3300025907 Bacteria 671
244 Ga0207654_10065946 3300025911 Bacteria 2134
245 Ga0207707_10464175 3300025912 Bacteria 1083
246 Ga0207707_11602427 3300025912 Bacteria 513
247 Ga0207695_10156241 3300025913 Bacteria 2215
248 Ga0207660_10077944 3300025917 Bacteria 2427
249 Ga0207662_10005161 3300025918 Bacteria 6928
250 Ga0207657_10125847 3300025919 Bacteria 2105
251 Ga0207657_10203049 3300025919 Bacteria 1593
252 Ga0207649_10422603 3300025920 Bacteria 1001
253 Ga0207652_10221306 3300025921 Bacteria 1706
254 Ga0207681_10233290 3300025923 Bacteria 1429
255 Ga0207681_10546047 3300025923 Bacteria 953
256 Ga0207694_10693474 3300025924 Bacteria 859
257 Ga0207650_10566357 3300025925 Bacteria 953
258 Ga0207659_10051630 3300025926 Bacteria 2925
259 Ga0207659_10148566 3300025926 Bacteria 1828
260 Ga0207659_10662474 3300025926 Unclassified 892
261 Ga0207687_10115220 3300025927 Bacteria 2002
262 Ga0207664_10104945 3300025929 Bacteria 2341
263 Ga0207644_10162008 3300025931 Bacteria 1739
264 Ga0207690_10069641 3300025932 Bacteria 2421
265 Ga0207690_10421431 3300025932 Bacteria 1068
266 Ga0207706_10126768 3300025933 Bacteria 2245
267 Ga0207686_10034245 3300025934 Bacteria 3039
268 Ga0207709_10406895 3300025935 Bacteria 1042
269 Ga0207670_10072265 3300025936 Bacteria 2388
270 Ga0207670_10121745 3300025936 Unclassified 1898
271 Ga0207670_11027097 3300025936 Bacteria 694
272 Ga0207704_10086366 3300025938 Bacteria 2046
273 Ga0207704_11017850 3300025938 Bacteria 701
274 Ga0207691_10023268 3300025940 Bacteria 5832
275 Ga0207691_11021053 3300025940 Bacteria 690
276 Ga0207711_10018783 3300025941 Bacteria 5748
277 Ga0207711_10308365 3300025941 Bacteria 1461
278 Ga0207711_10638869 3300025941 Bacteria 993
279 Ga0207689_10117560 3300025942 Bacteria 2186
280 Ga0207689_10126382 3300025942 Bacteria 2103
281 Ga0207661_10097768 3300025944 Bacteria 2459
282 Ga0207679_10426552 3300025945 Bacteria 1171
283 Ga0207667_10082564 3300025949 Bacteria 3328
284 Ga0207667_10426705 3300025949 Unclassified 1349
285 Ga0207667_11195900 3300025949 Unclassified 740
286 Ga0207651_10054289 3300025960 Bacteria 2744
287 Ga0207712_10759830 3300025961 Bacteria 850
288 Ga0207668_10937191 3300025972 Bacteria 772
289 Ga0207640_11355784 3300025981 Bacteria 636
290 Ga0207703_10113901 3300026035 Bacteria 2312
291 Ga0207703_11641172 3300026035 Bacteria 618
292 Ga0207639_10298629 3300026041 Bacteria 1423
293 Ga0207708_10001395 3300026075 Bacteria 18132
294 Ga0207708_10407400 3300026075 Unclassified 1126
295 Ga0207702_10336087 3300026078 Bacteria 1442
296 Ga0207702_11466051 3300026078 Unclassified 676
297 Ga0207641_10068220 3300026088 Bacteria 3049
298 Ga0207648_10001730 3300026089 Bacteria 23904
299 Ga0207648_10348438 3300026089 Bacteria 1335
300 Ga0207648_10753911 3300026089 Bacteria 904
301 Ga0207675_100013890 3300026118 Bacteria 7507
302 Ga0207675_100098302 3300026118 Bacteria 2756
303 Ga0207675_100177963 3300026118 Bacteria 2036
304 Ga0207675_100845505 3300026118 Bacteria 930
305 Ga0207683_10081331 3300026121 Bacteria 2875
306 Ga0207683_10375044 3300026121 Bacteria 1307
307 Ga0207683_10838717 3300026121 Bacteria 853
308 Ga0207698_10725106 3300026142 Unclassified 991
309 Ga0207698_10778854 3300026142 Bacteria 957
310 Ga0209971_1096881 3300027682 Bacteria 721
311 Ga0209966_1123250 3300027695 Unclassified 595
312 Ga0207428_10011067 3300027907 Bacteria 8015
313 Ga0207428_10026344 3300027907 Bacteria 4854
314 Ga0207428_10770704 3300027907 Bacteria 685
315 Ga0268266_10012249 3300028379 Bacteria 7420
316 Ga0268265_10536558 3300028380 Bacteria 1108
317 Ga0268265_10545329 3300028380 Unclassified 1100
318 Ga0268264_10011796 3300028381 Bacteria 7204
319 Ga0268264_10113045 3300028381 Bacteria 2382
320 Ga0265337_1021417 3300028556 Bacteria 2015
321 Ga0265338_10940101 3300028800 Unclassified 587
322 Ga0265320_10059221 3300031240 Unclassified 1832
323 Ga0265340_10000224 3300031247 Bacteria 28844
324 Ga0265316_10387734 3300031344 Bacteria 1007
325 Ga0307408_100034260 3300031548 Bacteria 3555
326 Ga0307408_100059353 3300031548 Bacteria 2784
327 Ga0307408_100365925 3300031548 Bacteria 1228
328 Ga0307408_100743696 3300031548 Bacteria 885
329 Ga0307405_10631092 3300031731 Bacteria 878
330 Ga0307405_10777048 3300031731 Bacteria 800
331 Ga0307405_10883773 3300031731 Bacteria 755
332 Ga0307405_11187479 3300031731 Unclassified 659
333 Ga0307405_11248993 3300031731 Unclassified 644
334 Ga0307413_10895153 3300031824 Unclassified 753
335 Ga0307410_10159865 3300031852 Bacteria 1687
336 Ga0307406_10108713 3300031901 Unclassified 1904
337 Ga0307406_10542372 3300031901 Bacteria 950
338 Ga0307406_10867725 3300031901 Bacteria 766
339 Ga0307406_11946610 3300031901 Unclassified 525
340 Ga0307407_10253402 3300031903 Bacteria 1207
341 Ga0307407_10258449 3300031903 Bacteria 1197
342 Ga0307407_11519328 3300031903 Bacteria 530
343 Ga0307412_10082653 3300031911 Unclassified 2224
344 Ga0307412_10348094 3300031911 Archaea 1189
345 Ga0307412_11071323 3300031911 Bacteria 716
346 Ga0307409_101414950 3300031995 Bacteria 722
347 Ga0307409_101480929 3300031995 Bacteria 706
348 Ga0307416_100056293 3300032002 Bacteria 3173
349 Ga0307416_100111122 3300032002 Bacteria 2415
350 Ga0307416_100731509 3300032002 Bacteria 1081
351 Ga0307416_101531268 3300032002 Bacteria 772
352 Ga0307416_101609533 3300032002 Bacteria 755
353 Ga0307416_101933766 3300032002 Unclassified 693
354 Ga0307416_102151748 3300032002 Bacteria 659
355 Ga0307411_10039837 3300032005 Bacteria 2976
356 Ga0307411_10070449 3300032005 Unclassified 2366
357 Ga0307411_10174160 3300032005 Bacteria 1626
358 Ga0307411_10190148 3300032005 Bacteria 1567
359 Ga0307411_10430356 3300032005 Bacteria 1099
360 Ga0373940_0071660 3300035088 Bacteria 1010
361 Ga0373949_0041277 3300035090 Bacteria 1135
362 Ga0373941_0096556 3300035115 Bacteria 1022
363 Ga0373945_0010371 3300035116 Bacteria 3068
364 Ga0373960_0177395 3300035121 Bacteria 742
365 Ga0373942_0047793 3300035207 Bacteria 1190
366 Ga0373962_0149385 3300035242 Bacteria 764
367 Ga0373935_0018885 3300035692 Bacteria 4202
368 Ga0373935_0673212 3300035692 Bacteria 760
369 Ga0373927_0000978 3300035695 Bacteria 21734
370 Ga0373927_0016485 3300035695 Bacteria 4872
371 Ga0373947_0015079 3300035725 Bacteria 4436
372 Ga0373925_0439986 3300037068 Bacteria 1067
373 Ga0439439_0115448 3300041406 Bacteria 746
374 Ga0439453_0008396 3300041408 Bacteria 1659
375 Ga0439465_0406126 3300041413 Bacteria 519
376 Ga0439433_0086276 3300041999 Bacteria 768
377 Ga0439441_074947 3300042001 Bacteria 730
378 Ga0439449_0131804 3300042007 Bacteria 929
379 Ga0439449_0134989 3300042007 Bacteria 918
380 Ga0439450_170634 3300042008 Unclassified 575
381 Ga0439434_0332336 3300042435 Unclassified 529
382 Ga0439464_0006555 3300042439 Bacteria 3036
383 Ga0439460_0140716 3300042461 Bacteria 800
384 Ga0439440_0139055 3300042993 Bacteria 688
385 Ga0453683_0389948 3300044673 Bacteria 897
386 Ga0453684_0024453 3300044712 Bacteria 8827
387 Ga0453684_1356985 3300044712 Unclassified 739
388 Ga0451576_0514102 3300045051 Unclassified 1258
389 Ga0451576_0673552 3300045051 Unclassified 1087
390 Ga0495630_0169268 3300046517 Unclassified 1664
391 Ga0495630_0310037 3300046517 Bacteria 1206
392 Ga0495666_0066497 3300046526 Bacteria 1718
393 Ga0495640_0193631 3300046533 Bacteria 1291
394 Ga0495599_0676437 3300046678 Bacteria 596
395 Ga0495647_0242486 3300046681 Bacteria 800
396 Ga0495669_0681280 3300046684 Bacteria 500
397 Ga0495680_0097388 3300047322 Bacteria 2196
398 Ga0495675_0215750 3300047444 Bacteria 1163
399 Ga0496104_0727056 3300048907 Bacteria 900
400 Ga0496105_0085065 3300048908 Bacteria 2613
401 Ga0496106_0438144 3300048909 Bacteria 1050
402 Ga0496107_0558788 3300048910 Bacteria 847
403 Ga0496107_1349266 3300048910 Unclassified 509
404 Ga0496113_0423310 3300048916 Bacteria 1070
405 Ga0501039_0521745 3300049575 Bacteria 933
406 Ga0501046_0183546 3300049580 Bacteria 1563
407 Ga0501047_0769188 3300049581 Bacteria 778
408 Ga0501048_0819742 3300049582 Bacteria 669
409 Ga0501071_0115646 3300049587 Bacteria 1985
410 Ga0501072_1153988 3300049588 Bacteria 602
411 Ga0501072_1249999 3300049588 Bacteria 576
412 Ga0501074_0128313 3300049590 Bacteria 1815
413 Ga0501076_0186669 3300049592 Bacteria 1691
414 Ga0501255_069512 3300049684 Bacteria 574
415 Ga0501079_1019685 3300049741 Unclassified 652
416 Ga0501080_0226350 3300049742 Bacteria 1710
417 Ga0501081_0864689 3300049743 Bacteria 681
418 Ga0501272_048737 3300049769 Unclassified 583
419 Ga0501273_007910 3300049770 Unclassified 1262
420 Ga0501212_031029 3300049851 Bacteria 862
421 nmdc:mga06z11_337257_c1 3300050494 Unclassified 901
422 nmdc:mga05p37_101386_c1 3300050507 Bacteria 3545
423 nmdc:mga05p37_111586_c1 3300050507 Bacteria 3363
424 nmdc:mga05p37_141308_c1 3300050507 Bacteria 2950
425 nmdc:mga05p37_1521325_c1 3300050507 Bacteria 665
426 nmdc:mga05p37_1913282_c1 3300050507 Unclassified 566
427 nmdc:mga05p37_679_c1 3300050507 Bacteria 37674
428 nmdc:mga05p37_74413_c1 3300050507 Bacteria 4181
429 nmdc:mga09592_96211_c1 3300050508 Unclassified 2533
430 nmdc:mga0qj67_109662_c1 3300050509 Unclassified 2228
431 nmdc:mga0qj67_1136502_c1 3300050509 Bacteria 609
432 nmdc:mga0qj67_370289_c1 3300050509 Bacteria 1157
433 nmdc:mga0qj67_772462_c1 3300050509 Unclassified 761
434 nmdc:mga0qj67_88916_c1 3300050509 Bacteria 2480
435 nmdc:mga06r32_1362087_c1 3300050510 Bacteria 652
436 nmdc:mga06r32_166402_c1 3300050510 Bacteria 2188
437 nmdc:mga06r32_26620_c1 3300050510 Bacteria 5395
438 nmdc:mga06r32_274769_c1 3300050510 Bacteria 1672
439 nmdc:mga06r32_88568_c1 3300050510 Bacteria 3021
440 nmdc:mga06r32_9355_c1 3300050510 Bacteria 8836
441 nmdc:mga08y16_1032397_c1 3300050511 Bacteria 800
442 nmdc:mga08y16_1178_c1 3300050511 Bacteria 25815
443 nmdc:mga08y16_13050_c1 3300050511 Bacteria 8741
444 nmdc:mga08y16_660070_c1 3300050511 Bacteria 1049
445 nmdc:mga08y16_80258_c1 3300050511 Bacteria 3401
446 nmdc:mga08y16_896013_c1 3300050511 Bacteria 873
447 nmdc:mga0n895_1286904_c1 3300050512 Bacteria 702
448 nmdc:mga0n895_368256_c1 3300050512 Bacteria 1455
449 nmdc:mga0rr50_242125_c1 3300050513 Bacteria 1495
450 nmdc:mga0rr50_26930_c1 3300050513 Bacteria 4020
451 nmdc:mga0rr50_396214_c1 3300050513 Bacteria 1166
452 nmdc:mga08x19_250416_c1 3300050514 Bacteria 1223
453 nmdc:mga08x19_44720_c1 3300050514 Bacteria 2828
454 nmdc:mga0a205_104733_c1 3300050515 Bacteria 2728
455 nmdc:mga0a205_48318_c1 3300050515 Bacteria 4107
456 nmdc:mga0a205_90788_c1 3300050515 Bacteria 2951
457 Ga0590071_023109 3300059421 Bacteria 1468
458 Ga0590071_063176 3300059421 Bacteria 907
459 Ga0590074_004274 3300059423 Bacteria 2361
460 Ga0070696_100465472
461 MRS1b_contig_633322
462 MBSR1b_contig_12402573
463 MBSR1b_contig_9886596
464 JGI24751J29686_10027666
465 Ga0065714_10200187
466 Ga0065712_10109598
467 Ga0065712_10149291
468 Ga0065712_10281014
469 Ga0065715_10102415
470 Ga0065715_10535170
471 Ga0065707_10032474
472 Ga0065707_10279315
473 Ga0065707_10431378
474 Ga0070676_10007547
475 Ga0070690_100154010
476 Ga0070670_100003424
477 Ga0070670_100009179
478 Ga0070677_10404964
479 Ga0068869_100383679
480 Ga0070666_10021934
481 Ga0070666_10059240
482 Ga0070682_100288823
483 Ga0068868_100893935
484 Ga0070660_100138002
485 Ga0070660_100497561
486 Ga0070689_100008481
487 Ga0070689_100024511
488 Ga0070689_100069931
489 Ga0070689_100204255
490 Ga0070689_101132604
491 Ga0070691_10734248
492 Ga0070687_100004779
493 Ga0070661_101327248
494 Ga0070692_10188958
495 Ga0070668_100033713
496 Ga0070668_100936657
497 Ga0070668_101046884
498 Ga0070668_102017517
499 Ga0070669_100111046
500 Ga0070669_101063823
501 Ga0070675_100119030
502 Ga0070675_100208697
503 Ga0070675_100355449
504 Ga0070675_100417222
505 Ga0070675_100558586
506 Ga0070671_100027966
507 Ga0070674_100026858
508 Ga0070674_100333641
509 Ga0070674_100562832
510 Ga0070673_100030094
511 Ga0070673_100392771
512 Ga0070673_102347472
513 Ga0070688_100004447
514 Ga0070688_100539026
515 Ga0070659_100036200
516 Ga0070703_10427841
517 Ga0070713_100457828
518 Ga0070701_10026675
519 Ga0070705_101358687
520 Ga0070700_100077240
521 Ga0070700_100230800
522 Ga0070700_101045690
523 Ga0070700_101619990
524 Ga0070708_100017006
525 Ga0070708_101166795
526 Ga0070663_100943185
527 Ga0070663_101267151
528 Ga0070678_100454029
529 Ga0070678_100679512
530 Ga0070678_101514826
531 Ga0070662_100099238
532 Ga0070681_10536749
533 Ga0070681_11085945
534 Ga0068867_100046343
535 Ga0068867_100268824
536 Ga0070685_10021308
537 Ga0070685_10067490
538 Ga0070685_10240273
539 Ga0070698_100234546
540 Ga0070699_100948002
541 Ga0070679_100428175
542 Ga0070697_100195111
543 Ga0070697_100361633
544 Ga0068853_100937983
545 Ga0068853_101079125
546 Ga0070672_100007696
547 Ga0070672_101410501
548 Ga0070686_100049551
549 Ga0070686_100628563
550 Ga0070686_101604097
551 Ga0070695_100126704
552 Ga0070695_101098757
553 Ga0070696_100593569
554 Ga0070693_100015767
555 Ga0070693_100030947
556 Ga0070665_100040509
557 Ga0070704_100201420
558 Ga0070704_100953577
559 Ga0068855_100104560
560 Ga0068855_101894856
561 Ga0070664_100152442
562 Ga0070664_100884361
563 Ga0068857_100052836
564 Ga0068857_100968009
565 Ga0068854_100050773
566 Ga0068856_100967243
567 Ga0070702_100217117
568 Ga0068852_100536766
569 Ga0068852_101706098
570 Ga0068859_100337139
571 Ga0068859_100469814
572 Ga0068859_101958206
573 Ga0068864_100481032
574 Ga0068864_100593447
575 Ga0068864_101013897
576 Ga0068864_101080548
577 Ga0068861_100083249
578 Ga0068861_100218657
579 Ga0068861_100355895
580 Ga0068861_100715692
581 Ga0068861_101013812
582 Ga0068870_11338216
583 Ga0068863_100345398
584 Ga0068858_100134770
585 Ga0068858_100243493
586 Ga0068858_100289235
587 Ga0068858_100314996
588 Ga0068860_100026153
589 Ga0068860_100052472
590 Ga0068860_100242920
591 Ga0068862_100395667
592 Ga0068862_100688710
593 Ga0068862_101071976
594 Ga0070715_10216030
595 Ga0070715_10413340
596 Ga0070716_100724592
597 Ga0070712_101259124
598 Ga0075367_10149148
599 Ga0097621_100342289
600 Ga0097621_101375550
601 Ga0075428_100001483
602 Ga0075428_100044508
603 Ga0075428_100558146
604 Ga0075428_101227695
605 Ga0075430_100005258
606 Ga0075430_100018384
607 Ga0075430_100097137
608 Ga0075430_100390782
609 Ga0075430_101425011
610 Ga0075431_100007468
611 Ga0075431_100078157
612 Ga0075431_100101648
613 Ga0075431_100181030
614 Ga0075431_100190517
615 Ga0075433_10044713
616 Ga0075433_11201676
617 Ga0075434_100062702
618 Ga0075434_100514279
619 Ga0075434_100637630
620 Ga0075429_100008368
621 Ga0075429_100044147
622 Ga0075429_100212194
623 Ga0075436_100004675
624 Ga0075436_100137460
625 Ga0097620_100067613
626 Ga0097620_100337134
627 Ga0097620_100469798
628 Ga0097620_101957471
629 Ga0075435_100001630
630 Ga0075435_100124588
631 Ga0075435_100126013
632 Ga0099794_10048766
633 Ga0105251_10299287
634 Ga0105240_11028784
635 Ga0111539_10002179
636 Ga0111539_10017242
637 Ga0111539_10090089
638 Ga0111539_10193929
639 Ga0111539_10459343
640 Ga0111539_10664965
641 Ga0111539_11182915
642 Ga0111539_11352543
643 Ga0111539_12408156
644 Ga0105245_10017970
645 Ga0105245_10461423
646 Ga0105245_10545566
647 Ga0105245_11695836
648 Ga0105247_10632976
649 Ga0114129_10022461
650 Ga0114129_10026341
651 Ga0114129_10030232
652 Ga0114129_10045304
653 Ga0114129_10090884
654 Ga0114129_10122444
655 Ga0114129_10656517
656 Ga0114129_12337685
657 Ga0105243_10317957
658 Ga0105243_11127913
659 Ga0105243_11796933
660 Ga0105242_10020834
661 Ga0105242_10849203
662 Ga0105242_11776203
663 Ga0105248_10389632
664 Ga0105248_10437865
665 Ga0105248_10634128
666 Ga0105248_11145452
667 Ga0105248_11355588
668 Ga0105248_11721779
669 Ga0105248_12582338
670 Ga0105237_11139078
671 Ga0105237_11579286
672 Ga0105238_11664630
673 Ga0105249_10618775
674 Ga0105239_10119352
675 Ga0105239_11135932
676 Ga0105246_10689889
677 Ga0105246_10694360
678 Ga0105246_12355608
679 Ga0157370_11199899
680 Ga0157378_10233902
681 Ga0157378_10286330
682 Ga0163162_10680590
683 Ga0163162_11994919
684 Ga0163162_12410316
685 Ga0163163_10878667
686 Ga0157380_10302181
687 Ga0157380_10326244
688 Ga0157380_10522546
689 Ga0157380_11094220
690 Ga0157379_10146624
691 Ga0157379_11655841
692 Ga0157376_10499689
693 Ga0207653_10277638
694 Ga0207682_10021217
695 Ga0207642_10298360
696 Ga0207642_10437297
697 Ga0207710_10189134
698 Ga0207688_10116086
699 Ga0207680_10048280
700 Ga0207680_10254313
701 Ga0207645_10007605
702 Ga0207645_10734087
703 Ga0207654_10065946
704 Ga0207707_10464175
705 Ga0207707_11602427
706 Ga0207695_10156241
707 Ga0207660_10077944
708 Ga0207662_10005161
709 Ga0207657_10125847
710 Ga0207657_10203049
711 Ga0207649_10422603
712 Ga0207652_10221306
713 Ga0207681_10233290
714 Ga0207681_10546047
715 Ga0207694_10693474
716 Ga0207650_10566357
717 Ga0207659_10051630
718 Ga0207659_10148566
719 Ga0207659_10662474
720 Ga0207687_10115220
721 Ga0207664_10104945
722 Ga0207644_10162008
723 Ga0207690_10069641
724 Ga0207690_10421431
725 Ga0207706_10126768
726 Ga0207686_10034245
727 Ga0207709_10406895
728 Ga0207670_10072265
729 Ga0207670_10121745
730 Ga0207670_11027097
731 Ga0207704_10086366
732 Ga0207704_11017850
733 Ga0207691_10023268
734 Ga0207691_11021053
735 Ga0207711_10018783
736 Ga0207711_10308365
737 Ga0207711_10638869
738 Ga0207689_10117560
739 Ga0207689_10126382
740 Ga0207661_10097768
741 Ga0207679_10426552
742 Ga0207667_10082564
743 Ga0207667_10426705
744 Ga0207667_11195900
745 Ga0207651_10054289
746 Ga0207712_10759830
747 Ga0207668_10937191
748 Ga0207640_11355784
749 Ga0207703_10113901
750 Ga0207703_11641172
751 Ga0207639_10298629
752 Ga0207708_10001395
753 Ga0207708_10407400
754 Ga0207702_10336087
755 Ga0207702_11466051
756 Ga0207641_10068220
757 Ga0207648_10001730
758 Ga0207648_10348438
759 Ga0207648_10753911
760 Ga0207675_100013890
761 Ga0207675_100098302
762 Ga0207675_100177963
763 Ga0207675_100845505
764 Ga0207683_10081331
765 Ga0207683_10375044
766 Ga0207683_10838717
767 Ga0207698_10725106
768 Ga0207698_10778854
769 Ga0209971_1096881
770 Ga0209966_1123250
771 Ga0207428_10011067
772 Ga0207428_10026344
773 Ga0207428_10770704
774 Ga0268266_10012249
775 Ga0268265_10536558
776 Ga0268265_10545329
777 Ga0268264_10011796
778 Ga0268264_10113045
779 Ga0265337_1021417
780 Ga0265338_10940101
781 Ga0265320_10059221
782 Ga0265340_10000224
783 Ga0265316_10387734
784 Ga0307408_100034260
785 Ga0307408_100059353
786 Ga0307408_100365925
787 Ga0307408_100743696
788 Ga0307405_10631092
789 Ga0307405_10777048
790 Ga0307405_10883773
791 Ga0307405_11187479
792 Ga0307405_11248993
793 Ga0307413_10895153
794 Ga0307410_10159865
795 Ga0307406_10108713
796 Ga0307406_10542372
797 Ga0307406_10867725
798 Ga0307406_11946610
799 Ga0307407_10253402
800 Ga0307407_10258449
801 Ga0307407_11519328
802 Ga0307412_10082653
803 Ga0307412_10348094
804 Ga0307412_11071323
805 Ga0307409_101414950
806 Ga0307409_101480929
807 Ga0307416_100056293
808 Ga0307416_100111122
809 Ga0307416_100731509
810 Ga0307416_101531268
811 Ga0307416_101609533
812 Ga0307416_101933766
813 Ga0307416_102151748
814 Ga0307411_10039837
815 Ga0307411_10070449
816 Ga0307411_10174160
817 Ga0307411_10190148
818 Ga0307411_10430356
819 Ga0373940_0071660
820 Ga0373949_0041277
821 Ga0373941_0096556
822 Ga0373945_0010371
823 Ga0373960_0177395
824 Ga0373942_0047793
825 Ga0373962_0149385
826 Ga0373935_0018885
827 Ga0373935_0673212
828 Ga0373927_0000978
829 Ga0373927_0016485
830 Ga0373947_0015079
831 Ga0373925_0439986
832 Ga0439439_0115448
833 Ga0439453_0008396
834 Ga0439465_0406126
835 Ga0439433_0086276
836 Ga0439441_074947
837 Ga0439449_0131804
838 Ga0439449_0134989
839 Ga0439450_170634
840 Ga0439434_0332336
841 Ga0439464_0006555
842 Ga0439460_0140716
843 Ga0439440_0139055
844 Ga0453683_0389948
845 Ga0453684_0024453
846 Ga0453684_1356985
847 Ga0451576_0514102
848 Ga0451576_0673552
849 Ga0495630_0169268
850 Ga0495630_0310037
851 Ga0495666_0066497
852 Ga0495640_0193631
853 Ga0495599_0676437
854 Ga0495647_0242486
855 Ga0495669_0681280
856 Ga0495680_0097388
857 Ga0495675_0215750
858 Ga0496104_0727056
859 Ga0496105_0085065
860 Ga0496106_0438144
861 Ga0496107_0558788
862 Ga0496107_1349266
863 Ga0496113_0423310
864 Ga0501039_0521745
865 Ga0501046_0183546
866 Ga0501047_0769188
867 Ga0501048_0819742
868 Ga0501071_0115646
869 Ga0501072_1153988
870 Ga0501072_1249999
871 Ga0501074_0128313
872 Ga0501076_0186669
873 Ga0501255_069512
874 Ga0501079_1019685
875 Ga0501080_0226350
876 Ga0501081_0864689
877 Ga0501272_048737
878 Ga0501273_007910
879 Ga0501212_031029
880 nmdc:mga06z11_337257_c1
881 nmdc:mga05p37_101386_c1
882 nmdc:mga05p37_111586_c1
883 nmdc:mga05p37_141308_c1
884 nmdc:mga05p37_1521325_c1
885 nmdc:mga05p37_1913282_c1
886 nmdc:mga05p37_679_c1
887 nmdc:mga05p37_74413_c1
888 nmdc:mga09592_96211_c1
889 nmdc:mga0qj67_109662_c1
890 nmdc:mga0qj67_1136502_c1
891 nmdc:mga0qj67_370289_c1
892 nmdc:mga0qj67_772462_c1
893 nmdc:mga0qj67_88916_c1
894 nmdc:mga06r32_1362087_c1
895 nmdc:mga06r32_166402_c1
896 nmdc:mga06r32_26620_c1
897 nmdc:mga06r32_274769_c1
898 nmdc:mga06r32_88568_c1
899 nmdc:mga06r32_9355_c1
900 nmdc:mga08y16_1032397_c1
901 nmdc:mga08y16_1178_c1
902 nmdc:mga08y16_13050_c1
903 nmdc:mga08y16_660070_c1
904 nmdc:mga08y16_80258_c1
905 nmdc:mga08y16_896013_c1
906 nmdc:mga0n895_1286904_c1
907 nmdc:mga0n895_368256_c1
908 nmdc:mga0rr50_242125_c1
909 nmdc:mga0rr50_26930_c1
910 nmdc:mga0rr50_396214_c1
911 nmdc:mga08x19_250416_c1
912 nmdc:mga08x19_44720_c1
913 nmdc:mga0a205_104733_c1
914 nmdc:mga0a205_48318_c1
915 nmdc:mga0a205_90788_c1
916 Ga0590071_023109
917 Ga0590071_063176
918 Ga0590074_004274

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00392

GntR

Bacterial regulatory proteins, gntR family

45

108

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mgr-assembly1.cif.gz_B the crystal structure of bacillus subtilis gabr, an autorepressor and plp- and gaba-dependent transcriptional activator of gabt 0.9541 7 83
4tv7-assembly2.cif.gz_C crystal structure of bacillus subtilis gabr at 2.05 angstroms resolution 0.9539 7 83
4tv7-assembly1.cif.gz_A crystal structure of bacillus subtilis gabr at 2.05 angstroms resolution 0.9536 7 83
4n0b-assembly2.cif.gz_C crystal structure of bacillus subtilis gabr, an autorepressor and transcriptional activator of gabt 0.9515 7 83
4u0y-assembly1.cif.gz_A crystal structure of the dna-binding domains of yvoa in complex with palindromic operator dna 0.9474 9 82
ID Description Score Start End Superfamily
2wv0D01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9629 16 82 1.10.10.10
af_P0ACM5_16_95_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9552 10 82 1.10.10.10
4u0vA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9542 7 82 1.10.10.10
2wv0I01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9525 16 82 1.10.10.10
af_Q2G0Q2_1_79_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9505 15 83 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A0B6SEK9-F1-model_v4 Transcriptional regulator, GntR family 0.9917 6 84 GO:0003677
GO:0003700
GO:0009058
GO:0030170
AF-A0A2V9KVP4-F1-model_v4 PLP-dependent aminotransferase family protein 0.9853 6 82 GO:0003677
GO:0003700
GO:0008483
GO:0009058
GO:0030170
AF-A0A2N1X5A7-F1-model_v4 deleted 0.9853 5 83
AF-A0A6L4ZHF0-F1-model_v4 DNA-binding HTH domain-and aminotransferase domain-containing transcriptional regulator 0.9852 6 83 GO:0003677
GO:0003700
GO:0008483
GO:0009058
GO:0030170
AF-A0A158BRP0-F1-model_v4 Transcriptional regulator 0.9835 6 82 GO:0003677
GO:0003700
GO:0009058
GO:0030170

Map