F448302

General Info

Members Datasets Scaffolds Average Seq Length
459 230 918 70

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100295108|Ga0070683_1002951082
Length 81
Sequence MMLAVDNGQCGLCSHFGEDHGSDPKLVQIRRTHRAPDDLLDDCGHPRHASLHLKVTPISGCDGFEPAAAAATGGKANRAIQ

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
133 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
134 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
135 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
136 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
146 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
149 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
150 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
151 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
152 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
153 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
154 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
155 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
156 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
157 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
158 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
159 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
160 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
161 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
162 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
163 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
164 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
165 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
166 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
167 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
168 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
169 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
170 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
171 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
172 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
173 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
174 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
175 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
178 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
179 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
180 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
181 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
182 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
183 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
184 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
187 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
188 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
189 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
190 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
191 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
192 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
193 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
194 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
195 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
196 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
197 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
198 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
199 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
200 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
201 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
202 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
208 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
216 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
217 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
218 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
220 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
221 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
222 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
226 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
227 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
228 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
229 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
230 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.09
Nodule 0
Rhizoplane 1.31
Rhizosphere 95.21
Stem 0
Stem Tuber 0
Unclassified 27.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100295108 3300005329 Bacteria 1542
2 LJNas_1020233 3300000546 Bacteria 710
3 rootH1_10093831 3300003316 Bacteria 2656
4 rootH2_10309296 3300003320 Bacteria 2039
5 Ga0070658_10261742 3300005327 Bacteria 1469
6 Ga0070658_10624766 3300005327 Bacteria 934
7 Ga0070658_11225903 3300005327 Bacteria 652
8 Ga0070683_100019875 3300005329 Bacteria 5970
9 Ga0070683_100046952 3300005329 Bacteria 3990
10 Ga0070683_100427480 3300005329 Bacteria 1264
11 Ga0070690_100628219 3300005330 Unclassified 818
12 Ga0070670_100344393 3300005331 Bacteria 1309
13 Ga0070670_100733565 3300005331 Bacteria 890
14 Ga0070666_10079952 3300005335 Bacteria 2233
15 Ga0070666_10335822 3300005335 Bacteria 1080
16 Ga0070666_10564118 3300005335 Bacteria 829
17 Ga0070680_100050576 3300005336 Bacteria 3390
18 Ga0070680_100230789 3300005336 Bacteria 1563
19 Ga0070660_100057030 3300005339 Bacteria 3024
20 Ga0070691_10351045 3300005341 Bacteria 819
21 Ga0070661_100050887 3300005344 Unclassified 3032
22 Ga0070661_100055952 3300005344 Bacteria 2889
23 Ga0070661_100062830 3300005344 Unclassified 2726
24 Ga0070661_100110806 3300005344 Bacteria 2049
25 Ga0070661_101459895 3300005344 Unclassified 576
26 Ga0070671_100064976 3300005355 Bacteria 3039
27 Ga0070671_101173692 3300005355 Unclassified 675
28 Ga0070671_101306403 3300005355 Bacteria 640
29 Ga0070659_100027424 3300005366 Bacteria 4388
30 Ga0070659_100039517 3300005366 Unclassified 3684
31 Ga0070659_100451130 3300005366 Bacteria 1091
32 Ga0070659_100848013 3300005366 Bacteria 796
33 Ga0070667_101310237 3300005367 Bacteria 679
34 Ga0070709_10552199 3300005434 Bacteria 881
35 Ga0070709_11414031 3300005434 Unclassified 563
36 Ga0070714_100020907 3300005435 Bacteria 5350
37 Ga0070713_100299954 3300005436 Bacteria 1479
38 Ga0070713_100347141 3300005436 Bacteria 1376
39 Ga0070711_101692616 3300005439 Bacteria 554
40 Ga0070663_100169525 3300005455 Bacteria 1686
41 Ga0070663_100319008 3300005455 Unclassified 1249
42 Ga0070678_100176256 3300005456 Unclassified 1746
43 Ga0070681_10146100 3300005458 Bacteria 2294
44 Ga0070681_10457885 3300005458 Unclassified 1188
45 Ga0070681_10629143 3300005458 Bacteria 988
46 Ga0068867_101362400 3300005459 Unclassified 657
47 Ga0070685_10390972 3300005466 Bacteria 961
48 Ga0070679_100002550 3300005530 Bacteria 16518
49 Ga0070679_100027940 3300005530 Bacteria 5558
50 Ga0070679_100051318 3300005530 Bacteria 4108
51 Ga0070679_100331834 3300005530 Bacteria 1469
52 Ga0070684_100023843 3300005535 Bacteria 5126
53 Ga0070684_100085820 3300005535 Bacteria 2792
54 Ga0070684_100085863 3300005535 Unclassified 2791
55 Ga0070684_100390412 3300005535 Unclassified 1283
56 Ga0070684_100484298 3300005535 Bacteria 1145
57 Ga0068853_100139698 3300005539 Bacteria 2174
58 Ga0068853_100212926 3300005539 Bacteria 1762
59 Ga0068853_100996239 3300005539 Bacteria 806
60 Ga0070672_100783521 3300005543 Unclassified 838
61 Ga0070686_101525198 3300005544 Unclassified 564
62 Ga0070693_100532214 3300005547 Bacteria 838
63 Ga0070665_100058575 3300005548 Unclassified 3861
64 Ga0070665_100061613 3300005548 Unclassified 3761
65 Ga0070665_100078285 3300005548 Bacteria 3312
66 Ga0070665_101066654 3300005548 Bacteria 820
67 Ga0070665_101777733 3300005548 Unclassified 623
68 Ga0068855_100239851 3300005563 Bacteria 2026
69 Ga0068855_100311641 3300005563 Bacteria 1741
70 Ga0068855_100483860 3300005563 Viruses 1347
71 Ga0068855_101574165 3300005563 Bacteria 673
72 Ga0070664_100014075 3300005564 Bacteria 6525
73 Ga0070664_100331112 3300005564 Unclassified 1381
74 Ga0070664_100504785 3300005564 Bacteria 1115
75 Ga0068857_100002244 3300005577 Bacteria 15732
76 Ga0068857_100024283 3300005577 Bacteria 5335
77 Ga0068857_100034742 3300005577 Bacteria 4459
78 Ga0068857_100226818 3300005577 Bacteria 1707
79 Ga0068857_101962211 3300005577 Unclassified 574
80 Ga0068854_100011166 3300005578 Bacteria 5835
81 Ga0068854_101669449 3300005578 Unclassified 582
82 Ga0068856_101128027 3300005614 Unclassified 801
83 Ga0068856_101279597 3300005614 Bacteria 749
84 Ga0068856_101695708 3300005614 Unclassified 644
85 Ga0068852_100102194 3300005616 Bacteria 2590
86 Ga0068852_100544857 3300005616 Unclassified 1160
87 Ga0068852_100944112 3300005616 Bacteria 880
88 Ga0068852_101155320 3300005616 Bacteria 795
89 Ga0068852_101667958 3300005616 Bacteria 660
90 Ga0068852_101725503 3300005616 Unclassified 649
91 Ga0068852_102006207 3300005616 Unclassified 601
92 Ga0068859_101351645 3300005617 Bacteria 785
93 Ga0068864_100049725 3300005618 Bacteria 3608
94 Ga0068864_100205416 3300005618 Bacteria 1812
95 Ga0068864_100558595 3300005618 Bacteria 1107
96 Ga0068864_100937318 3300005618 Bacteria 856
97 Ga0068851_10160533 3300005834 Bacteria 1234
98 Ga0068851_10511849 3300005834 Unclassified 721
99 Ga0068851_10622025 3300005834 Unclassified 659
100 Ga0068863_100081043 3300005841 Unclassified 3074
101 Ga0068863_100460987 3300005841 Bacteria 1248
102 Ga0068863_100589434 3300005841 Bacteria 1100
103 Ga0068863_102197518 3300005841 Bacteria 562
104 Ga0068860_100389370 3300005843 Bacteria 1377
105 Ga0070717_12161698 3300006028 Unclassified 500
106 Ga0070712_101064633 3300006175 Bacteria 701
107 Ga0070712_101941999 3300006175 Bacteria 515
108 Ga0068871_100861068 3300006358 Unclassified 838
109 Ga0075430_100985072 3300006846 Unclassified 694
110 Ga0075431_102097766 3300006847 Bacteria 520
111 Ga0075433_10412607 3300006852 Unclassified 1191
112 Ga0075434_100009449 3300006871 Bacteria 9091
113 Ga0075429_100540046 3300006880 Bacteria 1022
114 Ga0075429_101545629 3300006880 Bacteria 577
115 Ga0097620_101351641 3300006931 Bacteria 785
116 Ga0105240_10005471 3300009093 Bacteria 18930
117 Ga0105240_10696074 3300009093 Bacteria 1110
118 Ga0105245_10783496 3300009098 Unclassified 991
119 Ga0105247_10167558 3300009101 Bacteria 1459
120 Ga0105247_10358779 3300009101 Unclassified 1027
121 Ga0105247_11238380 3300009101 Bacteria 596
122 Ga0114129_12445772 3300009147 Unclassified 625
123 Ga0105241_10272731 3300009174 Bacteria 1442
124 Ga0105248_10611461 3300009177 Unclassified 1230
125 Ga0105237_10049282 3300009545 Bacteria 4234
126 Ga0105237_10670752 3300009545 Bacteria 1044
127 Ga0105238_10833091 3300009551 Unclassified 939
128 Ga0105238_10968131 3300009551 Unclassified 871
129 Ga0105238_11257084 3300009551 Unclassified 766
130 Ga0105238_12088978 3300009551 Unclassified 601
131 Ga0105239_10074500 3300010375 Bacteria 3732
132 Ga0105239_11038685 3300010375 Bacteria 943
133 Ga0105239_11372173 3300010375 Bacteria 816
134 Ga0157345_1031778 3300012498 Bacteria 595
135 Ga0157373_10104561 3300013100 Unclassified 1991
136 Ga0157373_10997553 3300013100 Bacteria 625
137 Ga0157371_10169374 3300013102 Bacteria 1560
138 Ga0157371_10477420 3300013102 Unclassified 919
139 Ga0157371_10501927 3300013102 Bacteria 896
140 Ga0157370_10019768 3300013104 Bacteria 6742
141 Ga0157369_10119866 3300013105 Bacteria 2792
142 Ga0157369_10220619 3300013105 Unclassified 1985
143 Ga0157369_10323403 3300013105 Bacteria 1603
144 Ga0157369_10706149 3300013105 Bacteria 1038
145 Ga0157369_10807720 3300013105 Bacteria 964
146 Ga0157369_11061221 3300013105 Bacteria 829
147 Ga0157369_11755448 3300013105 Unclassified 630
148 Ga0157369_11987113 3300013105 Unclassified 590
149 Ga0157369_12667610 3300013105 Bacteria 504
150 Ga0157374_10005070 3300013296 Bacteria 11048
151 Ga0157374_10418941 3300013296 Bacteria 1338
152 Ga0157374_10973958 3300013296 Bacteria 867
153 Ga0157378_10396746 3300013297 Bacteria 1358
154 Ga0163162_10026372 3300013306 Bacteria 5743
155 Ga0163162_13234925 3300013306 Unclassified 522
156 Ga0157372_10007516 3300013307 Bacteria 11589
157 Ga0157372_10020997 3300013307 Bacteria 7050
158 Ga0157372_10068013 3300013307 Bacteria 4005
159 Ga0157372_10107892 3300013307 Unclassified 3186
160 Ga0157372_10396781 3300013307 Bacteria 1608
161 Ga0157372_10426089 3300013307 Bacteria 1546
162 Ga0157372_10804569 3300013307 Unclassified 1092
163 Ga0157375_10047370 3300013308 Bacteria 4198
164 Ga0157375_11896611 3300013308 Unclassified 707
165 Ga0163163_10009898 3300014325 Bacteria 8546
166 Ga0157380_11121223 3300014326 Unclassified 827
167 Ga0157380_12747344 3300014326 Unclassified 559
168 Ga0157377_11433159 3300014745 Unclassified 546
169 Ga0157376_10073904 3300014969 Bacteria 2905
170 Ga0157376_10254866 3300014969 Bacteria 1641
171 Ga0157376_10725067 3300014969 Bacteria 1001
172 Ga0213876_10010787 3300021384 Bacteria 4895
173 Ga0213876_10363479 3300021384 Bacteria 770
174 Ga0207656_10024306 3300025321 Bacteria 2449
175 Ga0207692_10301283 3300025898 Unclassified 976
176 Ga0207710_10559514 3300025900 Unclassified 596
177 Ga0207680_10535750 3300025903 Bacteria 835
178 Ga0207680_11088458 3300025903 Bacteria 571
179 Ga0207647_10044900 3300025904 Bacteria 2759
180 Ga0207647_10066696 3300025904 Bacteria 2182
181 Ga0207705_10000405 3300025909 Bacteria 37816
182 Ga0207705_10570483 3300025909 Bacteria 880
183 Ga0207654_10135043 3300025911 Bacteria 1566
184 Ga0207707_10155847 3300025912 Bacteria 1998
185 Ga0207707_10329189 3300025912 Bacteria 1318
186 Ga0207707_10515764 3300025912 Bacteria 1018
187 Ga0207695_10002055 3300025913 Bacteria 30785
188 Ga0207695_10061576 3300025913 Bacteria 3878
189 Ga0207695_10806919 3300025913 Bacteria 818
190 Ga0207671_10273764 3300025914 Bacteria 1330
191 Ga0207671_10541525 3300025914 Bacteria 928
192 Ga0207660_10060693 3300025917 Bacteria 2720
193 Ga0207657_10001086 3300025919 Bacteria 28797
194 Ga0207657_10092991 3300025919 Unclassified 2512
195 Ga0207649_10066001 3300025920 Unclassified 2292
196 Ga0207649_10077274 3300025920 Unclassified 2145
197 Ga0207649_10105904 3300025920 Bacteria 1870
198 Ga0207652_10004893 3300025921 Bacteria 10837
199 Ga0207652_10013643 3300025921 Bacteria 6569
200 Ga0207652_10278520 3300025921 Bacteria 1509
201 Ga0207652_10937735 3300025921 Bacteria 763
202 Ga0207694_10364412 3300025924 Bacteria 1198
203 Ga0207694_10551814 3300025924 Bacteria 967
204 Ga0207650_10469097 3300025925 Bacteria 1049
205 Ga0207650_10547771 3300025925 Bacteria 970
206 Ga0207687_10117742 3300025927 Unclassified 1982
207 Ga0207700_10441391 3300025928 Bacteria 1146
208 Ga0207700_12044293 3300025928 Bacteria 500
209 Ga0207664_10015874 3300025929 Bacteria 5484
210 Ga0207644_10063974 3300025931 Unclassified 2672
211 Ga0207644_11187053 3300025931 Bacteria 641
212 Ga0207690_10005189 3300025932 Bacteria 7684
213 Ga0207690_10069846 3300025932 Unclassified 2418
214 Ga0207690_11125302 3300025932 Unclassified 655
215 Ga0207690_11271785 3300025932 Unclassified 615
216 Ga0207706_11221303 3300025933 Unclassified 624
217 Ga0207686_10356809 3300025934 Bacteria 1102
218 Ga0207670_10771738 3300025936 Unclassified 799
219 Ga0207669_10571970 3300025937 Unclassified 915
220 Ga0207704_10752021 3300025938 Unclassified 811
221 Ga0207691_10312068 3300025940 Bacteria 1349
222 Ga0207691_10444175 3300025940 Unclassified 1104
223 Ga0207711_10495707 3300025941 Unclassified 1138
224 Ga0207661_10050843 3300025944 Bacteria 3304
225 Ga0207661_10087207 3300025944 Unclassified 2591
226 Ga0207661_10090135 3300025944 Bacteria 2553
227 Ga0207661_10099752 3300025944 Bacteria 2436
228 Ga0207661_10230994 3300025944 Bacteria 1638
229 Ga0207661_10385390 3300025944 Bacteria 1269
230 Ga0207661_10510097 3300025944 Bacteria 1099
231 Ga0207661_10936985 3300025944 Bacteria 798
232 Ga0207661_11113893 3300025944 Unclassified 727
233 Ga0207661_11845776 3300025944 Unclassified 550
234 Ga0207679_10401981 3300025945 Unclassified 1205
235 Ga0207679_10424851 3300025945 Bacteria 1174
236 Ga0207679_10747959 3300025945 Bacteria 889
237 Ga0207667_10030810 3300025949 Bacteria 5797
238 Ga0207667_10083107 3300025949 Bacteria 3316
239 Ga0207667_10430100 3300025949 Bacteria 1343
240 Ga0207667_10797247 3300025949 Bacteria 941
241 Ga0207667_10867891 3300025949 Bacteria 896
242 Ga0207667_12193861 3300025949 Unclassified 509
243 Ga0207640_10038214 3300025981 Bacteria 3027
244 Ga0207658_11343245 3300025986 Bacteria 654
245 Ga0207658_11519750 3300025986 Bacteria 612
246 Ga0207639_10189975 3300026041 Bacteria 1754
247 Ga0207639_10628322 3300026041 Bacteria 992
248 Ga0207639_11029530 3300026041 Viruses 771
249 Ga0207639_11150956 3300026041 Bacteria 728
250 Ga0207678_10004768 3300026067 Bacteria 12170
251 Ga0207708_10020510 3300026075 Unclassified 4985
252 Ga0207702_11309001 3300026078 Unclassified 719
253 Ga0207641_10341127 3300026088 Bacteria 1426
254 Ga0207641_10390300 3300026088 Bacteria 1335
255 Ga0207641_10479031 3300026088 Bacteria 1206
256 Ga0207641_10821760 3300026088 Bacteria 920
257 Ga0207641_11849667 3300026088 Unclassified 605
258 Ga0207676_10032130 3300026095 Bacteria 3953
259 Ga0207676_10098371 3300026095 Unclassified 2419
260 Ga0207676_10172841 3300026095 Bacteria 1884
261 Ga0207676_10758879 3300026095 Bacteria 944
262 Ga0207676_10794867 3300026095 Bacteria 923
263 Ga0207676_10900836 3300026095 Unclassified 868
264 Ga0207674_10002064 3300026116 Bacteria 25509
265 Ga0207674_10002406 3300026116 Bacteria 23609
266 Ga0207674_10102508 3300026116 Unclassified 2842
267 Ga0207683_10256173 3300026121 Unclassified 1597
268 Ga0207698_10380747 3300026142 Bacteria 1342
269 Ga0207698_10698394 3300026142 Bacteria 1009
270 Ga0207698_10779489 3300026142 Bacteria 957
271 Ga0207698_10831469 3300026142 Bacteria 927
272 Ga0207698_10919087 3300026142 Bacteria 883
273 Ga0207698_11496483 3300026142 Bacteria 690
274 Ga0268266_10001310 3300028379 Bacteria 30226
275 Ga0268266_10006608 3300028379 Bacteria 10586
276 Ga0268266_10052989 3300028379 Bacteria 3485
277 Ga0268266_10101412 3300028379 Unclassified 2537
278 Ga0268266_11034834 3300028379 Unclassified 794
279 Ga0268264_10300614 3300028381 Unclassified 1511
280 Ga0307408_100543364 3300031548 Bacteria 1024
281 Ga0307408_102475619 3300031548 Bacteria 505
282 Ga0307405_10100139 3300031731 Bacteria 1941
283 Ga0307405_10313388 3300031731 Bacteria 1195
284 Ga0307413_10017536 3300031824 Bacteria 3731
285 Ga0307413_10074465 3300031824 Bacteria 2150
286 Ga0307413_10077444 3300031824 Bacteria 2117
287 Ga0307413_10500659 3300031824 Unclassified 975
288 Ga0307410_10011302 3300031852 Bacteria 5100
289 Ga0307410_10021520 3300031852 Bacteria 3968
290 Ga0307410_10284010 3300031852 Bacteria 1300
291 Ga0307410_10820144 3300031852 Bacteria 792
292 Ga0307406_10014571 3300031901 Bacteria 4527
293 Ga0307406_10077262 3300031901 Bacteria 2202
294 Ga0307407_10008022 3300031903 Bacteria 4818
295 Ga0307407_10081564 3300031903 Bacteria 1958
296 Ga0307407_10147497 3300031903 Bacteria 1525
297 Ga0307412_10025769 3300031911 Bacteria 3646
298 Ga0307412_10580503 3300031911 Bacteria 946
299 Ga0307409_100023171 3300031995 Unclassified 4296
300 Ga0307409_100094775 3300031995 Bacteria 2457
301 Ga0307409_100161821 3300031995 Bacteria 1958
302 Ga0307409_100250433 3300031995 Bacteria 1619
303 Ga0307409_100980222 3300031995 Bacteria 862
304 Ga0307409_102419993 3300031995 Unclassified 554
305 Ga0307416_100066101 3300032002 Bacteria 2975
306 Ga0307416_100356383 3300032002 Bacteria 1483
307 Ga0307416_100972294 3300032002 Bacteria 951
308 Ga0307416_101266479 3300032002 Bacteria 843
309 Ga0307416_101648207 3300032002 Bacteria 746
310 Ga0307416_102392370 3300032002 Unclassified 628
311 Ga0307416_103078098 3300032002 Bacteria 558
312 Ga0307414_10029204 3300032004 Bacteria 3586
313 Ga0307414_10033156 3300032004 Bacteria 3410
314 Ga0307414_10034895 3300032004 Bacteria 3341
315 Ga0307414_10864821 3300032004 Unclassified 827
316 Ga0307414_11085730 3300032004 Unclassified 739
317 Ga0307411_10032070 3300032005 Bacteria 3242
318 Ga0307411_10060204 3300032005 Bacteria 2520
319 Ga0307411_10084774 3300032005 Bacteria 2192
320 Ga0307411_12084889 3300032005 Unclassified 530
321 Ga0307415_100004588 3300032126 Bacteria 7203
322 Ga0307415_100051890 3300032126 Bacteria 2786
323 Ga0307415_101067620 3300032126 Bacteria 754
324 Ga0307510_10048627 3300033180 Bacteria 4523
325 Ga0307510_10133258 3300033180 Bacteria 2150
326 Ga0307510_10498952 3300033180 Unclassified 660
327 Ga0373944_0308172 3300035089 Unclassified 595
328 Ga0373953_0501528 3300035117 Bacteria 538
329 Ga0373943_0003900 3300035170 Bacteria 6789
330 Ga0373961_0288848 3300035241 Bacteria 604
331 Ga0373937_2008249 3300036401 Unclassified 524
332 Ga0395899_0022233 3300037312 Bacteria 4810
333 Ga0395900_0087635 3300037418 Bacteria 3199
334 Ga0395900_0664538 3300037418 Bacteria 978
335 Ga0395900_0723103 3300037418 Unclassified 928
336 Ga0395905_0011130 3300037471 Bacteria 8701
337 Ga0395905_0074326 3300037471 Bacteria 3185
338 Ga0395905_0080237 3300037471 Bacteria 3058
339 Ga0395905_0158246 3300037471 Bacteria 2130
340 Ga0395905_0725905 3300037471 Bacteria 896
341 Ga0395905_0746354 3300037471 Bacteria 881
342 Ga0395905_1492686 3300037471 Unclassified 580
343 Ga0395901_0068621 3300038443 Bacteria 3693
344 Ga0395901_0576948 3300038443 Bacteria 1137
345 Ga0395901_1128803 3300038443 Bacteria 753
346 Ga0436365_0194019 3300039437 Bacteria 33376
347 Ga0436365_1302426 3300039437 Unclassified 674
348 Ga0436365_1648041 3300039437 Bacteria 6258
349 Ga0439439_0115542 3300041406 Bacteria 746
350 Ga0466967_0910077 3300045976 Bacteria 875
351 Ga0495617_016896 3300046452 Bacteria 2467
352 Ga0495603_0006534 3300046455 Bacteria 6992
353 Ga0495603_0095471 3300046455 Bacteria 1737
354 Ga0495629_0066718 3300046459 Bacteria 2511
355 Ga0495651_0008904 3300046462 Bacteria 7710
356 Ga0495580_0045846 3300046472 Bacteria 3104
357 Ga0495582_0037330 3300046473 Bacteria 2672
358 Ga0495605_0336144 3300046474 Bacteria 635
359 Ga0495664_0327147 3300046477 Unclassified 924
360 Ga0495585_0042591 3300046492 Bacteria 2542
361 Ga0495585_0217019 3300046492 Bacteria 967
362 Ga0495594_0000058 3300046499 Bacteria 48394
363 Ga0495594_0005643 3300046499 Bacteria 6435
364 Ga0495596_0066567 3300046500 Unclassified 1400
365 Ga0495607_0076829 3300046501 Bacteria 1846
366 Ga0495606_0244175 3300046507 Bacteria 999
367 Ga0495631_0023646 3300046518 Bacteria 2846
368 Ga0495643_0046321 3300046522 Bacteria 2358
369 Ga0495644_0000010 3300046523 Bacteria 106185
370 Ga0495648_0238617 3300046524 Bacteria 885
371 Ga0495666_0339376 3300046526 Bacteria 677
372 Ga0495642_0024800 3300046528 Bacteria 2374
373 Ga0495642_0078069 3300046528 Bacteria 1391
374 Ga0495652_0044154 3300046529 Bacteria 3839
375 Ga0495665_0486490 3300046531 Unclassified 622
376 Ga0495587_0129408 3300046536 Unclassified 1443
377 Ga0495609_0005346 3300046538 Bacteria 6780
378 Ga0495609_0021700 3300046538 Bacteria 2962
379 Ga0495645_0000877 3300046543 Bacteria 20506
380 Ga0495622_0077226 3300046557 Bacteria 1534
381 Ga0495633_0017864 3300046558 Bacteria 3613
382 Ga0495667_0324446 3300046559 Unclassified 974
383 Ga0495668_0024362 3300046616 Unclassified 3443
384 Ga0495634_0612204 3300046642 Bacteria 631
385 Ga0495611_0202470 3300046648 Bacteria 925
386 Ga0495625_0000689 3300046660 Bacteria 48170
387 Ga0495625_0007658 3300046660 Bacteria 9362
388 Ga0495625_0047851 3300046660 Bacteria 3083
389 Ga0495635_0938231 3300046663 Unclassified 553
390 Ga0495659_0024832 3300046664 Bacteria 2047
391 Ga0495588_0095222 3300046674 Bacteria 1561
392 Ga0495657_0244058 3300046675 Bacteria 1083
393 Ga0495599_0128080 3300046678 Bacteria 1577
394 Ga0495623_0148450 3300046679 Bacteria 1388
395 Ga0495646_0114481 3300046680 Bacteria 1532
396 Ga0495658_0532500 3300046683 Bacteria 752
397 Ga0495669_0024915 3300046684 Bacteria 2606
398 Ga0495613_0283137 3300046689 Unclassified 1151
399 Ga0495613_0395991 3300046689 Bacteria 942
400 Ga0495670_0018288 3300046691 Bacteria 3451
401 Ga0495671_0285350 3300046692 Bacteria 795
402 Ga0495649_0022690 3300046694 Bacteria 3511
403 Ga0495649_0163561 3300046694 Bacteria 1166
404 Ga0495649_0547049 3300046694 Bacteria 573
405 Ga0495600_0085341 3300046809 Bacteria 2060
406 Ga0495600_0689471 3300046809 Bacteria 615
407 Ga0495581_0035174 3300047315 Bacteria 2898
408 Ga0495636_0187636 3300047318 Bacteria 940
409 Ga0495676_0294303 3300047321 Bacteria 1096
410 Ga0495683_0096747 3300047323 Bacteria 1424
411 Ga0495683_0234622 3300047323 Bacteria 812
412 Ga0495687_040793 3300047443 Bacteria 2042
413 Ga0495677_0007591 3300047445 Bacteria 4050
414 Ga0495673_0028538 3300047469 Bacteria 2642
415 Ga0495681_0336754 3300047470 Bacteria 576
416 Ga0495684_0139754 3300047471 Bacteria 1816
417 Ga0495684_0190551 3300047471 Bacteria 1516
418 Ga0495686_0010400 3300047472 Bacteria 6623
419 Ga0495593_0114178 3300047673 Bacteria 1377
420 Ga0495602_0448051 3300048088 Unclassified 912
421 Ga0495614_0014569 3300048089 Bacteria 3439
422 Ga0496104_0129710 3300048907 Bacteria 2422
423 Ga0496104_0244263 3300048907 Unclassified 1708
424 Ga0496109_1791034 3300048912 Unclassified 547
425 Ga0496112_0124804 3300048915 Unclassified 2545
426 Ga0496112_0152002 3300048915 Unclassified 2282
427 Ga0496113_0469563 3300048916 Bacteria 1011
428 Ga0496126_0295609 3300048929 Unclassified 1338
429 Ga0501033_0155937 3300049570 Unclassified 1645
430 Ga0501034_0111582 3300049571 Bacteria 2725
431 Ga0501034_1323111 3300049571 Unclassified 597
432 Ga0501037_0022574 3300049573 Bacteria 4654
433 Ga0501037_0393805 3300049573 Unclassified 951
434 Ga0501037_0425355 3300049573 Bacteria 909
435 Ga0501038_0119065 3300049574 Unclassified 2180
436 Ga0501043_0139853 3300049579 Unclassified 1896
437 Ga0501047_0239050 3300049581 Unclassified 1667
438 Ga0501047_0751209 3300049581 Bacteria 791
439 Ga0501070_0939227 3300049586 Bacteria 673
440 Ga0501073_0173543 3300049589 Unclassified 1492
441 Ga0501073_0425160 3300049589 Bacteria 918
442 Ga0501076_0320192 3300049592 Bacteria 1272
443 Ga0501268_016843 3300049765 Bacteria 1214
444 Ga0501268_039547 3300049765 Bacteria 883
445 Ga0501035_0057971 3300049822 Unclassified 3452
446 Ga0501044_0009498 3300049823 Bacteria 10591
447 nmdc:mga09592_558396_c1 3300050508 Unclassified 983
448 nmdc:mga0qj67_364657_c1 3300050509 Bacteria 1167
449 nmdc:mga0qj67_454162_c1 3300050509 Bacteria 1032
450 nmdc:mga06r32_337483_c1 3300050510 Bacteria 1492
451 nmdc:mga0n895_55234_c1 3300050512 Unclassified 3908
452 nmdc:mga0a205_132198_c1 3300050515 Bacteria 2396
453 Ga0495601_0464910 3300053077 Unclassified 818
454 Ga0495612_0041816 3300053078 Unclassified 1870
455 Ga0500646_0237915 3300053090 Unclassified 637
456 Ga0500595_000036 3300053119 Bacteria 103200
457 Ga0500595_012078 3300053119 Bacteria 3351
458 Ga0500586_182831 3300053145 Unclassified 698
459 Ga0500661_000822 3300055283 Bacteria 5779
460 Ga0070683_100295108
461 LJNas_1020233
462 rootH1_10093831
463 rootH2_10309296
464 Ga0070658_10261742
465 Ga0070658_10624766
466 Ga0070658_11225903
467 Ga0070683_100019875
468 Ga0070683_100046952
469 Ga0070683_100427480
470 Ga0070690_100628219
471 Ga0070670_100344393
472 Ga0070670_100733565
473 Ga0070666_10079952
474 Ga0070666_10335822
475 Ga0070666_10564118
476 Ga0070680_100050576
477 Ga0070680_100230789
478 Ga0070660_100057030
479 Ga0070691_10351045
480 Ga0070661_100050887
481 Ga0070661_100055952
482 Ga0070661_100062830
483 Ga0070661_100110806
484 Ga0070661_101459895
485 Ga0070671_100064976
486 Ga0070671_101173692
487 Ga0070671_101306403
488 Ga0070659_100027424
489 Ga0070659_100039517
490 Ga0070659_100451130
491 Ga0070659_100848013
492 Ga0070667_101310237
493 Ga0070709_10552199
494 Ga0070709_11414031
495 Ga0070714_100020907
496 Ga0070713_100299954
497 Ga0070713_100347141
498 Ga0070711_101692616
499 Ga0070663_100169525
500 Ga0070663_100319008
501 Ga0070678_100176256
502 Ga0070681_10146100
503 Ga0070681_10457885
504 Ga0070681_10629143
505 Ga0068867_101362400
506 Ga0070685_10390972
507 Ga0070679_100002550
508 Ga0070679_100027940
509 Ga0070679_100051318
510 Ga0070679_100331834
511 Ga0070684_100023843
512 Ga0070684_100085820
513 Ga0070684_100085863
514 Ga0070684_100390412
515 Ga0070684_100484298
516 Ga0068853_100139698
517 Ga0068853_100212926
518 Ga0068853_100996239
519 Ga0070672_100783521
520 Ga0070686_101525198
521 Ga0070693_100532214
522 Ga0070665_100058575
523 Ga0070665_100061613
524 Ga0070665_100078285
525 Ga0070665_101066654
526 Ga0070665_101777733
527 Ga0068855_100239851
528 Ga0068855_100311641
529 Ga0068855_100483860
530 Ga0068855_101574165
531 Ga0070664_100014075
532 Ga0070664_100331112
533 Ga0070664_100504785
534 Ga0068857_100002244
535 Ga0068857_100024283
536 Ga0068857_100034742
537 Ga0068857_100226818
538 Ga0068857_101962211
539 Ga0068854_100011166
540 Ga0068854_101669449
541 Ga0068856_101128027
542 Ga0068856_101279597
543 Ga0068856_101695708
544 Ga0068852_100102194
545 Ga0068852_100544857
546 Ga0068852_100944112
547 Ga0068852_101155320
548 Ga0068852_101667958
549 Ga0068852_101725503
550 Ga0068852_102006207
551 Ga0068859_101351645
552 Ga0068864_100049725
553 Ga0068864_100205416
554 Ga0068864_100558595
555 Ga0068864_100937318
556 Ga0068851_10160533
557 Ga0068851_10511849
558 Ga0068851_10622025
559 Ga0068863_100081043
560 Ga0068863_100460987
561 Ga0068863_100589434
562 Ga0068863_102197518
563 Ga0068860_100389370
564 Ga0070717_12161698
565 Ga0070712_101064633
566 Ga0070712_101941999
567 Ga0068871_100861068
568 Ga0075430_100985072
569 Ga0075431_102097766
570 Ga0075433_10412607
571 Ga0075434_100009449
572 Ga0075429_100540046
573 Ga0075429_101545629
574 Ga0097620_101351641
575 Ga0105240_10005471
576 Ga0105240_10696074
577 Ga0105245_10783496
578 Ga0105247_10167558
579 Ga0105247_10358779
580 Ga0105247_11238380
581 Ga0114129_12445772
582 Ga0105241_10272731
583 Ga0105248_10611461
584 Ga0105237_10049282
585 Ga0105237_10670752
586 Ga0105238_10833091
587 Ga0105238_10968131
588 Ga0105238_11257084
589 Ga0105238_12088978
590 Ga0105239_10074500
591 Ga0105239_11038685
592 Ga0105239_11372173
593 Ga0157345_1031778
594 Ga0157373_10104561
595 Ga0157373_10997553
596 Ga0157371_10169374
597 Ga0157371_10477420
598 Ga0157371_10501927
599 Ga0157370_10019768
600 Ga0157369_10119866
601 Ga0157369_10220619
602 Ga0157369_10323403
603 Ga0157369_10706149
604 Ga0157369_10807720
605 Ga0157369_11061221
606 Ga0157369_11755448
607 Ga0157369_11987113
608 Ga0157369_12667610
609 Ga0157374_10005070
610 Ga0157374_10418941
611 Ga0157374_10973958
612 Ga0157378_10396746
613 Ga0163162_10026372
614 Ga0163162_13234925
615 Ga0157372_10007516
616 Ga0157372_10020997
617 Ga0157372_10068013
618 Ga0157372_10107892
619 Ga0157372_10396781
620 Ga0157372_10426089
621 Ga0157372_10804569
622 Ga0157375_10047370
623 Ga0157375_11896611
624 Ga0163163_10009898
625 Ga0157380_11121223
626 Ga0157380_12747344
627 Ga0157377_11433159
628 Ga0157376_10073904
629 Ga0157376_10254866
630 Ga0157376_10725067
631 Ga0213876_10010787
632 Ga0213876_10363479
633 Ga0207656_10024306
634 Ga0207692_10301283
635 Ga0207710_10559514
636 Ga0207680_10535750
637 Ga0207680_11088458
638 Ga0207647_10044900
639 Ga0207647_10066696
640 Ga0207705_10000405
641 Ga0207705_10570483
642 Ga0207654_10135043
643 Ga0207707_10155847
644 Ga0207707_10329189
645 Ga0207707_10515764
646 Ga0207695_10002055
647 Ga0207695_10061576
648 Ga0207695_10806919
649 Ga0207671_10273764
650 Ga0207671_10541525
651 Ga0207660_10060693
652 Ga0207657_10001086
653 Ga0207657_10092991
654 Ga0207649_10066001
655 Ga0207649_10077274
656 Ga0207649_10105904
657 Ga0207652_10004893
658 Ga0207652_10013643
659 Ga0207652_10278520
660 Ga0207652_10937735
661 Ga0207694_10364412
662 Ga0207694_10551814
663 Ga0207650_10469097
664 Ga0207650_10547771
665 Ga0207687_10117742
666 Ga0207700_10441391
667 Ga0207700_12044293
668 Ga0207664_10015874
669 Ga0207644_10063974
670 Ga0207644_11187053
671 Ga0207690_10005189
672 Ga0207690_10069846
673 Ga0207690_11125302
674 Ga0207690_11271785
675 Ga0207706_11221303
676 Ga0207686_10356809
677 Ga0207670_10771738
678 Ga0207669_10571970
679 Ga0207704_10752021
680 Ga0207691_10312068
681 Ga0207691_10444175
682 Ga0207711_10495707
683 Ga0207661_10050843
684 Ga0207661_10087207
685 Ga0207661_10090135
686 Ga0207661_10099752
687 Ga0207661_10230994
688 Ga0207661_10385390
689 Ga0207661_10510097
690 Ga0207661_10936985
691 Ga0207661_11113893
692 Ga0207661_11845776
693 Ga0207679_10401981
694 Ga0207679_10424851
695 Ga0207679_10747959
696 Ga0207667_10030810
697 Ga0207667_10083107
698 Ga0207667_10430100
699 Ga0207667_10797247
700 Ga0207667_10867891
701 Ga0207667_12193861
702 Ga0207640_10038214
703 Ga0207658_11343245
704 Ga0207658_11519750
705 Ga0207639_10189975
706 Ga0207639_10628322
707 Ga0207639_11029530
708 Ga0207639_11150956
709 Ga0207678_10004768
710 Ga0207708_10020510
711 Ga0207702_11309001
712 Ga0207641_10341127
713 Ga0207641_10390300
714 Ga0207641_10479031
715 Ga0207641_10821760
716 Ga0207641_11849667
717 Ga0207676_10032130
718 Ga0207676_10098371
719 Ga0207676_10172841
720 Ga0207676_10758879
721 Ga0207676_10794867
722 Ga0207676_10900836
723 Ga0207674_10002064
724 Ga0207674_10002406
725 Ga0207674_10102508
726 Ga0207683_10256173
727 Ga0207698_10380747
728 Ga0207698_10698394
729 Ga0207698_10779489
730 Ga0207698_10831469
731 Ga0207698_10919087
732 Ga0207698_11496483
733 Ga0268266_10001310
734 Ga0268266_10006608
735 Ga0268266_10052989
736 Ga0268266_10101412
737 Ga0268266_11034834
738 Ga0268264_10300614
739 Ga0307408_100543364
740 Ga0307408_102475619
741 Ga0307405_10100139
742 Ga0307405_10313388
743 Ga0307413_10017536
744 Ga0307413_10074465
745 Ga0307413_10077444
746 Ga0307413_10500659
747 Ga0307410_10011302
748 Ga0307410_10021520
749 Ga0307410_10284010
750 Ga0307410_10820144
751 Ga0307406_10014571
752 Ga0307406_10077262
753 Ga0307407_10008022
754 Ga0307407_10081564
755 Ga0307407_10147497
756 Ga0307412_10025769
757 Ga0307412_10580503
758 Ga0307409_100023171
759 Ga0307409_100094775
760 Ga0307409_100161821
761 Ga0307409_100250433
762 Ga0307409_100980222
763 Ga0307409_102419993
764 Ga0307416_100066101
765 Ga0307416_100356383
766 Ga0307416_100972294
767 Ga0307416_101266479
768 Ga0307416_101648207
769 Ga0307416_102392370
770 Ga0307416_103078098
771 Ga0307414_10029204
772 Ga0307414_10033156
773 Ga0307414_10034895
774 Ga0307414_10864821
775 Ga0307414_11085730
776 Ga0307411_10032070
777 Ga0307411_10060204
778 Ga0307411_10084774
779 Ga0307411_12084889
780 Ga0307415_100004588
781 Ga0307415_100051890
782 Ga0307415_101067620
783 Ga0307510_10048627
784 Ga0307510_10133258
785 Ga0307510_10498952
786 Ga0373944_0308172
787 Ga0373953_0501528
788 Ga0373943_0003900
789 Ga0373961_0288848
790 Ga0373937_2008249
791 Ga0395899_0022233
792 Ga0395900_0087635
793 Ga0395900_0664538
794 Ga0395900_0723103
795 Ga0395905_0011130
796 Ga0395905_0074326
797 Ga0395905_0080237
798 Ga0395905_0158246
799 Ga0395905_0725905
800 Ga0395905_0746354
801 Ga0395905_1492686
802 Ga0395901_0068621
803 Ga0395901_0576948
804 Ga0395901_1128803
805 Ga0436365_0194019
806 Ga0436365_1302426
807 Ga0436365_1648041
808 Ga0439439_0115542
809 Ga0466967_0910077
810 Ga0495617_016896
811 Ga0495603_0006534
812 Ga0495603_0095471
813 Ga0495629_0066718
814 Ga0495651_0008904
815 Ga0495580_0045846
816 Ga0495582_0037330
817 Ga0495605_0336144
818 Ga0495664_0327147
819 Ga0495585_0042591
820 Ga0495585_0217019
821 Ga0495594_0000058
822 Ga0495594_0005643
823 Ga0495596_0066567
824 Ga0495607_0076829
825 Ga0495606_0244175
826 Ga0495631_0023646
827 Ga0495643_0046321
828 Ga0495644_0000010
829 Ga0495648_0238617
830 Ga0495666_0339376
831 Ga0495642_0024800
832 Ga0495642_0078069
833 Ga0495652_0044154
834 Ga0495665_0486490
835 Ga0495587_0129408
836 Ga0495609_0005346
837 Ga0495609_0021700
838 Ga0495645_0000877
839 Ga0495622_0077226
840 Ga0495633_0017864
841 Ga0495667_0324446
842 Ga0495668_0024362
843 Ga0495634_0612204
844 Ga0495611_0202470
845 Ga0495625_0000689
846 Ga0495625_0007658
847 Ga0495625_0047851
848 Ga0495635_0938231
849 Ga0495659_0024832
850 Ga0495588_0095222
851 Ga0495657_0244058
852 Ga0495599_0128080
853 Ga0495623_0148450
854 Ga0495646_0114481
855 Ga0495658_0532500
856 Ga0495669_0024915
857 Ga0495613_0283137
858 Ga0495613_0395991
859 Ga0495670_0018288
860 Ga0495671_0285350
861 Ga0495649_0022690
862 Ga0495649_0163561
863 Ga0495649_0547049
864 Ga0495600_0085341
865 Ga0495600_0689471
866 Ga0495581_0035174
867 Ga0495636_0187636
868 Ga0495676_0294303
869 Ga0495683_0096747
870 Ga0495683_0234622
871 Ga0495687_040793
872 Ga0495677_0007591
873 Ga0495673_0028538
874 Ga0495681_0336754
875 Ga0495684_0139754
876 Ga0495684_0190551
877 Ga0495686_0010400
878 Ga0495593_0114178
879 Ga0495602_0448051
880 Ga0495614_0014569
881 Ga0496104_0129710
882 Ga0496104_0244263
883 Ga0496109_1791034
884 Ga0496112_0124804
885 Ga0496112_0152002
886 Ga0496113_0469563
887 Ga0496126_0295609
888 Ga0501033_0155937
889 Ga0501034_0111582
890 Ga0501034_1323111
891 Ga0501037_0022574
892 Ga0501037_0393805
893 Ga0501037_0425355
894 Ga0501038_0119065
895 Ga0501043_0139853
896 Ga0501047_0239050
897 Ga0501047_0751209
898 Ga0501070_0939227
899 Ga0501073_0173543
900 Ga0501073_0425160
901 Ga0501076_0320192
902 Ga0501268_016843
903 Ga0501268_039547
904 Ga0501035_0057971
905 Ga0501044_0009498
906 nmdc:mga09592_558396_c1
907 nmdc:mga0qj67_364657_c1
908 nmdc:mga0qj67_454162_c1
909 nmdc:mga06r32_337483_c1
910 nmdc:mga0n895_55234_c1
911 nmdc:mga0a205_132198_c1
912 Ga0495601_0464910
913 Ga0495612_0041816
914 Ga0500646_0237915
915 Ga0500595_000036
916 Ga0500595_012078
917 Ga0500586_182831
918 Ga0500661_000822

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End Superfamily
af_B0S7L8_29_293_1.25.40.20 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Ankyrin repeat-containing domain 0.373 25 40 1.25.40.20
af_B0S7L8_29_293_1.25.40.20 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Ankyrin repeat-containing domain 0.119 25 40 1.25.40.20
ID Description Score Start End GO Terms
AF-A0A2E5EF04-F1-model_v4 Uncharacterized protein 0.8821 1 63
AF-A0A166VQM3-F1-model_v4 deleted 0.8596 1 66
AF-A0A2E5EF04-F1-model_v4 Uncharacterized protein 0.8325 1 63
AF-A0A2E3RMS6-F1-model_v4 Uncharacterized protein 0.7997 1 69
AF-A0A2E3RMS6-F1-model_v4 Uncharacterized protein 0.7891 1 69

Map