F448301

General Info

Members Datasets Scaffolds Average Seq Length
459 250 918 237

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10092405|Ga0070676_100924052
Length 222
Sequence MPRLELEDVSKSFRGLRAVSRASFVVEAGTIVALIGPNGAGKTTIFNLIAGVHRPDSGDIRLHARSIAGLAPDEVCAVGVGRTFQLVKPFAGLSVLENAMVGALHKERTMAGARARATAVLERLGLAGKAALAAAHLTLADRRRLEVARALATRPSLLLLDEVMAGLRPAELTEHVMRAVMALSDQIVVLHHGEVIARGAPAAVVRDPSVVACYLGEEAPPL

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
136 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
137 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
138 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
139 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
140 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
141 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
142 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
144 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
146 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
147 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
148 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
149 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
150 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
151 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
152 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
153 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
154 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
157 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
158 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
162 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
163 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
164 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
165 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
166 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
167 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
168 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
169 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
170 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
171 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
172 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
173 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
174 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
175 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
176 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
177 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
178 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
179 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
180 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
181 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
182 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
183 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
184 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
185 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
186 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
187 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
188 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
189 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
190 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
191 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
192 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
193 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
194 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
199 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
200 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
201 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
204 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
205 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
206 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
207 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
208 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
222 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
223 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
224 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
225 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
226 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
227 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
228 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
229 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
230 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
231 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
232 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
236 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
237 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
238 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
239 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
242 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
243 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
244 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
245 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
246 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
247 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
248 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
249 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
250 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.44
Rhizosphere 99.56
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10092405 3300005328 Bacteria 1856
2 Ga0065707_10008722 3300005295 Bacteria 2655
3 Ga0065707_10042850 3300005295 Bacteria 972
4 Ga0065707_10255138 3300005295 Bacteria 1113
5 Ga0070676_10066603 3300005328 Bacteria 2152
6 Ga0070676_10173611 3300005328 Bacteria 1396
7 Ga0070690_100008951 3300005330 Bacteria 5785
8 Ga0070690_100072927 3300005330 Bacteria 2233
9 Ga0068869_100001168 3300005334 Bacteria 15386
10 Ga0068869_100232061 3300005334 Bacteria 1467
11 Ga0068869_100266814 3300005334 Bacteria 1372
12 Ga0070680_100000569 3300005336 Bacteria 25346
13 Ga0070682_100055726 3300005337 Bacteria 2484
14 Ga0068868_100005473 3300005338 Bacteria 8929
15 Ga0070689_100001976 3300005340 Bacteria 13287
16 Ga0070689_100003909 3300005340 Bacteria 9987
17 Ga0070689_100031381 3300005340 Bacteria 4037
18 Ga0070689_100096442 3300005340 Bacteria 2337
19 Ga0070689_100289105 3300005340 Bacteria 1362
20 Ga0070689_100495506 3300005340 Bacteria 1046
21 Ga0070691_10010450 3300005341 Bacteria 4235
22 Ga0070691_10012206 3300005341 Bacteria 3934
23 Ga0070687_100000380 3300005343 Bacteria 15140
24 Ga0070687_100219196 3300005343 Bacteria 1164
25 Ga0070687_100451687 3300005343 Bacteria 855
26 Ga0070692_10006328 3300005345 Bacteria 5136
27 Ga0070692_10008750 3300005345 Bacteria 4527
28 Ga0070692_10149540 3300005345 Bacteria 1329
29 Ga0070668_100196515 3300005347 Bacteria 1654
30 Ga0070669_100008181 3300005353 Bacteria 7470
31 Ga0070671_100297179 3300005355 Bacteria 1375
32 Ga0070674_100000745 3300005356 Bacteria 16683
33 Ga0070673_100000416 3300005364 Bacteria 22479
34 Ga0070688_100322955 3300005365 Bacteria 1122
35 Ga0070667_100362963 3300005367 Bacteria 1313
36 Ga0070703_10006637 3300005406 Bacteria 3240
37 Ga0070701_10038531 3300005438 Bacteria 2419
38 Ga0070705_100001474 3300005440 Bacteria 12452
39 Ga0070705_100026229 3300005440 Bacteria 3170
40 Ga0070705_100084842 3300005440 Bacteria 1956
41 Ga0070700_100001483 3300005441 Bacteria 11686
42 Ga0070694_100001869 3300005444 Bacteria 12459
43 Ga0070694_100024990 3300005444 Bacteria 3861
44 Ga0070694_100044205 3300005444 Bacteria 2981
45 Ga0070694_100076338 3300005444 Bacteria 2319
46 Ga0070708_100312640 3300005445 Bacteria 1480
47 Ga0070678_100151202 3300005456 Bacteria 1870
48 Ga0070678_100227561 3300005456 Bacteria 1553
49 Ga0070662_100050116 3300005457 Bacteria 3012
50 Ga0068867_100002965 3300005459 Bacteria 11952
51 Ga0070685_10037332 3300005466 Bacteria 2751
52 Ga0070706_100091531 3300005467 Bacteria 2821
53 Ga0070698_100011110 3300005471 Bacteria 9567
54 Ga0070698_100216561 3300005471 Bacteria 1849
55 Ga0070699_100011660 3300005518 Bacteria 7587
56 Ga0070679_100128070 3300005530 Bacteria 2520
57 Ga0070684_100176772 3300005535 Bacteria 1940
58 Ga0068853_100498334 3300005539 Bacteria 1150
59 Ga0070672_100006714 3300005543 Bacteria 7759
60 Ga0070672_100009805 3300005543 Bacteria 6618
61 Ga0070672_100280765 3300005543 Bacteria 1408
62 Ga0070686_100002312 3300005544 Bacteria 10524
63 Ga0070686_100028428 3300005544 Bacteria 3391
64 Ga0070686_100217610 3300005544 Bacteria 1379
65 Ga0070695_100000728 3300005545 Bacteria 17589
66 Ga0070695_100012471 3300005545 Bacteria 5102
67 Ga0070695_100034347 3300005545 Bacteria 3179
68 Ga0070695_100102880 3300005545 Bacteria 1926
69 Ga0070695_100577364 3300005545 Bacteria 880
70 Ga0070696_100002611 3300005546 Bacteria 11950
71 Ga0070696_100013198 3300005546 Bacteria 5544
72 Ga0070696_100368520 3300005546 Bacteria 1116
73 Ga0070693_100000072 3300005547 Bacteria 41480
74 Ga0070693_100240375 3300005547 Bacteria 1196
75 Ga0070704_100001974 3300005549 Bacteria 11360
76 Ga0070704_100010675 3300005549 Bacteria 5594
77 Ga0070704_100074829 3300005549 Bacteria 2472
78 Ga0070704_100255869 3300005549 Bacteria 1440
79 Ga0068855_100014032 3300005563 Bacteria 9658
80 Ga0068857_100293865 3300005577 Bacteria 1496
81 Ga0068854_100000912 3300005578 Bacteria 17764
82 Ga0068856_100013894 3300005614 Bacteria 7788
83 Ga0068856_100769065 3300005614 Bacteria 983
84 Ga0070702_100000084 3300005615 Bacteria 27525
85 Ga0070702_100103458 3300005615 Bacteria 1751
86 Ga0070702_100270763 3300005615 Bacteria 1161
87 Ga0068852_100655863 3300005616 Bacteria 1057
88 Ga0068852_100678134 3300005616 Bacteria 1040
89 Ga0068859_100007866 3300005617 Bacteria 10817
90 Ga0068859_100279192 3300005617 Bacteria 1763
91 Ga0068859_100654437 3300005617 Bacteria 1143
92 Ga0068859_100700108 3300005617 Bacteria 1104
93 Ga0068864_100287914 3300005618 Bacteria 1535
94 Ga0068866_10001152 3300005718 Bacteria 11621
95 Ga0068866_10050140 3300005718 Bacteria 2119
96 Ga0068861_100002361 3300005719 Bacteria 12279
97 Ga0068861_100281832 3300005719 Bacteria 1431
98 Ga0068858_100004430 3300005842 Bacteria 13773
99 Ga0068858_100091553 3300005842 Bacteria 2830
100 Ga0068858_100150881 3300005842 Bacteria 2185
101 Ga0068860_100008011 3300005843 Bacteria 10535
102 Ga0068860_100400578 3300005843 Bacteria 1358
103 Ga0068860_100416634 3300005843 Bacteria 1331
104 Ga0068862_100002836 3300005844 Bacteria 15212
105 Ga0068862_100064309 3300005844 Bacteria 3158
106 Ga0068862_100276515 3300005844 Bacteria 1537
107 Ga0081539_10000513 3300005985 Bacteria 80514
108 Ga0097621_100000794 3300006237 Bacteria 22198
109 Ga0068871_100002185 3300006358 Bacteria 13292
110 Ga0068871_100040552 3300006358 Bacteria 3729
111 Ga0075428_100014260 3300006844 Bacteria 8840
112 Ga0075430_100001038 3300006846 Bacteria 21949
113 Ga0075430_100008855 3300006846 Bacteria 8493
114 Ga0075430_100329480 3300006846 Bacteria 1262
115 Ga0075431_100110947 3300006847 Bacteria 2831
116 Ga0075431_100835849 3300006847 Bacteria 893
117 Ga0075433_10047680 3300006852 Bacteria 3727
118 Ga0075433_10325488 3300006852 Bacteria 1360
119 Ga0075433_10410295 3300006852 Bacteria 1195
120 Ga0075433_10732759 3300006852 Bacteria 865
121 Ga0075434_100001156 3300006871 Bacteria 21811
122 Ga0075434_100022526 3300006871 Bacteria 6134
123 Ga0075434_100028590 3300006871 Bacteria 5480
124 Ga0075434_100321842 3300006871 Bacteria 1567
125 Ga0075429_100000358 3300006880 Bacteria 33554
126 Ga0075429_100000365 3300006880 Bacteria 33361
127 Ga0075429_100019602 3300006880 Bacteria 5863
128 Ga0068865_100002527 3300006881 Bacteria 10831
129 Ga0068865_100004249 3300006881 Bacteria 8636
130 Ga0075436_100007374 3300006914 Bacteria 7519
131 Ga0075436_100010299 3300006914 Bacteria 6402
132 Ga0075436_100010678 3300006914 Bacteria 6299
133 Ga0075436_100013506 3300006914 Bacteria 5592
134 Ga0075436_100024871 3300006914 Bacteria 4118
135 Ga0075436_100035433 3300006914 Bacteria 3443
136 Ga0075436_100177745 3300006914 Bacteria 1504
137 Ga0075436_100241172 3300006914 Bacteria 1286
138 Ga0097620_100007866 3300006931 Bacteria 10817
139 Ga0097620_100279196 3300006931 Bacteria 1763
140 Ga0097620_100334898 3300006931 Bacteria 1608
141 Ga0097620_100654420 3300006931 Bacteria 1143
142 Ga0097620_100700094 3300006931 Bacteria 1104
143 Ga0075435_100004362 3300007076 Bacteria 9718
144 Ga0075435_100045816 3300007076 Bacteria 3507
145 Ga0075435_100286580 3300007076 Bacteria 1406
146 Ga0075435_100289275 3300007076 Bacteria 1400
147 Ga0099794_10011936 3300007265 Bacteria 3734
148 Ga0099794_10202346 3300007265 Bacteria 1017
149 Ga0111539_10007875 3300009094 Bacteria 13601
150 Ga0111539_10063524 3300009094 Bacteria 4369
151 Ga0111539_10079169 3300009094 Bacteria 3866
152 Ga0111539_10096067 3300009094 Bacteria 3481
153 Ga0111539_11065153 3300009094 Bacteria 940
154 Ga0105245_10004314 3300009098 Bacteria 12589
155 Ga0105245_10043462 3300009098 Bacteria 4008
156 Ga0114129_10045425 3300009147 Bacteria 6175
157 Ga0114129_10265483 3300009147 Bacteria 2298
158 Ga0114129_11483626 3300009147 Bacteria 834
159 Ga0105243_10004238 3300009148 Bacteria 11365
160 Ga0105243_10156986 3300009148 Bacteria 1957
161 Ga0105241_10442577 3300009174 Bacteria 1148
162 Ga0105242_10004218 3300009176 Bacteria 11202
163 Ga0105242_10009439 3300009176 Bacteria 7477
164 Ga0105249_10004285 3300009553 Bacteria 12330
165 Ga0105249_10262132 3300009553 Bacteria 1718
166 Ga0105239_10211734 3300010375 Bacteria 2173
167 Ga0105246_10036970 3300011119 Bacteria 3274
168 Ga0157378_10022760 3300013297 Bacteria 5515
169 Ga0163162_10053092 3300013306 Bacteria 4073
170 Ga0157372_10359530 3300013307 Bacteria 1696
171 Ga0157380_10513214 3300014326 Bacteria 1167
172 Ga0157376_10106781 3300014969 Bacteria 2457
173 Ga0207642_10000905 3300025899 Bacteria 9302
174 Ga0207688_10005703 3300025901 Bacteria 6770
175 Ga0207680_10108529 3300025903 Bacteria 1796
176 Ga0207647_10072271 3300025904 Bacteria 2080
177 Ga0207647_10291153 3300025904 Bacteria 931
178 Ga0207645_10023749 3300025907 Bacteria 3981
179 Ga0207645_10239954 3300025907 Bacteria 1197
180 Ga0207645_10288961 3300025907 Bacteria 1090
181 Ga0207684_10114492 3300025910 Bacteria 2309
182 Ga0207707_10004784 3300025912 Bacteria 11874
183 Ga0207707_10387692 3300025912 Bacteria 1200
184 Ga0207660_10221412 3300025917 Bacteria 1485
185 Ga0207662_10000133 3300025918 Bacteria 35913
186 Ga0207662_10029452 3300025918 Bacteria 3181
187 Ga0207662_10044010 3300025918 Bacteria 2635
188 Ga0207662_10420836 3300025918 Bacteria 909
189 Ga0207652_10136479 3300025921 Bacteria 2191
190 Ga0207652_10145116 3300025921 Bacteria 2123
191 Ga0207681_10001721 3300025923 Bacteria 14068
192 Ga0207687_10003332 3300025927 Bacteria 10849
193 Ga0207687_10068454 3300025927 Bacteria 2529
194 Ga0207706_10017215 3300025933 Bacteria 6515
195 Ga0207686_10002374 3300025934 Bacteria 10271
196 Ga0207686_10010094 3300025934 Bacteria 5136
197 Ga0207709_10000442 3300025935 Bacteria 38909
198 Ga0207670_10016091 3300025936 Bacteria 4487
199 Ga0207670_10109576 3300025936 Bacteria 1987
200 Ga0207669_10003533 3300025937 Bacteria 6767
201 Ga0207704_10000969 3300025938 Bacteria 12703
202 Ga0207704_10001676 3300025938 Bacteria 9919
203 Ga0207665_10045599 3300025939 Bacteria 2935
204 Ga0207691_10014659 3300025940 Bacteria 7473
205 Ga0207691_10037092 3300025940 Bacteria 4514
206 Ga0207691_10793114 3300025940 Bacteria 796
207 Ga0207689_10004727 3300025942 Bacteria 12280
208 Ga0207689_10171465 3300025942 Bacteria 1789
209 Ga0207689_10298388 3300025942 Bacteria 1335
210 Ga0207689_10658951 3300025942 Bacteria 882
211 Ga0207667_10005294 3300025949 Bacteria 15734
212 Ga0207651_10005887 3300025960 Bacteria 6342
213 Ga0207712_10289257 3300025961 Bacteria 1340
214 Ga0207668_10038714 3300025972 Bacteria 3203
215 Ga0207640_10100322 3300025981 Bacteria 2028
216 Ga0207658_10151998 3300025986 Bacteria 1887
217 Ga0207677_10003016 3300026023 Bacteria 8890
218 Ga0207703_10006526 3300026035 Bacteria 9306
219 Ga0207703_10012473 3300026035 Bacteria 6626
220 Ga0207703_10141444 3300026035 Bacteria 2089
221 Ga0207639_10333931 3300026041 Bacteria 1350
222 Ga0207708_10000164 3300026075 Bacteria 52172
223 Ga0207708_10041310 3300026075 Bacteria 3516
224 Ga0207708_10223602 3300026075 Bacteria 1509
225 Ga0207708_10392727 3300026075 Bacteria 1146
226 Ga0207702_10640212 3300026078 Bacteria 1045
227 Ga0207648_10001660 3300026089 Bacteria 24369
228 Ga0207648_10534420 3300026089 Bacteria 1075
229 Ga0207676_10629422 3300026095 Bacteria 1033
230 Ga0207675_100001376 3300026118 Bacteria 24369
231 Ga0207675_100028779 3300026118 Bacteria 5176
232 Ga0207683_10056128 3300026121 Bacteria 3454
233 Ga0207683_10178268 3300026121 Bacteria 1926
234 Ga0209969_1000301 3300027360 Bacteria 6604
235 Ga0209967_1000863 3300027364 Bacteria 3897
236 Ga0210000_1000836 3300027462 Bacteria 4268
237 Ga0210000_1002459 3300027462 Bacteria 2635
238 Ga0210000_1018362 3300027462 Bacteria 1062
239 Ga0209995_1018804 3300027471 Bacteria 1140
240 Ga0209968_1001592 3300027526 Bacteria 3429
241 Ga0209999_1012365 3300027543 Bacteria 1545
242 Ga0209983_1014854 3300027665 Bacteria 1605
243 Ga0209588_1087578 3300027671 Bacteria 1004
244 Ga0209971_1006619 3300027682 Bacteria 2743
245 Ga0209966_1004204 3300027695 Bacteria 2435
246 Ga0209974_10005420 3300027876 Bacteria 4489
247 Ga0207428_10001986 3300027907 Bacteria 20756
248 Ga0207428_10031153 3300027907 Bacteria 4405
249 Ga0207428_10087848 3300027907 Bacteria 2418
250 Ga0268265_10014579 3300028380 Bacteria 5357
251 Ga0268265_10531590 3300028380 Bacteria 1113
252 Ga0268264_10003329 3300028381 Bacteria 13889
253 Ga0268264_10180004 3300028381 Bacteria 1919
254 Ga0307408_100145649 3300031548 Bacteria 1864
255 Ga0265314_10140612 3300031711 Bacteria 1493
256 Ga0307411_10396891 3300032005 Bacteria 1139
257 Ga0373930_0011928 3300034816 Bacteria 1577
258 Ga0373950_0021170 3300034818 Bacteria 1149
259 Ga0373938_0010958 3300034957 Bacteria 1677
260 Ga0373926_0001043 3300035083 Bacteria 8132
261 Ga0373926_0230159 3300035083 Bacteria 716
262 Ga0373929_0004584 3300035085 Bacteria 2476
263 Ga0373934_0118789 3300035086 Bacteria 1075
264 Ga0373949_0004221 3300035090 Bacteria 3317
265 Ga0373923_0210045 3300035111 Bacteria 902
266 Ga0373932_0001600 3300035112 Bacteria 6234
267 Ga0373936_0084939 3300035113 Bacteria 1321
268 Ga0373939_0039226 3300035114 Bacteria 1416
269 Ga0373941_0002397 3300035115 Bacteria 4122
270 Ga0373941_0020540 3300035115 Bacteria 1853
271 Ga0373945_0031480 3300035116 Bacteria 1874
272 Ga0373953_0006183 3300035117 Bacteria 3934
273 Ga0373953_0061876 3300035117 Bacteria 1532
274 Ga0373954_0000075 3300035118 Bacteria 35026
275 Ga0373960_0062974 3300035121 Bacteria 1129
276 Ga0373943_0012312 3300035170 Bacteria 3848
277 Ga0373943_0123616 3300035170 Bacteria 1377
278 Ga0373946_0018440 3300035171 Bacteria 2680
279 Ga0373942_0073716 3300035207 Bacteria 1001
280 Ga0373931_0000468 3300035691 Bacteria 16517
281 Ga0373931_0033373 3300035691 Bacteria 2667
282 Ga0373931_0057469 3300035691 Bacteria 2086
283 Ga0373935_0004450 3300035692 Bacteria 8226
284 Ga0373935_0129613 3300035692 Bacteria 1694
285 Ga0373927_0008159 3300035695 Bacteria 7063
286 Ga0373927_0162691 3300035695 Bacteria 1462
287 Ga0373933_0007919 3300035724 Bacteria 5798
288 Ga0373947_0002856 3300035725 Bacteria 10316
289 Ga0373947_0004222 3300035725 Bacteria 8424
290 Ga0373937_0000418 3300036401 Bacteria 39714
291 Ga0373937_0004735 3300036401 Bacteria 11574
292 Ga0373925_0013043 3300037068 Bacteria 6017
293 Ga0373925_0040974 3300037068 Bacteria 3430
294 Ga0451807_0430782 3300041486 Bacteria 3953
295 Ga0439441_005565 3300042001 Bacteria 1966
296 Ga0439451_023609 3300042009 Bacteria 1239
297 Ga0439456_034333 3300042013 Bacteria 1092
298 Ga0439435_0000044 3300042436 Bacteria 14055
299 Ga0439435_0006179 3300042436 Bacteria 2681
300 Ga0439435_0011060 3300042436 Bacteria 2158
301 Ga0439444_0001820 3300042437 Bacteria 2828
302 Ga0439460_0002523 3300042461 Bacteria 4419
303 Ga0439460_0018464 3300042461 Bacteria 1878
304 Ga0451577_0108217 3300042876 Bacteria 2485
305 Ga0451577_0890236 3300042876 Bacteria 802
306 Ga0466963_0184289 3300044694 Bacteria 1458
307 Ga0451576_0000360 3300045051 Bacteria 109145
308 Ga0451576_0036416 3300045051 Bacteria 5216
309 Ga0451576_0043895 3300045051 Bacteria 4715
310 Ga0466967_0009548 3300045976 Bacteria 7207
311 Ga0495592_0006561 3300046454 Bacteria 8670
312 Ga0495592_0046054 3300046454 Bacteria 3252
313 Ga0495603_0039695 3300046455 Bacteria 2819
314 Ga0495651_0081427 3300046462 Bacteria 2444
315 Ga0495580_0008583 3300046472 Bacteria 8107
316 Ga0495639_0020416 3300046475 Bacteria 2895
317 Ga0495662_0002748 3300046476 Bacteria 8891
318 Ga0495608_0012778 3300046511 Bacteria 5826
319 Ga0495628_0050021 3300046516 Bacteria 3307
320 Ga0495630_0001728 3300046517 Bacteria 15247
321 Ga0495630_0032896 3300046517 Bacteria 3866
322 Ga0495630_0103731 3300046517 Bacteria 2152
323 Ga0495663_0119084 3300046525 Bacteria 883
324 Ga0495642_0045182 3300046528 Bacteria 1800
325 Ga0495640_0005587 3300046533 Bacteria 9999
326 Ga0495640_0066893 3300046533 Bacteria 2422
327 Ga0495586_0005428 3300046535 Bacteria 6817
328 Ga0495587_0135178 3300046536 Bacteria 1409
329 Ga0495621_0048640 3300046539 Bacteria 1511
330 Ga0495621_0111773 3300046539 Bacteria 1048
331 Ga0495667_0017187 3300046559 Bacteria 4886
332 Ga0495667_0227287 3300046559 Bacteria 1190
333 Ga0495656_0215060 3300046615 Bacteria 959
334 Ga0495634_0010834 3300046642 Bacteria 6667
335 Ga0495634_0088226 3300046642 Bacteria 2018
336 Ga0495635_0064801 3300046663 Bacteria 2508
337 Ga0495635_0131689 3300046663 Bacteria 1705
338 Ga0495599_0196071 3300046678 Bacteria 1241
339 Ga0495623_0216740 3300046679 Bacteria 1093
340 Ga0495646_0199018 3300046680 Bacteria 1092
341 Ga0495647_0001506 3300046681 Bacteria 7215
342 Ga0495647_0021169 3300046681 Bacteria 2340
343 Ga0495658_0025760 3300046683 Bacteria 3147
344 Ga0495669_0006231 3300046684 Bacteria 4976
345 Ga0495613_0022406 3300046689 Bacteria 4708
346 Ga0495624_0024962 3300046690 Bacteria 3931
347 Ga0495600_0020310 3300046809 Bacteria 4248
348 Ga0495604_0023168 3300047317 Bacteria 4956
349 Ga0495604_0167522 3300047317 Bacteria 1548
350 Ga0495636_0002229 3300047318 Bacteria 7441
351 Ga0495674_0076671 3300047319 Bacteria 2875
352 Ga0495676_0038851 3300047321 Bacteria 3949
353 Ga0495680_0004705 3300047322 Bacteria 12987
354 Ga0495680_0090449 3300047322 Bacteria 2296
355 Ga0495675_0161218 3300047444 Bacteria 1381
356 Ga0495684_0315424 3300047471 Bacteria 1119
357 Ga0495593_0116129 3300047673 Bacteria 1364
358 Ga0495602_0291865 3300048088 Bacteria 1197
359 Ga0496102_0840459 3300048905 Bacteria 840
360 Ga0501033_0008510 3300049570 Bacteria 7939
361 Ga0501033_0045728 3300049570 Bacteria 3257
362 Ga0501036_0000244 3300049572 Bacteria 36661
363 Ga0501037_0002554 3300049573 Bacteria 13160
364 Ga0501038_0000368 3300049574 Bacteria 39009
365 Ga0501038_0390057 3300049574 Bacteria 1079
366 Ga0501039_0001872 3300049575 Bacteria 15555
367 Ga0501039_0244433 3300049575 Bacteria 1411
368 Ga0501039_0245288 3300049575 Bacteria 1408
369 Ga0501040_0007447 3300049576 Bacteria 7089
370 Ga0501040_0011721 3300049576 Bacteria 5735
371 Ga0501040_0085142 3300049576 Bacteria 2194
372 Ga0501040_0098536 3300049576 Bacteria 2037
373 Ga0501040_0125643 3300049576 Bacteria 1802
374 Ga0501040_0347299 3300049576 Bacteria 1063
375 Ga0501041_0002205 3300049577 Bacteria 11003
376 Ga0501041_0025087 3300049577 Bacteria 3583
377 Ga0501041_0043217 3300049577 Bacteria 2740
378 Ga0501042_0001912 3300049578 Bacteria 12522
379 Ga0501042_0055813 3300049578 Bacteria 2819
380 Ga0501042_0062457 3300049578 Bacteria 2662
381 Ga0501042_0400992 3300049578 Bacteria 994
382 Ga0501043_0024297 3300049579 Bacteria 4756
383 Ga0501046_0001501 3300049580 Bacteria 22294
384 Ga0501046_0064562 3300049580 Bacteria 2858
385 Ga0501048_0000485 3300049582 Bacteria 27770
386 Ga0501048_0362158 3300049582 Bacteria 1035
387 Ga0501068_0003258 3300049584 Bacteria 8704
388 Ga0501068_0136222 3300049584 Bacteria 1538
389 Ga0501069_0106277 3300049585 Bacteria 1596
390 Ga0501070_0030634 3300049586 Bacteria 4508
391 Ga0501071_0111129 3300049587 Bacteria 2025
392 Ga0501072_0000928 3300049588 Bacteria 21567
393 Ga0501074_0003865 3300049590 Bacteria 10668
394 Ga0501074_0146913 3300049590 Bacteria 1686
395 Ga0501075_0002601 3300049591 Bacteria 12056
396 Ga0501075_0124515 3300049591 Bacteria 1962
397 Ga0501075_0398446 3300049591 Bacteria 1049
398 Ga0501076_0017236 3300049592 Bacteria 5485
399 Ga0501076_0060146 3300049592 Bacteria 3022
400 Ga0501077_0004853 3300049593 Bacteria 8168
401 Ga0501077_0060994 3300049593 Bacteria 2393
402 Ga0501079_0001130 3300049741 Bacteria 18615
403 Ga0501080_0013758 3300049742 Bacteria 7451
404 Ga0501080_0039043 3300049742 Bacteria 4430
405 Ga0501081_0000895 3300049743 Bacteria 17656
406 Ga0501081_0015350 3300049743 Bacteria 5053
407 Ga0501081_0143668 3300049743 Bacteria 1711
408 Ga0501035_0009479 3300049822 Bacteria 9052
409 Ga0501044_0041904 3300049823 Bacteria 4766
410 Ga0501045_0000136 3300049824 Bacteria 38497
411 Ga0501045_0016469 3300049824 Bacteria 5252
412 nmdc:mga05p37_13591_c2 3300050507 Bacteria 6115
413 nmdc:mga05p37_421_c1 3300050507 Bacteria 45929
414 nmdc:mga05p37_846_c1 3300050507 Bacteria 34377
415 nmdc:mga09592_419_c1 3300050508 Bacteria 31189
416 nmdc:mga09592_561_c1 3300050508 Bacteria 28236
417 nmdc:mga0qj67_100524_c1 3300050509 Bacteria 2332
418 nmdc:mga0qj67_10255_c1 3300050509 Bacteria 6998
419 nmdc:mga0qj67_295084_c1 3300050509 Bacteria 1314
420 nmdc:mga0qj67_6756_c1 3300050509 Bacteria 8433
421 nmdc:mga0qj67_886_c1 3300050509 Bacteria 20528
422 nmdc:mga06r32_11129_c1 3300050510 Bacteria 8100
423 nmdc:mga06r32_2835_c1 3300050510 Bacteria 15554
424 nmdc:mga06r32_51135_c1 3300050510 Bacteria 3954
425 nmdc:mga06r32_511492_c1 3300050510 Bacteria 1177
426 nmdc:mga08y16_10933_c1 3300050511 Bacteria 9532
427 nmdc:mga08y16_144001_c1 3300050511 Bacteria 2477
428 nmdc:mga08y16_1688_c1 3300050511 Bacteria 22410
429 nmdc:mga08y16_193199_c1 3300050511 Bacteria 2111
430 nmdc:mga08y16_279907_c1 3300050511 Bacteria 1721
431 nmdc:mga0n895_11352_c1 3300050512 Bacteria 7941
432 nmdc:mga0n895_331783_c1 3300050512 Bacteria 1541
433 nmdc:mga0n895_5169_c1 3300050512 Bacteria 10860
434 nmdc:mga0n895_98316_c1 3300050512 Bacteria 2934
435 nmdc:mga0rr50_141323_c1 3300050513 Bacteria 1937
436 nmdc:mga0rr50_182671_c1 3300050513 Bacteria 1715
437 nmdc:mga0rr50_473067_c1 3300050513 Bacteria 1064
438 nmdc:mga0rr50_489024_c1 3300050513 Bacteria 1045
439 nmdc:mga0rr50_597_c1 3300050513 Bacteria 19339
440 nmdc:mga0rr50_61971_c1 3300050513 Bacteria 2820
441 nmdc:mga0rr50_63090_c1 3300050513 Bacteria 2797
442 nmdc:mga08x19_16055_c1 3300050514 Bacteria 4562
443 nmdc:mga08x19_34921_c1 3300050514 Bacteria 3180
444 nmdc:mga08x19_4007_c1 3300050514 Bacteria 8763
445 nmdc:mga08x19_59889_c1 3300050514 Bacteria 2465
446 nmdc:mga08x19_680_c1 3300050514 Bacteria 21801
447 nmdc:mga08x19_6937_c1 3300050514 Bacteria 6728
448 nmdc:mga0a205_171094_c1 3300050515 Bacteria 1695
449 nmdc:mga0a205_292469_c1 3300050515 Bacteria 1503
450 nmdc:mga0a205_496431_c1 3300050515 Bacteria 1078
451 nmdc:mga0a205_55782_c1 3300050515 Bacteria 3815
452 Ga0495601_0065983 3300053077 Bacteria 2304
453 Ga0495619_0279667 3300053085 Bacteria 1156
454 Ga0501084_0007901 3300054114 Bacteria 8756
455 Ga0590071_009960 3300059421 Bacteria 2228
456 Ga0501082_0002798 3300060353 Bacteria 15222
457 Ga0530510_0000301 3300061734 Bacteria 31442
458 Ga0530510_0139057 3300061734 Bacteria 1788
459 Ga0530510_0349280 3300061734 Bacteria 1111
460 Ga0070676_10092405
461 Ga0065707_10008722
462 Ga0065707_10042850
463 Ga0065707_10255138
464 Ga0070676_10066603
465 Ga0070676_10173611
466 Ga0070690_100008951
467 Ga0070690_100072927
468 Ga0068869_100001168
469 Ga0068869_100232061
470 Ga0068869_100266814
471 Ga0070680_100000569
472 Ga0070682_100055726
473 Ga0068868_100005473
474 Ga0070689_100001976
475 Ga0070689_100003909
476 Ga0070689_100031381
477 Ga0070689_100096442
478 Ga0070689_100289105
479 Ga0070689_100495506
480 Ga0070691_10010450
481 Ga0070691_10012206
482 Ga0070687_100000380
483 Ga0070687_100219196
484 Ga0070687_100451687
485 Ga0070692_10006328
486 Ga0070692_10008750
487 Ga0070692_10149540
488 Ga0070668_100196515
489 Ga0070669_100008181
490 Ga0070671_100297179
491 Ga0070674_100000745
492 Ga0070673_100000416
493 Ga0070688_100322955
494 Ga0070667_100362963
495 Ga0070703_10006637
496 Ga0070701_10038531
497 Ga0070705_100001474
498 Ga0070705_100026229
499 Ga0070705_100084842
500 Ga0070700_100001483
501 Ga0070694_100001869
502 Ga0070694_100024990
503 Ga0070694_100044205
504 Ga0070694_100076338
505 Ga0070708_100312640
506 Ga0070678_100151202
507 Ga0070678_100227561
508 Ga0070662_100050116
509 Ga0068867_100002965
510 Ga0070685_10037332
511 Ga0070706_100091531
512 Ga0070698_100011110
513 Ga0070698_100216561
514 Ga0070699_100011660
515 Ga0070679_100128070
516 Ga0070684_100176772
517 Ga0068853_100498334
518 Ga0070672_100006714
519 Ga0070672_100009805
520 Ga0070672_100280765
521 Ga0070686_100002312
522 Ga0070686_100028428
523 Ga0070686_100217610
524 Ga0070695_100000728
525 Ga0070695_100012471
526 Ga0070695_100034347
527 Ga0070695_100102880
528 Ga0070695_100577364
529 Ga0070696_100002611
530 Ga0070696_100013198
531 Ga0070696_100368520
532 Ga0070693_100000072
533 Ga0070693_100240375
534 Ga0070704_100001974
535 Ga0070704_100010675
536 Ga0070704_100074829
537 Ga0070704_100255869
538 Ga0068855_100014032
539 Ga0068857_100293865
540 Ga0068854_100000912
541 Ga0068856_100013894
542 Ga0068856_100769065
543 Ga0070702_100000084
544 Ga0070702_100103458
545 Ga0070702_100270763
546 Ga0068852_100655863
547 Ga0068852_100678134
548 Ga0068859_100007866
549 Ga0068859_100279192
550 Ga0068859_100654437
551 Ga0068859_100700108
552 Ga0068864_100287914
553 Ga0068866_10001152
554 Ga0068866_10050140
555 Ga0068861_100002361
556 Ga0068861_100281832
557 Ga0068858_100004430
558 Ga0068858_100091553
559 Ga0068858_100150881
560 Ga0068860_100008011
561 Ga0068860_100400578
562 Ga0068860_100416634
563 Ga0068862_100002836
564 Ga0068862_100064309
565 Ga0068862_100276515
566 Ga0081539_10000513
567 Ga0097621_100000794
568 Ga0068871_100002185
569 Ga0068871_100040552
570 Ga0075428_100014260
571 Ga0075430_100001038
572 Ga0075430_100008855
573 Ga0075430_100329480
574 Ga0075431_100110947
575 Ga0075431_100835849
576 Ga0075433_10047680
577 Ga0075433_10325488
578 Ga0075433_10410295
579 Ga0075433_10732759
580 Ga0075434_100001156
581 Ga0075434_100022526
582 Ga0075434_100028590
583 Ga0075434_100321842
584 Ga0075429_100000358
585 Ga0075429_100000365
586 Ga0075429_100019602
587 Ga0068865_100002527
588 Ga0068865_100004249
589 Ga0075436_100007374
590 Ga0075436_100010299
591 Ga0075436_100010678
592 Ga0075436_100013506
593 Ga0075436_100024871
594 Ga0075436_100035433
595 Ga0075436_100177745
596 Ga0075436_100241172
597 Ga0097620_100007866
598 Ga0097620_100279196
599 Ga0097620_100334898
600 Ga0097620_100654420
601 Ga0097620_100700094
602 Ga0075435_100004362
603 Ga0075435_100045816
604 Ga0075435_100286580
605 Ga0075435_100289275
606 Ga0099794_10011936
607 Ga0099794_10202346
608 Ga0111539_10007875
609 Ga0111539_10063524
610 Ga0111539_10079169
611 Ga0111539_10096067
612 Ga0111539_11065153
613 Ga0105245_10004314
614 Ga0105245_10043462
615 Ga0114129_10045425
616 Ga0114129_10265483
617 Ga0114129_11483626
618 Ga0105243_10004238
619 Ga0105243_10156986
620 Ga0105241_10442577
621 Ga0105242_10004218
622 Ga0105242_10009439
623 Ga0105249_10004285
624 Ga0105249_10262132
625 Ga0105239_10211734
626 Ga0105246_10036970
627 Ga0157378_10022760
628 Ga0163162_10053092
629 Ga0157372_10359530
630 Ga0157380_10513214
631 Ga0157376_10106781
632 Ga0207642_10000905
633 Ga0207688_10005703
634 Ga0207680_10108529
635 Ga0207647_10072271
636 Ga0207647_10291153
637 Ga0207645_10023749
638 Ga0207645_10239954
639 Ga0207645_10288961
640 Ga0207684_10114492
641 Ga0207707_10004784
642 Ga0207707_10387692
643 Ga0207660_10221412
644 Ga0207662_10000133
645 Ga0207662_10029452
646 Ga0207662_10044010
647 Ga0207662_10420836
648 Ga0207652_10136479
649 Ga0207652_10145116
650 Ga0207681_10001721
651 Ga0207687_10003332
652 Ga0207687_10068454
653 Ga0207706_10017215
654 Ga0207686_10002374
655 Ga0207686_10010094
656 Ga0207709_10000442
657 Ga0207670_10016091
658 Ga0207670_10109576
659 Ga0207669_10003533
660 Ga0207704_10000969
661 Ga0207704_10001676
662 Ga0207665_10045599
663 Ga0207691_10014659
664 Ga0207691_10037092
665 Ga0207691_10793114
666 Ga0207689_10004727
667 Ga0207689_10171465
668 Ga0207689_10298388
669 Ga0207689_10658951
670 Ga0207667_10005294
671 Ga0207651_10005887
672 Ga0207712_10289257
673 Ga0207668_10038714
674 Ga0207640_10100322
675 Ga0207658_10151998
676 Ga0207677_10003016
677 Ga0207703_10006526
678 Ga0207703_10012473
679 Ga0207703_10141444
680 Ga0207639_10333931
681 Ga0207708_10000164
682 Ga0207708_10041310
683 Ga0207708_10223602
684 Ga0207708_10392727
685 Ga0207702_10640212
686 Ga0207648_10001660
687 Ga0207648_10534420
688 Ga0207676_10629422
689 Ga0207675_100001376
690 Ga0207675_100028779
691 Ga0207683_10056128
692 Ga0207683_10178268
693 Ga0209969_1000301
694 Ga0209967_1000863
695 Ga0210000_1000836
696 Ga0210000_1002459
697 Ga0210000_1018362
698 Ga0209995_1018804
699 Ga0209968_1001592
700 Ga0209999_1012365
701 Ga0209983_1014854
702 Ga0209588_1087578
703 Ga0209971_1006619
704 Ga0209966_1004204
705 Ga0209974_10005420
706 Ga0207428_10001986
707 Ga0207428_10031153
708 Ga0207428_10087848
709 Ga0268265_10014579
710 Ga0268265_10531590
711 Ga0268264_10003329
712 Ga0268264_10180004
713 Ga0307408_100145649
714 Ga0265314_10140612
715 Ga0307411_10396891
716 Ga0373930_0011928
717 Ga0373950_0021170
718 Ga0373938_0010958
719 Ga0373926_0001043
720 Ga0373926_0230159
721 Ga0373929_0004584
722 Ga0373934_0118789
723 Ga0373949_0004221
724 Ga0373923_0210045
725 Ga0373932_0001600
726 Ga0373936_0084939
727 Ga0373939_0039226
728 Ga0373941_0002397
729 Ga0373941_0020540
730 Ga0373945_0031480
731 Ga0373953_0006183
732 Ga0373953_0061876
733 Ga0373954_0000075
734 Ga0373960_0062974
735 Ga0373943_0012312
736 Ga0373943_0123616
737 Ga0373946_0018440
738 Ga0373942_0073716
739 Ga0373931_0000468
740 Ga0373931_0033373
741 Ga0373931_0057469
742 Ga0373935_0004450
743 Ga0373935_0129613
744 Ga0373927_0008159
745 Ga0373927_0162691
746 Ga0373933_0007919
747 Ga0373947_0002856
748 Ga0373947_0004222
749 Ga0373937_0000418
750 Ga0373937_0004735
751 Ga0373925_0013043
752 Ga0373925_0040974
753 Ga0451807_0430782
754 Ga0439441_005565
755 Ga0439451_023609
756 Ga0439456_034333
757 Ga0439435_0000044
758 Ga0439435_0006179
759 Ga0439435_0011060
760 Ga0439444_0001820
761 Ga0439460_0002523
762 Ga0439460_0018464
763 Ga0451577_0108217
764 Ga0451577_0890236
765 Ga0466963_0184289
766 Ga0451576_0000360
767 Ga0451576_0036416
768 Ga0451576_0043895
769 Ga0466967_0009548
770 Ga0495592_0006561
771 Ga0495592_0046054
772 Ga0495603_0039695
773 Ga0495651_0081427
774 Ga0495580_0008583
775 Ga0495639_0020416
776 Ga0495662_0002748
777 Ga0495608_0012778
778 Ga0495628_0050021
779 Ga0495630_0001728
780 Ga0495630_0032896
781 Ga0495630_0103731
782 Ga0495663_0119084
783 Ga0495642_0045182
784 Ga0495640_0005587
785 Ga0495640_0066893
786 Ga0495586_0005428
787 Ga0495587_0135178
788 Ga0495621_0048640
789 Ga0495621_0111773
790 Ga0495667_0017187
791 Ga0495667_0227287
792 Ga0495656_0215060
793 Ga0495634_0010834
794 Ga0495634_0088226
795 Ga0495635_0064801
796 Ga0495635_0131689
797 Ga0495599_0196071
798 Ga0495623_0216740
799 Ga0495646_0199018
800 Ga0495647_0001506
801 Ga0495647_0021169
802 Ga0495658_0025760
803 Ga0495669_0006231
804 Ga0495613_0022406
805 Ga0495624_0024962
806 Ga0495600_0020310
807 Ga0495604_0023168
808 Ga0495604_0167522
809 Ga0495636_0002229
810 Ga0495674_0076671
811 Ga0495676_0038851
812 Ga0495680_0004705
813 Ga0495680_0090449
814 Ga0495675_0161218
815 Ga0495684_0315424
816 Ga0495593_0116129
817 Ga0495602_0291865
818 Ga0496102_0840459
819 Ga0501033_0008510
820 Ga0501033_0045728
821 Ga0501036_0000244
822 Ga0501037_0002554
823 Ga0501038_0000368
824 Ga0501038_0390057
825 Ga0501039_0001872
826 Ga0501039_0244433
827 Ga0501039_0245288
828 Ga0501040_0007447
829 Ga0501040_0011721
830 Ga0501040_0085142
831 Ga0501040_0098536
832 Ga0501040_0125643
833 Ga0501040_0347299
834 Ga0501041_0002205
835 Ga0501041_0025087
836 Ga0501041_0043217
837 Ga0501042_0001912
838 Ga0501042_0055813
839 Ga0501042_0062457
840 Ga0501042_0400992
841 Ga0501043_0024297
842 Ga0501046_0001501
843 Ga0501046_0064562
844 Ga0501048_0000485
845 Ga0501048_0362158
846 Ga0501068_0003258
847 Ga0501068_0136222
848 Ga0501069_0106277
849 Ga0501070_0030634
850 Ga0501071_0111129
851 Ga0501072_0000928
852 Ga0501074_0003865
853 Ga0501074_0146913
854 Ga0501075_0002601
855 Ga0501075_0124515
856 Ga0501075_0398446
857 Ga0501076_0017236
858 Ga0501076_0060146
859 Ga0501077_0004853
860 Ga0501077_0060994
861 Ga0501079_0001130
862 Ga0501080_0013758
863 Ga0501080_0039043
864 Ga0501081_0000895
865 Ga0501081_0015350
866 Ga0501081_0143668
867 Ga0501035_0009479
868 Ga0501044_0041904
869 Ga0501045_0000136
870 Ga0501045_0016469
871 nmdc:mga05p37_13591_c2
872 nmdc:mga05p37_421_c1
873 nmdc:mga05p37_846_c1
874 nmdc:mga09592_419_c1
875 nmdc:mga09592_561_c1
876 nmdc:mga0qj67_100524_c1
877 nmdc:mga0qj67_10255_c1
878 nmdc:mga0qj67_295084_c1
879 nmdc:mga0qj67_6756_c1
880 nmdc:mga0qj67_886_c1
881 nmdc:mga06r32_11129_c1
882 nmdc:mga06r32_2835_c1
883 nmdc:mga06r32_51135_c1
884 nmdc:mga06r32_511492_c1
885 nmdc:mga08y16_10933_c1
886 nmdc:mga08y16_144001_c1
887 nmdc:mga08y16_1688_c1
888 nmdc:mga08y16_193199_c1
889 nmdc:mga08y16_279907_c1
890 nmdc:mga0n895_11352_c1
891 nmdc:mga0n895_331783_c1
892 nmdc:mga0n895_5169_c1
893 nmdc:mga0n895_98316_c1
894 nmdc:mga0rr50_141323_c1
895 nmdc:mga0rr50_182671_c1
896 nmdc:mga0rr50_473067_c1
897 nmdc:mga0rr50_489024_c1
898 nmdc:mga0rr50_597_c1
899 nmdc:mga0rr50_61971_c1
900 nmdc:mga0rr50_63090_c1
901 nmdc:mga08x19_16055_c1
902 nmdc:mga08x19_34921_c1
903 nmdc:mga08x19_4007_c1
904 nmdc:mga08x19_59889_c1
905 nmdc:mga08x19_680_c1
906 nmdc:mga08x19_6937_c1
907 nmdc:mga0a205_171094_c1
908 nmdc:mga0a205_292469_c1
909 nmdc:mga0a205_496431_c1
910 nmdc:mga0a205_55782_c1
911 Ga0495601_0065983
912 Ga0495619_0279667
913 Ga0501084_0007901
914 Ga0590071_009960
915 Ga0501082_0002798
916 Ga0530510_0000301
917 Ga0530510_0139057
918 Ga0530510_0349280

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12399

BCA_ABC_TP_C

Branched-chain amino acid ATP-binding cassette transporter

194

220

0.96

PF00005

ABC_tran

ABC transporter

19

165

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4khz-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose 0.9343 2 222
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.9341 2 232
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9323 2 224
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9314 2 224
7x0q-assembly1.cif.gz_A crystal structure of atpase clo1313_2554 from clostridium thermocellum 0.9296 1 226
ID Description Score Start End Superfamily
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9667 2 235 3.40.50.300
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.943 2 235 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9421 2 218 3.40.50.300
af_P0AAI1_7_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9357 2 218 3.40.50.300
af_Q9XW49_1237_1482_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9317 2 225 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7V3H5Z2-F1-model_v4 ABC transporter ATP-binding protein 0.981 2 217 GO:0005524
GO:0005886
GO:0016887
AF-A0A212K4P3-F1-model_v4 Putative branched-chain amino acid transport protein (ATP binding protein) livG-like protein (EC 3.6.3.-) 0.9787 2 235 GO:0005524
GO:0005886
GO:0016887
AF-A0A1F9NM38-F1-model_v4 ABC transporter ATP-binding protein 0.9778 1 211 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806
AF-A0A367ZUC1-F1-model_v4 Branched-chain amino acid transport ATP-binding protein LivG 0.9775 1 235 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806
AF-A0A2M7JPQ3-F1-model_v4 ABC transporter ATP-binding protein 0.9774 1 222 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806

Map