F448210

General Info

Members Datasets Scaffolds Average Seq Length
458 253 916 180

Family's Representative Sequence

Representative Sequence 3300025942|Ga0207689_10638668|Ga0207689_106386682
Length 208
Sequence VQRAGQSQRKSVALIRRSASQWPQMALQATIYNFDIELADNDRAVYESLALRLARHPSESDEYLIARLLAYLLEFTNGIAFSRGVSEPDEPAISVRDPTGAITTWIDIGTPDAGRLHKASKAARRVVVYTHKDPRQFLKQLAGEKIHRADALELYAIDRALVAALVARLERRVAFSLSVTEGELYVSIATENLTGSVVRLTRETDRSK

Samples

Sample ID Description Type Environment
1 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
147 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
148 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
149 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
150 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
151 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
152 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
153 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
154 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
155 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
157 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
158 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
159 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
160 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
161 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
162 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
163 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
170 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
171 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
172 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
173 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
174 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
175 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
178 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
179 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
180 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
181 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
182 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
183 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
184 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
185 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
186 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
187 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
188 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
189 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
190 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
191 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
192 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
193 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
194 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
195 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
196 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
197 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
198 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
199 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
200 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
201 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
202 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
203 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
204 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
205 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
206 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
207 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
208 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
209 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
210 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
211 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
212 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
228 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
229 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
230 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
231 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
232 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
233 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
234 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
235 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
236 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
237 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
238 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
239 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
242 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
243 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
244 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
245 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
246 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
247 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
248 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
249 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
250 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
251 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
252 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
253 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.06
Nodule 0
Rhizoplane 2.84
Rhizosphere 93.67
Stem 0
Stem Tuber 0
Unclassified 28.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207689_10638668 3300025942 Bacteria 896
2 JGI24751J29686_10050973 3300002459 Unclassified 854
3 Ga0065704_10153230 3300005289 Bacteria 1412
4 Ga0065712_10012990 3300005290 Unclassified 2217
5 Ga0065712_10106005 3300005290 Unclassified 1927
6 Ga0065715_10100047 3300005293 Bacteria 3336
7 Ga0065707_10003003 3300005295 Bacteria 14961
8 Ga0065707_10014336 3300005295 Bacteria 1781
9 Ga0065707_10039458 3300005295 Bacteria 1054
10 Ga0065707_10152408 3300005295 Unclassified 1644
11 Ga0065707_10160158 3300005295 Bacteria 1568
12 Ga0070683_100006880 3300005329 Bacteria 9553
13 Ga0070670_100059763 3300005331 Bacteria 3272
14 Ga0068869_100194495 3300005334 Bacteria 1597
15 Ga0070666_10012044 3300005335 Bacteria 5444
16 Ga0070666_10085771 3300005335 Unclassified 2157
17 Ga0070680_100294461 3300005336 Unclassified 1376
18 Ga0070680_100680030 3300005336 Unclassified 885
19 Ga0070660_100291319 3300005339 Unclassified 1337
20 Ga0070689_100615806 3300005340 Unclassified 942
21 Ga0070661_100024821 3300005344 Bacteria 4302
22 Ga0070661_100569690 3300005344 Bacteria 913
23 Ga0070668_100001154 3300005347 Bacteria 18625
24 Ga0070668_100499655 3300005347 Archaea 1053
25 Ga0070669_100006140 3300005353 Bacteria 8676
26 Ga0070669_100011262 3300005353 Bacteria 6350
27 Ga0070669_100145344 3300005353 Bacteria 1832
28 Ga0070669_100150777 3300005353 Bacteria 1799
29 Ga0070669_100549473 3300005353 Bacteria 963
30 Ga0070675_100161993 3300005354 Bacteria 1924
31 Ga0070675_100212095 3300005354 Archaea 1683
32 Ga0070675_100642409 3300005354 Unclassified 964
33 Ga0070674_100027406 3300005356 Bacteria 3733
34 Ga0070674_100056799 3300005356 Bacteria 2715
35 Ga0070674_100959927 3300005356 Unclassified 748
36 Ga0070673_100066655 3300005364 Bacteria 2877
37 Ga0070673_100342378 3300005364 Unclassified 1325
38 Ga0070659_100253091 3300005366 Bacteria 1460
39 Ga0070703_10037240 3300005406 Unclassified 1498
40 Ga0070701_10272354 3300005438 Bacteria 1031
41 Ga0070705_100385530 3300005440 Bacteria 1033
42 Ga0070694_100075121 3300005444 Unclassified 2337
43 Ga0070708_100503135 3300005445 Unclassified 1143
44 Ga0070708_100546043 3300005445 Unclassified 1093
45 Ga0070663_100672288 3300005455 Unclassified 878
46 Ga0070662_100035672 3300005457 Bacteria 3514
47 Ga0070662_100042627 3300005457 Bacteria 3242
48 Ga0070662_100072840 3300005457 Bacteria 2537
49 Ga0070662_100297631 3300005457 Unclassified 1310
50 Ga0070662_100316942 3300005457 Bacteria 1271
51 Ga0070662_100472657 3300005457 Archaea 1043
52 Ga0070681_10392324 3300005458 Bacteria 1299
53 Ga0070706_100115189 3300005467 Bacteria 2503
54 Ga0070706_100240160 3300005467 Bacteria 1692
55 Ga0070707_100041788 3300005468 Bacteria 4389
56 Ga0070707_100098467 3300005468 Unclassified 2832
57 Ga0070698_100288191 3300005471 Bacteria 1573
58 Ga0070684_100001096 3300005535 Bacteria 19412
59 Ga0070697_100430019 3300005536 Bacteria 1148
60 Ga0070697_101378650 3300005536 Unclassified 629
61 Ga0070672_100038514 3300005543 Bacteria 3654
62 Ga0070672_100041124 3300005543 Bacteria 3552
63 Ga0070672_100164299 3300005543 Bacteria 1843
64 Ga0070672_101009721 3300005543 Bacteria 737
65 Ga0070686_100001727 3300005544 Bacteria 12210
66 Ga0070686_100267286 3300005544 Unclassified 1256
67 Ga0070695_100066660 3300005545 Unclassified 2346
68 Ga0070695_100084451 3300005545 Bacteria 2106
69 Ga0070695_100099274 3300005545 Bacteria 1958
70 Ga0070695_100102497 3300005545 Bacteria 1930
71 Ga0070665_100308201 3300005548 Bacteria 1587
72 Ga0070704_100043925 3300005549 Bacteria 3101
73 Ga0070704_100091663 3300005549 Bacteria 2267
74 Ga0070704_100732989 3300005549 Bacteria 879
75 Ga0068855_100347255 3300005563 Bacteria 1635
76 Ga0068855_100776797 3300005563 Bacteria 1020
77 Ga0070664_100001159 3300005564 Bacteria 20903
78 Ga0068857_100042412 3300005577 Bacteria 4036
79 Ga0068857_100547806 3300005577 Bacteria 1090
80 Ga0068854_100162317 3300005578 Bacteria 1732
81 Ga0068854_100257156 3300005578 Unclassified 1397
82 Ga0068854_101423192 3300005578 Unclassified 627
83 Ga0068852_100588729 3300005616 Bacteria 1116
84 Ga0068859_100002791 3300005617 Bacteria 17698
85 Ga0068864_100043202 3300005618 Bacteria 3858
86 Ga0068864_100328710 3300005618 Bacteria 1438
87 Ga0068866_10580427 3300005718 Unclassified 754
88 Ga0068851_10527524 3300005834 Bacteria 711
89 Ga0068870_10630217 3300005840 Unclassified 732
90 Ga0068863_100071255 3300005841 Bacteria 3288
91 Ga0068863_100774703 3300005841 Bacteria 956
92 Ga0068858_100018494 3300005842 Bacteria 6523
93 Ga0068858_100233168 3300005842 Bacteria 1745
94 Ga0068858_100309656 3300005842 Unclassified 1508
95 Ga0068860_100451909 3300005843 Unclassified 1278
96 Ga0068862_100034302 3300005844 Bacteria 4292
97 Ga0068862_100702824 3300005844 Bacteria 980
98 Ga0075368_10139009 3300006042 Bacteria 1011
99 Ga0075364_10055771 3300006051 Bacteria 2586
100 Ga0075367_10053425 3300006178 Bacteria 2393
101 Ga0075367_10098667 3300006178 Unclassified 1783
102 Ga0075366_10062640 3300006195 Unclassified 2211
103 Ga0097621_100463107 3300006237 Bacteria 1144
104 Ga0097621_100477961 3300006237 Bacteria 1126
105 Ga0068871_100436238 3300006358 Bacteria 1172
106 Ga0075428_100018876 3300006844 Bacteria 7626
107 Ga0075428_100071133 3300006844 Bacteria 3802
108 Ga0075428_100088020 3300006844 Bacteria 3387
109 Ga0075428_100128057 3300006844 Bacteria 2762
110 Ga0075428_100660634 3300006844 Unclassified 1115
111 Ga0075428_100665905 3300006844 Bacteria 1110
112 Ga0075430_100095772 3300006846 Bacteria 2481
113 Ga0075430_100136652 3300006846 Bacteria 2042
114 Ga0075430_100214680 3300006846 Bacteria 1596
115 Ga0075431_100034271 3300006847 Bacteria 5231
116 Ga0075431_100051947 3300006847 Bacteria 4226
117 Ga0075431_100116116 3300006847 Bacteria 2763
118 Ga0075431_100412550 3300006847 Unclassified 1350
119 Ga0075431_100444533 3300006847 Unclassified 1293
120 Ga0075431_100674772 3300006847 Bacteria 1012
121 Ga0075431_101161212 3300006847 Unclassified 736
122 Ga0075433_10001359 3300006852 Bacteria 17934
123 Ga0075433_10057875 3300006852 Unclassified 3389
124 Ga0075433_10535420 3300006852 Bacteria 1030
125 Ga0075433_10689187 3300006852 Bacteria 895
126 Ga0075434_100011900 3300006871 Bacteria 8228
127 Ga0075434_100081409 3300006871 Bacteria 3235
128 Ga0075434_100364487 3300006871 Bacteria 1466
129 Ga0075429_100157483 3300006880 Unclassified 1989
130 Ga0075429_100158805 3300006880 Bacteria 1980
131 Ga0075429_100180731 3300006880 Bacteria 1849
132 Ga0075429_101042288 3300006880 Bacteria 715
133 Ga0068865_100244469 3300006881 Bacteria 1413
134 Ga0075436_100035342 3300006914 Bacteria 3448
135 Ga0075436_100091441 3300006914 Bacteria 2115
136 Ga0075436_100246885 3300006914 Unclassified 1270
137 Ga0097620_100002791 3300006931 Bacteria 17698
138 Ga0075435_100024775 3300007076 Bacteria 4662
139 Ga0075435_100034430 3300007076 Bacteria 4014
140 Ga0075435_100267306 3300007076 Bacteria 1458
141 Ga0075435_100531887 3300007076 Bacteria 1017
142 Ga0075435_100627019 3300007076 Bacteria 933
143 Ga0099794_10110403 3300007265 Bacteria 1378
144 Ga0099795_10352491 3300007788 Unclassified 659
145 Ga0111539_10009782 3300009094 Bacteria 12103
146 Ga0111539_10015266 3300009094 Bacteria 9566
147 Ga0111539_10028084 3300009094 Bacteria 6869
148 Ga0111539_10141782 3300009094 Unclassified 2813
149 Ga0105247_10017496 3300009101 Unclassified 4301
150 Ga0105247_10058822 3300009101 Unclassified 2378
151 Ga0105247_10292212 3300009101 Bacteria 1128
152 Ga0114129_10019082 3300009147 Bacteria 9767
153 Ga0114129_10026328 3300009147 Bacteria 8236
154 Ga0114129_10059910 3300009147 Bacteria 5323
155 Ga0114129_10277721 3300009147 Bacteria 2239
156 Ga0114129_10466168 3300009147 Bacteria 1655
157 Ga0114129_10498056 3300009147 Bacteria 1592
158 Ga0114129_11655519 3300009147 Unclassified 782
159 Ga0105241_10090438 3300009174 Bacteria 2414
160 Ga0105242_10318005 3300009176 Bacteria 1427
161 Ga0105248_10055551 3300009177 Unclassified 4442
162 Ga0105248_10323191 3300009177 Bacteria 1738
163 Ga0105248_10968209 3300009177 Bacteria 961
164 Ga0105248_11020804 3300009177 Bacteria 934
165 Ga0105249_10082050 3300009553 Unclassified 2999
166 Ga0099796_10389809 3300010159 Bacteria 609
167 Ga0105239_11419006 3300010375 Unclassified 802
168 Ga0157374_10376304 3300013296 Bacteria 1414
169 Ga0157378_10607229 3300013297 Unclassified 1106
170 Ga0157378_11387444 3300013297 Unclassified 745
171 Ga0163162_10103399 3300013306 Bacteria 2943
172 Ga0157375_10140468 3300013308 Bacteria 2542
173 Ga0157375_10503306 3300013308 Bacteria 1375
174 Ga0163163_10010399 3300014325 Bacteria 8366
175 Ga0157380_10002833 3300014326 Bacteria 11787
176 Ga0157380_10130327 3300014326 Bacteria 2144
177 Ga0157380_10469983 3300014326 Bacteria 1213
178 Ga0157380_10759046 3300014326 Unclassified 982
179 Ga0157380_11552650 3300014326 Unclassified 716
180 Ga0157380_11703834 3300014326 Unclassified 688
181 Ga0157377_10008573 3300014745 Bacteria 4990
182 Ga0157379_10082980 3300014968 Bacteria 2872
183 Ga0157376_10064898 3300014969 Bacteria 3080
184 Ga0157376_10113811 3300014969 Unclassified 2386
185 Ga0157376_10176931 3300014969 Unclassified 1947
186 Ga0163161_10551237 3300017792 Unclassified 945
187 Ga0163161_10669511 3300017792 Bacteria 861
188 Ga0207697_10046703 3300025315 Bacteria 1784
189 Ga0207697_10084651 3300025315 Bacteria 1339
190 Ga0207710_10009885 3300025900 Unclassified 4010
191 Ga0207688_10079457 3300025901 Bacteria 1871
192 Ga0207680_10011755 3300025903 Bacteria 4435
193 Ga0207680_10983885 3300025903 Bacteria 604
194 Ga0207685_10069107 3300025905 Bacteria 1425
195 Ga0207645_10235222 3300025907 Bacteria 1210
196 Ga0207643_10407450 3300025908 Unclassified 860
197 Ga0207643_10741308 3300025908 Unclassified 636
198 Ga0207684_10235306 3300025910 Unclassified 1580
199 Ga0207684_10361399 3300025910 Bacteria 1249
200 Ga0207654_10050877 3300025911 Bacteria 2382
201 Ga0207707_10521495 3300025912 Bacteria 1012
202 Ga0207695_10232614 3300025913 Bacteria 1747
203 Ga0207671_10856852 3300025914 Unclassified 719
204 Ga0207662_10015220 3300025918 Bacteria 4326
205 Ga0207657_10127106 3300025919 Bacteria 2093
206 Ga0207646_10277924 3300025922 Unclassified 1513
207 Ga0207681_10201193 3300025923 Bacteria 1530
208 Ga0207681_10396700 3300025923 Bacteria 1113
209 Ga0207694_11009828 3300025924 Bacteria 704
210 Ga0207650_10103262 3300025925 Bacteria 2198
211 Ga0207650_10131238 3300025925 Bacteria 1960
212 Ga0207650_10481200 3300025925 Unclassified 1036
213 Ga0207650_10481730 3300025925 Bacteria 1035
214 Ga0207659_10099153 3300025926 Bacteria 2193
215 Ga0207659_10114575 3300025926 Bacteria 2055
216 Ga0207659_10639862 3300025926 Bacteria 908
217 Ga0207659_10655607 3300025926 Bacteria 897
218 Ga0207690_10176885 3300025932 Bacteria 1603
219 Ga0207706_10126923 3300025933 Bacteria 2243
220 Ga0207706_10194217 3300025933 Bacteria 1781
221 Ga0207706_10197188 3300025933 Bacteria 1766
222 Ga0207706_10213753 3300025933 Bacteria 1690
223 Ga0207706_10298013 3300025933 Unclassified 1405
224 Ga0207669_10053559 3300025937 Bacteria 2431
225 Ga0207691_10030607 3300025940 Bacteria 5028
226 Ga0207691_10046348 3300025940 Bacteria 3995
227 Ga0207691_10300777 3300025940 Bacteria 1378
228 Ga0207711_10140779 3300025941 Bacteria 2170
229 Ga0207711_10448867 3300025941 Unclassified 1200
230 Ga0207689_10150986 3300025942 Bacteria 1915
231 Ga0207689_10474816 3300025942 Unclassified 1047
232 Ga0207661_10181590 3300025944 Unclassified 1838
233 Ga0207679_10178965 3300025945 Bacteria 1753
234 Ga0207679_10733085 3300025945 Unclassified 898
235 Ga0207667_10935907 3300025949 Bacteria 857
236 Ga0207667_11599699 3300025949 Bacteria 620
237 Ga0207651_10184590 3300025960 Unclassified 1658
238 Ga0207712_10061177 3300025961 Bacteria 2672
239 Ga0207712_10279528 3300025961 Archaea 1362
240 Ga0207712_10528335 3300025961 Bacteria 1012
241 Ga0207668_10027752 3300025972 Bacteria 3691
242 Ga0207668_10152622 3300025972 Archaea 1790
243 Ga0207703_10914582 3300026035 Unclassified 840
244 Ga0207678_10271713 3300026067 Bacteria 1454
245 Ga0207678_10498953 3300026067 Bacteria 1061
246 Ga0207708_10314809 3300026075 Unclassified 1276
247 Ga0207708_10456881 3300026075 Unclassified 1065
248 Ga0207708_11038538 3300026075 Bacteria 713
249 Ga0207641_10373942 3300026088 Unclassified 1363
250 Ga0207648_11219804 3300026089 Unclassified 707
251 Ga0207676_10071943 3300026095 Bacteria 2778
252 Ga0207676_10722471 3300026095 Bacteria 967
253 Ga0207674_10012514 3300026116 Bacteria 9479
254 Ga0207674_10144829 3300026116 Bacteria 2334
255 Ga0207675_100041882 3300026118 Bacteria 4276
256 Ga0207675_100190009 3300026118 Unclassified 1970
257 Ga0207675_100702195 3300026118 Bacteria 1020
258 Ga0207675_100783706 3300026118 Bacteria 966
259 Ga0207675_100829754 3300026118 Bacteria 939
260 Ga0207683_10060255 3300026121 Bacteria 3336
261 Ga0207698_11735528 3300026142 Unclassified 640
262 Ga0210002_1074021 3300027617 Bacteria 603
263 Ga0209813_10135021 3300027866 Bacteria 871
264 Ga0207428_10002438 3300027907 Bacteria 18586
265 Ga0207428_10002827 3300027907 Bacteria 17231
266 Ga0268266_10248448 3300028379 Unclassified 1645
267 Ga0268265_10011101 3300028380 Bacteria 6087
268 Ga0268265_10201722 3300028380 Unclassified 1726
269 Ga0268265_10268306 3300028380 Bacteria 1521
270 Ga0268265_10852913 3300028380 Bacteria 891
271 Ga0268264_10254968 3300028381 Bacteria 1631
272 Ga0307509_10731654 3300031507 Unclassified 655
273 Ga0307408_100071273 3300031548 Unclassified 2569
274 Ga0307408_101019844 3300031548 Bacteria 764
275 Ga0307405_10084549 3300031731 Unclassified 2083
276 Ga0307405_10663905 3300031731 Bacteria 859
277 Ga0307413_10926419 3300031824 Unclassified 742
278 Ga0307407_10096631 3300031903 Unclassified 1824
279 Ga0307412_10408100 3300031911 Unclassified 1108
280 Ga0307412_11551651 3300031911 Bacteria 603
281 Ga0307416_100003427 3300032002 Bacteria 9308
282 Ga0307416_100108323 3300032002 Bacteria 2441
283 Ga0307416_101381811 3300032002 Bacteria 810
284 Ga0307414_10182840 3300032004 Bacteria 1688
285 Ga0307414_10498731 3300032004 Bacteria 1077
286 Ga0307411_10083100 3300032005 Bacteria 2211
287 Ga0307411_10531360 3300032005 Bacteria 1000
288 Ga0307415_100165046 3300032126 Bacteria 1721
289 Ga0307415_101308975 3300032126 Unclassified 687
290 Ga0373958_0001663 3300034819 Bacteria 3018
291 Ga0373959_0001386 3300034820 Bacteria 3878
292 Ga0373938_0000205 3300034957 Bacteria 8934
293 Ga0373928_0001574 3300035084 Bacteria 4423
294 Ga0373934_0298891 3300035086 Unclassified 668
295 Ga0373940_0000037 3300035088 Bacteria 14665
296 Ga0373949_0000454 3300035090 Bacteria 14136
297 Ga0373951_0000603 3300035091 Bacteria 9886
298 Ga0373952_0000666 3300035092 Bacteria 6067
299 Ga0373923_0035134 3300035111 Bacteria 2039
300 Ga0373939_0000545 3300035114 Bacteria 9411
301 Ga0373941_0000148 3300035115 Bacteria 12522
302 Ga0373956_0187097 3300035119 Bacteria 980
303 Ga0373957_0096589 3300035120 Bacteria 1179
304 Ga0373960_0000908 3300035121 Bacteria 6290
305 Ga0373955_0053216 3300035172 Unclassified 2210
306 Ga0373942_0000134 3300035207 Bacteria 17539
307 Ga0373961_0000639 3300035241 Bacteria 12664
308 Ga0373931_0255747 3300035691 Unclassified 1067
309 Ga0373935_0152752 3300035692 Unclassified 1568
310 Ga0373947_0717560 3300035725 Unclassified 682
311 Ga0373937_0002278 3300036401 Bacteria 16032
312 Ga0373937_0072474 3300036401 Bacteria 3177
313 Ga0373925_0253445 3300037068 Unclassified 1412
314 Ga0242420_094503 3300038996 Unclassified 631
315 Ga0439453_0002330 3300041408 Bacteria 2605
316 Ga0451839_1143585 3300041496 Bacteria 1135
317 Ga0439442_038327 3300042002 Unclassified 1005
318 Ga0439457_030789 3300042014 Bacteria 1190
319 Ga0439462_0062743 3300042015 Bacteria 1006
320 Ga0466963_0636328 3300044694 Bacteria 753
321 Ga0451576_0013724 3300045051 Bacteria 9049
322 Ga0451576_0181255 3300045051 Unclassified 2199
323 Ga0451576_1141975 3300045051 Bacteria 815
324 Ga0495651_0393543 3300046462 Bacteria 906
325 Ga0495653_0018335 3300046463 Bacteria 5686
326 Ga0495582_0129697 3300046473 Bacteria 1424
327 Ga0495664_0266103 3300046477 Unclassified 1036
328 Ga0495608_0012387 3300046511 Bacteria 5920
329 Ga0495608_0234535 3300046511 Bacteria 1148
330 Ga0495608_0280355 3300046511 Bacteria 1035
331 Ga0495618_0322748 3300046514 Unclassified 956
332 Ga0495628_0230883 3300046516 Unclassified 1387
333 Ga0495630_0207005 3300046517 Bacteria 1497
334 Ga0495652_0052312 3300046529 Bacteria 3484
335 Ga0495640_0017306 3300046533 Bacteria 5374
336 Ga0495640_0250683 3300046533 Unclassified 1109
337 Ga0495640_0338566 3300046533 Bacteria 930
338 Ga0495586_0005833 3300046535 Bacteria 6583
339 Ga0495598_0226265 3300046537 Bacteria 685
340 Ga0495621_0069476 3300046539 Unclassified 1294
341 Ga0495645_0018117 3300046543 Bacteria 5054
342 Ga0495667_0023866 3300046559 Bacteria 4119
343 Ga0495656_0062670 3300046615 Bacteria 1627
344 Ga0495656_0097674 3300046615 Unclassified 1353
345 Ga0495634_0516362 3300046642 Bacteria 699
346 Ga0495635_0034873 3300046663 Bacteria 3490
347 Ga0495635_0191617 3300046663 Bacteria 1388
348 Ga0495659_0049526 3300046664 Bacteria 1526
349 Ga0495657_0319625 3300046675 Bacteria 923
350 Ga0495599_0467169 3300046678 Bacteria 745
351 Ga0495623_0007837 3300046679 Bacteria 6948
352 Ga0495647_0068359 3300046681 Bacteria 1417
353 Ga0495658_0022028 3300046683 Unclassified 3366
354 Ga0495658_0206087 3300046683 Bacteria 1227
355 Ga0495658_0324196 3300046683 Unclassified 977
356 Ga0495669_0089045 3300046684 Bacteria 1423
357 Ga0495669_0361467 3300046684 Bacteria 702
358 Ga0495613_0131129 3300046689 Bacteria 1795
359 Ga0495613_0237403 3300046689 Bacteria 1275
360 Ga0495613_0325418 3300046689 Unclassified 1060
361 Ga0495624_0041905 3300046690 Bacteria 2926
362 Ga0495600_0016220 3300046809 Bacteria 4724
363 Ga0495600_0187017 3300046809 Bacteria 1333
364 Ga0495636_0235141 3300047318 Unclassified 844
365 Ga0495674_0051424 3300047319 Bacteria 3632
366 Ga0495674_0428800 3300047319 Bacteria 1065
367 Ga0495674_0488434 3300047319 Bacteria 986
368 Ga0495672_0012570 3300047320 Bacteria 5902
369 Ga0495680_0079428 3300047322 Bacteria 2481
370 Ga0495680_0099318 3300047322 Bacteria 2170
371 Ga0495675_0017000 3300047444 Bacteria 4605
372 Ga0495684_0103185 3300047471 Bacteria 2155
373 Ga0495602_0024728 3300048088 Bacteria 5824
374 Ga0496101_0167552 3300048904 Unclassified 1687
375 Ga0496103_0455109 3300048906 Unclassified 821
376 Ga0496105_0037101 3300048908 Bacteria 4015
377 Ga0496108_0001001 3300048911 Bacteria 22058
378 Ga0496108_0387943 3300048911 Unclassified 1220
379 Ga0496110_0163115 3300048913 Unclassified 2020
380 Ga0496111_0117266 3300048914 Bacteria 1964
381 Ga0496112_0144464 3300048915 Bacteria 2348
382 Ga0496112_0145923 3300048915 Unclassified 2335
383 Ga0496112_0217385 3300048915 Unclassified 1867
384 Ga0496112_0323536 3300048915 Bacteria 1486
385 Ga0496113_0038317 3300048916 Bacteria 3524
386 Ga0496113_0226713 3300048916 Bacteria 1490
387 Ga0501031_0191702 3300049568 Unclassified 1335
388 Ga0501036_0581512 3300049572 Unclassified 930
389 Ga0501039_0069250 3300049575 Bacteria 2740
390 Ga0501039_1091261 3300049575 Unclassified 619
391 Ga0501042_0482077 3300049578 Bacteria 900
392 Ga0501043_0361340 3300049579 Bacteria 1102
393 Ga0501046_0276263 3300049580 Bacteria 1231
394 Ga0501047_0351098 3300049581 Bacteria 1312
395 Ga0501067_0291003 3300049583 Bacteria 909
396 Ga0501071_0058298 3300049587 Bacteria 2792
397 Ga0501072_0056259 3300049588 Bacteria 3100
398 Ga0501076_0020335 3300049592 Bacteria 5081
399 Ga0501225_0040171 3300049705 Unclassified 1289
400 Ga0501079_0078277 3300049741 Bacteria 2557
401 Ga0501079_0872239 3300049741 Unclassified 709
402 Ga0501045_0337329 3300049824 Bacteria 1122
403 nmdc:mga06z11_344125_c1 3300050494 Unclassified 892
404 nmdc:mga06z11_86803_c1 3300050494 Bacteria 1691
405 nmdc:mga04h51_135185_c1 3300050495 Bacteria 931
406 nmdc:mga05p37_1198386_c1 3300050507 Unclassified 785
407 nmdc:mga05p37_1246242_c1 3300050507 Unclassified 764
408 nmdc:mga05p37_131899_c1 3300050507 Unclassified 3066
409 nmdc:mga05p37_142623_c1 3300050507 Bacteria 2934
410 nmdc:mga05p37_29368_c1 3300050507 Bacteria 6710
411 nmdc:mga05p37_414344_c1 3300050507 Bacteria 1570
412 nmdc:mga05p37_67260_c1 3300050507 Bacteria 4408
413 nmdc:mga05p37_85140_c1 3300050507 Unclassified 3895
414 nmdc:mga09592_140507_c1 3300050508 Unclassified 2081
415 nmdc:mga09592_223827_c1 3300050508 Bacteria 1630
416 nmdc:mga09592_33274_c1 3300050508 Bacteria 4302
417 nmdc:mga09592_947256_c1 3300050508 Bacteria 722
418 nmdc:mga0qj67_290466_c1 3300050509 Bacteria 1325
419 nmdc:mga0qj67_366523_c1 3300050509 Unclassified 1164
420 nmdc:mga06r32_100393_c1 3300050510 Bacteria 2839
421 nmdc:mga06r32_10430_c1 3300050510 Bacteria 8383
422 nmdc:mga06r32_1259732_c1 3300050510 Bacteria 684
423 nmdc:mga06r32_289545_c1 3300050510 Bacteria 1625
424 nmdc:mga06r32_339325_c1 3300050510 Bacteria 1487
425 nmdc:mga06r32_538275_c1 3300050510 Bacteria 1143
426 nmdc:mga06r32_672487_c1 3300050510 Unclassified 1002
427 nmdc:mga08y16_16015_c1 3300050511 Bacteria 7881
428 nmdc:mga08y16_183_c1 3300050511 Bacteria 55505
429 nmdc:mga08y16_24380_c1 3300050511 Bacteria 6384
430 nmdc:mga0n895_1106168_c1 3300050512 Unclassified 770
431 nmdc:mga0n895_114776_c1 3300050512 Bacteria 2711
432 nmdc:mga0n895_20818_c1 3300050512 Bacteria 6125
433 nmdc:mga0n895_4895_c1 3300050512 Bacteria 11096
434 nmdc:mga0n895_607360_c1 3300050512 Bacteria 1096
435 nmdc:mga0rr50_113778_c1 3300050513 Unclassified 2144
436 nmdc:mga0rr50_349_c1 3300050513 Bacteria 25202
437 nmdc:mga0rr50_457612_c1 3300050513 Bacteria 1082
438 nmdc:mga0rr50_6174_c1 3300050513 Bacteria 7258
439 nmdc:mga08x19_18908_c1 3300050514 Unclassified 4224
440 nmdc:mga08x19_3147_c1 3300050514 Bacteria 9911
441 nmdc:mga08x19_632941_c1 3300050514 Unclassified 758
442 nmdc:mga08x19_68147_c1 3300050514 Unclassified 2316
443 nmdc:mga08x19_833829_c1 3300050514 Unclassified 655
444 nmdc:mga0a205_16056_c1 3300050515 Bacteria 7009
445 nmdc:mga0a205_316_c3 3300050515 Bacteria 7397
446 nmdc:mga0a205_640725_c1 3300050515 Bacteria 914
447 nmdc:mga0a205_651300_c1 3300050515 Unclassified 905
448 nmdc:mga0a205_96318_c1 3300050515 Bacteria 2858
449 Ga0495601_0157325 3300053077 Unclassified 1484
450 Ga0495595_0023730 3300053084 Unclassified 2704
451 Ga0495619_0062596 3300053085 Unclassified 2477
452 Ga0500641_0002502 3300053096 Bacteria 6496
453 Ga0500555_000564 3300053103 Bacteria 14690
454 Ga0500568_0002419 3300053139 Bacteria 11007
455 Ga0500616_0000340 3300053153 Bacteria 66819
456 Ga0500645_000036 3300053730 Bacteria 113063
457 Ga0501082_0194953 3300060353 Bacteria 1762
458 Ga0501082_0803551 3300060353 Bacteria 823
459 Ga0207689_10638668
460 JGI24751J29686_10050973
461 Ga0065704_10153230
462 Ga0065712_10012990
463 Ga0065712_10106005
464 Ga0065715_10100047
465 Ga0065707_10003003
466 Ga0065707_10014336
467 Ga0065707_10039458
468 Ga0065707_10152408
469 Ga0065707_10160158
470 Ga0070683_100006880
471 Ga0070670_100059763
472 Ga0068869_100194495
473 Ga0070666_10012044
474 Ga0070666_10085771
475 Ga0070680_100294461
476 Ga0070680_100680030
477 Ga0070660_100291319
478 Ga0070689_100615806
479 Ga0070661_100024821
480 Ga0070661_100569690
481 Ga0070668_100001154
482 Ga0070668_100499655
483 Ga0070669_100006140
484 Ga0070669_100011262
485 Ga0070669_100145344
486 Ga0070669_100150777
487 Ga0070669_100549473
488 Ga0070675_100161993
489 Ga0070675_100212095
490 Ga0070675_100642409
491 Ga0070674_100027406
492 Ga0070674_100056799
493 Ga0070674_100959927
494 Ga0070673_100066655
495 Ga0070673_100342378
496 Ga0070659_100253091
497 Ga0070703_10037240
498 Ga0070701_10272354
499 Ga0070705_100385530
500 Ga0070694_100075121
501 Ga0070708_100503135
502 Ga0070708_100546043
503 Ga0070663_100672288
504 Ga0070662_100035672
505 Ga0070662_100042627
506 Ga0070662_100072840
507 Ga0070662_100297631
508 Ga0070662_100316942
509 Ga0070662_100472657
510 Ga0070681_10392324
511 Ga0070706_100115189
512 Ga0070706_100240160
513 Ga0070707_100041788
514 Ga0070707_100098467
515 Ga0070698_100288191
516 Ga0070684_100001096
517 Ga0070697_100430019
518 Ga0070697_101378650
519 Ga0070672_100038514
520 Ga0070672_100041124
521 Ga0070672_100164299
522 Ga0070672_101009721
523 Ga0070686_100001727
524 Ga0070686_100267286
525 Ga0070695_100066660
526 Ga0070695_100084451
527 Ga0070695_100099274
528 Ga0070695_100102497
529 Ga0070665_100308201
530 Ga0070704_100043925
531 Ga0070704_100091663
532 Ga0070704_100732989
533 Ga0068855_100347255
534 Ga0068855_100776797
535 Ga0070664_100001159
536 Ga0068857_100042412
537 Ga0068857_100547806
538 Ga0068854_100162317
539 Ga0068854_100257156
540 Ga0068854_101423192
541 Ga0068852_100588729
542 Ga0068859_100002791
543 Ga0068864_100043202
544 Ga0068864_100328710
545 Ga0068866_10580427
546 Ga0068851_10527524
547 Ga0068870_10630217
548 Ga0068863_100071255
549 Ga0068863_100774703
550 Ga0068858_100018494
551 Ga0068858_100233168
552 Ga0068858_100309656
553 Ga0068860_100451909
554 Ga0068862_100034302
555 Ga0068862_100702824
556 Ga0075368_10139009
557 Ga0075364_10055771
558 Ga0075367_10053425
559 Ga0075367_10098667
560 Ga0075366_10062640
561 Ga0097621_100463107
562 Ga0097621_100477961
563 Ga0068871_100436238
564 Ga0075428_100018876
565 Ga0075428_100071133
566 Ga0075428_100088020
567 Ga0075428_100128057
568 Ga0075428_100660634
569 Ga0075428_100665905
570 Ga0075430_100095772
571 Ga0075430_100136652
572 Ga0075430_100214680
573 Ga0075431_100034271
574 Ga0075431_100051947
575 Ga0075431_100116116
576 Ga0075431_100412550
577 Ga0075431_100444533
578 Ga0075431_100674772
579 Ga0075431_101161212
580 Ga0075433_10001359
581 Ga0075433_10057875
582 Ga0075433_10535420
583 Ga0075433_10689187
584 Ga0075434_100011900
585 Ga0075434_100081409
586 Ga0075434_100364487
587 Ga0075429_100157483
588 Ga0075429_100158805
589 Ga0075429_100180731
590 Ga0075429_101042288
591 Ga0068865_100244469
592 Ga0075436_100035342
593 Ga0075436_100091441
594 Ga0075436_100246885
595 Ga0097620_100002791
596 Ga0075435_100024775
597 Ga0075435_100034430
598 Ga0075435_100267306
599 Ga0075435_100531887
600 Ga0075435_100627019
601 Ga0099794_10110403
602 Ga0099795_10352491
603 Ga0111539_10009782
604 Ga0111539_10015266
605 Ga0111539_10028084
606 Ga0111539_10141782
607 Ga0105247_10017496
608 Ga0105247_10058822
609 Ga0105247_10292212
610 Ga0114129_10019082
611 Ga0114129_10026328
612 Ga0114129_10059910
613 Ga0114129_10277721
614 Ga0114129_10466168
615 Ga0114129_10498056
616 Ga0114129_11655519
617 Ga0105241_10090438
618 Ga0105242_10318005
619 Ga0105248_10055551
620 Ga0105248_10323191
621 Ga0105248_10968209
622 Ga0105248_11020804
623 Ga0105249_10082050
624 Ga0099796_10389809
625 Ga0105239_11419006
626 Ga0157374_10376304
627 Ga0157378_10607229
628 Ga0157378_11387444
629 Ga0163162_10103399
630 Ga0157375_10140468
631 Ga0157375_10503306
632 Ga0163163_10010399
633 Ga0157380_10002833
634 Ga0157380_10130327
635 Ga0157380_10469983
636 Ga0157380_10759046
637 Ga0157380_11552650
638 Ga0157380_11703834
639 Ga0157377_10008573
640 Ga0157379_10082980
641 Ga0157376_10064898
642 Ga0157376_10113811
643 Ga0157376_10176931
644 Ga0163161_10551237
645 Ga0163161_10669511
646 Ga0207697_10046703
647 Ga0207697_10084651
648 Ga0207710_10009885
649 Ga0207688_10079457
650 Ga0207680_10011755
651 Ga0207680_10983885
652 Ga0207685_10069107
653 Ga0207645_10235222
654 Ga0207643_10407450
655 Ga0207643_10741308
656 Ga0207684_10235306
657 Ga0207684_10361399
658 Ga0207654_10050877
659 Ga0207707_10521495
660 Ga0207695_10232614
661 Ga0207671_10856852
662 Ga0207662_10015220
663 Ga0207657_10127106
664 Ga0207646_10277924
665 Ga0207681_10201193
666 Ga0207681_10396700
667 Ga0207694_11009828
668 Ga0207650_10103262
669 Ga0207650_10131238
670 Ga0207650_10481200
671 Ga0207650_10481730
672 Ga0207659_10099153
673 Ga0207659_10114575
674 Ga0207659_10639862
675 Ga0207659_10655607
676 Ga0207690_10176885
677 Ga0207706_10126923
678 Ga0207706_10194217
679 Ga0207706_10197188
680 Ga0207706_10213753
681 Ga0207706_10298013
682 Ga0207669_10053559
683 Ga0207691_10030607
684 Ga0207691_10046348
685 Ga0207691_10300777
686 Ga0207711_10140779
687 Ga0207711_10448867
688 Ga0207689_10150986
689 Ga0207689_10474816
690 Ga0207661_10181590
691 Ga0207679_10178965
692 Ga0207679_10733085
693 Ga0207667_10935907
694 Ga0207667_11599699
695 Ga0207651_10184590
696 Ga0207712_10061177
697 Ga0207712_10279528
698 Ga0207712_10528335
699 Ga0207668_10027752
700 Ga0207668_10152622
701 Ga0207703_10914582
702 Ga0207678_10271713
703 Ga0207678_10498953
704 Ga0207708_10314809
705 Ga0207708_10456881
706 Ga0207708_11038538
707 Ga0207641_10373942
708 Ga0207648_11219804
709 Ga0207676_10071943
710 Ga0207676_10722471
711 Ga0207674_10012514
712 Ga0207674_10144829
713 Ga0207675_100041882
714 Ga0207675_100190009
715 Ga0207675_100702195
716 Ga0207675_100783706
717 Ga0207675_100829754
718 Ga0207683_10060255
719 Ga0207698_11735528
720 Ga0210002_1074021
721 Ga0209813_10135021
722 Ga0207428_10002438
723 Ga0207428_10002827
724 Ga0268266_10248448
725 Ga0268265_10011101
726 Ga0268265_10201722
727 Ga0268265_10268306
728 Ga0268265_10852913
729 Ga0268264_10254968
730 Ga0307509_10731654
731 Ga0307408_100071273
732 Ga0307408_101019844
733 Ga0307405_10084549
734 Ga0307405_10663905
735 Ga0307413_10926419
736 Ga0307407_10096631
737 Ga0307412_10408100
738 Ga0307412_11551651
739 Ga0307416_100003427
740 Ga0307416_100108323
741 Ga0307416_101381811
742 Ga0307414_10182840
743 Ga0307414_10498731
744 Ga0307411_10083100
745 Ga0307411_10531360
746 Ga0307415_100165046
747 Ga0307415_101308975
748 Ga0373958_0001663
749 Ga0373959_0001386
750 Ga0373938_0000205
751 Ga0373928_0001574
752 Ga0373934_0298891
753 Ga0373940_0000037
754 Ga0373949_0000454
755 Ga0373951_0000603
756 Ga0373952_0000666
757 Ga0373923_0035134
758 Ga0373939_0000545
759 Ga0373941_0000148
760 Ga0373956_0187097
761 Ga0373957_0096589
762 Ga0373960_0000908
763 Ga0373955_0053216
764 Ga0373942_0000134
765 Ga0373961_0000639
766 Ga0373931_0255747
767 Ga0373935_0152752
768 Ga0373947_0717560
769 Ga0373937_0002278
770 Ga0373937_0072474
771 Ga0373925_0253445
772 Ga0242420_094503
773 Ga0439453_0002330
774 Ga0451839_1143585
775 Ga0439442_038327
776 Ga0439457_030789
777 Ga0439462_0062743
778 Ga0466963_0636328
779 Ga0451576_0013724
780 Ga0451576_0181255
781 Ga0451576_1141975
782 Ga0495651_0393543
783 Ga0495653_0018335
784 Ga0495582_0129697
785 Ga0495664_0266103
786 Ga0495608_0012387
787 Ga0495608_0234535
788 Ga0495608_0280355
789 Ga0495618_0322748
790 Ga0495628_0230883
791 Ga0495630_0207005
792 Ga0495652_0052312
793 Ga0495640_0017306
794 Ga0495640_0250683
795 Ga0495640_0338566
796 Ga0495586_0005833
797 Ga0495598_0226265
798 Ga0495621_0069476
799 Ga0495645_0018117
800 Ga0495667_0023866
801 Ga0495656_0062670
802 Ga0495656_0097674
803 Ga0495634_0516362
804 Ga0495635_0034873
805 Ga0495635_0191617
806 Ga0495659_0049526
807 Ga0495657_0319625
808 Ga0495599_0467169
809 Ga0495623_0007837
810 Ga0495647_0068359
811 Ga0495658_0022028
812 Ga0495658_0206087
813 Ga0495658_0324196
814 Ga0495669_0089045
815 Ga0495669_0361467
816 Ga0495613_0131129
817 Ga0495613_0237403
818 Ga0495613_0325418
819 Ga0495624_0041905
820 Ga0495600_0016220
821 Ga0495600_0187017
822 Ga0495636_0235141
823 Ga0495674_0051424
824 Ga0495674_0428800
825 Ga0495674_0488434
826 Ga0495672_0012570
827 Ga0495680_0079428
828 Ga0495680_0099318
829 Ga0495675_0017000
830 Ga0495684_0103185
831 Ga0495602_0024728
832 Ga0496101_0167552
833 Ga0496103_0455109
834 Ga0496105_0037101
835 Ga0496108_0001001
836 Ga0496108_0387943
837 Ga0496110_0163115
838 Ga0496111_0117266
839 Ga0496112_0144464
840 Ga0496112_0145923
841 Ga0496112_0217385
842 Ga0496112_0323536
843 Ga0496113_0038317
844 Ga0496113_0226713
845 Ga0501031_0191702
846 Ga0501036_0581512
847 Ga0501039_0069250
848 Ga0501039_1091261
849 Ga0501042_0482077
850 Ga0501043_0361340
851 Ga0501046_0276263
852 Ga0501047_0351098
853 Ga0501067_0291003
854 Ga0501071_0058298
855 Ga0501072_0056259
856 Ga0501076_0020335
857 Ga0501225_0040171
858 Ga0501079_0078277
859 Ga0501079_0872239
860 Ga0501045_0337329
861 nmdc:mga06z11_344125_c1
862 nmdc:mga06z11_86803_c1
863 nmdc:mga04h51_135185_c1
864 nmdc:mga05p37_1198386_c1
865 nmdc:mga05p37_1246242_c1
866 nmdc:mga05p37_131899_c1
867 nmdc:mga05p37_142623_c1
868 nmdc:mga05p37_29368_c1
869 nmdc:mga05p37_414344_c1
870 nmdc:mga05p37_67260_c1
871 nmdc:mga05p37_85140_c1
872 nmdc:mga09592_140507_c1
873 nmdc:mga09592_223827_c1
874 nmdc:mga09592_33274_c1
875 nmdc:mga09592_947256_c1
876 nmdc:mga0qj67_290466_c1
877 nmdc:mga0qj67_366523_c1
878 nmdc:mga06r32_100393_c1
879 nmdc:mga06r32_10430_c1
880 nmdc:mga06r32_1259732_c1
881 nmdc:mga06r32_289545_c1
882 nmdc:mga06r32_339325_c1
883 nmdc:mga06r32_538275_c1
884 nmdc:mga06r32_672487_c1
885 nmdc:mga08y16_16015_c1
886 nmdc:mga08y16_183_c1
887 nmdc:mga08y16_24380_c1
888 nmdc:mga0n895_1106168_c1
889 nmdc:mga0n895_114776_c1
890 nmdc:mga0n895_20818_c1
891 nmdc:mga0n895_4895_c1
892 nmdc:mga0n895_607360_c1
893 nmdc:mga0rr50_113778_c1
894 nmdc:mga0rr50_349_c1
895 nmdc:mga0rr50_457612_c1
896 nmdc:mga0rr50_6174_c1
897 nmdc:mga08x19_18908_c1
898 nmdc:mga08x19_3147_c1
899 nmdc:mga08x19_632941_c1
900 nmdc:mga08x19_68147_c1
901 nmdc:mga08x19_833829_c1
902 nmdc:mga0a205_16056_c1
903 nmdc:mga0a205_316_c3
904 nmdc:mga0a205_640725_c1
905 nmdc:mga0a205_651300_c1
906 nmdc:mga0a205_96318_c1
907 Ga0495601_0157325
908 Ga0495595_0023730
909 Ga0495619_0062596
910 Ga0500641_0002502
911 Ga0500555_000564
912 Ga0500568_0002419
913 Ga0500616_0000340
914 Ga0500645_000036
915 Ga0501082_0194953
916 Ga0501082_0803551

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07152

YaeQ

YaeQ protein

25

197

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ot9-assembly1.cif.gz_A crystal structure of yaeq protein from pseudomonas syringae 0.8931 5 175
7tcb-assembly3.cif.gz_C crystal structure of the yaeq family protein vpa0551 from vibrio parahaemolyticus 0.8817 4 175
2g3w-assembly1.cif.gz_B the crystal structure of yaeq protein from xanthomonas axonopodis pv. citri 0.8733 5 173
7tcb-assembly3.cif.gz_C crystal structure of the yaeq family protein vpa0551 from vibrio parahaemolyticus 0.8622 4 175
3c0u-assembly3.cif.gz_B crystal structure of e.coli yaeq protein 0.8578 1 175
ID Description Score Start End Superfamily
2ot9A01 Alpha Beta;Roll;Restriction endonuclease-like alpha-beta roll fold;Restriction endonuclease-like alpha-beta roll domain 0.8785 5 175 3.10.640.10
2ot9A01 Alpha Beta;Roll;Restriction endonuclease-like alpha-beta roll fold;Restriction endonuclease-like alpha-beta roll domain 0.8545 5 175 3.10.640.10
2g3wB00 Alpha Beta;Roll;Restriction endonuclease-like alpha-beta roll fold;Restriction endonuclease-like alpha-beta roll domain 0.8534 5 172 3.10.640.10
3c0uA00 Alpha Beta;Roll;Restriction endonuclease-like alpha-beta roll fold;Restriction endonuclease-like alpha-beta roll domain 0.8477 1 175 3.10.640.10
3c0uA00 Alpha Beta;Roll;Restriction endonuclease-like alpha-beta roll fold;Restriction endonuclease-like alpha-beta roll domain 0.8294 1 175 3.10.640.10
ID Description Score Start End GO Terms
AF-A0A7R7Y422-F1-model_v4 deleted 0.9766 1 176
AF-A0A2D9H9S0-F1-model_v4 YaeQ family protein 0.9722 1 176
AF-A0A0D0I0H2-F1-model_v4 YaeQ family protein 0.9717 1 176
AF-A0A495LXM2-F1-model_v4 deleted 0.9694 1 176
AF-A0A661MW07-F1-model_v4 YaeQ family protein 0.9692 8 177

Map