F448191

General Info

Members Datasets Scaffolds Average Seq Length
458 279 440 252

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10240834|Ga0157380_102408341
Length 283
Sequence LWTHRRPAGDVAAAALPVDAFTDGLGADPLYTLGMRAEGPVAVVTGAGSGIGRRVSLDLAAAGYRVVLAGRRVSTLDETAAAAPESTLVVATDVTDPAAVRDLFARARDRYGRVDVLFNNAGAFGRTAPIADVSYEQWQAVVDTNLTGAFLCAQEAFRAMRDQSPQGGRIINNGSISAHVPRPYAVGYTATKHAVTGLTKQIALEGRPYRIACGQIDIGNAATDMTAAMSQGVPQASGQIAAEPRMDVAHAASAVVYMAGLPLDANVLFLTVMATTMPYVGRG

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
4 2643221558 Rhizobium sp. Root149 Isolate Unclassified
5 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
6 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
7 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
8 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
9 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
10 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
11 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
12 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
13 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
14 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
15 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
16 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
165 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
166 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
167 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
168 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
169 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
170 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
171 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
174 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
175 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
179 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
189 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
190 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
191 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
196 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
197 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
198 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
199 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
200 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
201 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
202 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
203 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
204 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
205 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
206 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
207 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
208 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
209 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
210 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
211 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
212 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
213 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
214 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
215 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
216 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
217 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
218 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
219 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
220 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
221 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
222 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
233 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
234 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
235 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
236 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
237 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
250 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
251 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
252 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
253 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
254 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
255 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
256 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
257 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
258 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
259 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
260 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
263 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
264 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
265 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
266 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
267 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
268 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
269 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
270 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
271 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
272 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
273 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
274 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
275 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
276 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
277 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
278 641522639 Methylobacterium sp. 4-46 Isolate Nodule
279 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.07
Metatranscriptomes 0
Isolates 3.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.75
Nodule 2.4
Rhizoplane 3.71
Rhizosphere 89.52
Stem 0
Stem Tuber 0
Unclassified 2.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10001919 3300005328 Bacteria 10570
2 Ga0070683_100079079 3300005329 Bacteria 3077
3 Ga0070690_100149786 3300005330 Bacteria 1591
4 Ga0070670_100000942 3300005331 Bacteria 22849
5 Ga0070670_100119509 3300005331 Bacteria 2273
6 Ga0070670_100324426 3300005331 Bacteria 1349
7 Ga0068869_100162242 3300005334 Bacteria 1740
8 Ga0070666_10000980 3300005335 Bacteria 17428
9 Ga0070666_10001480 3300005335 Bacteria 14261
10 Ga0070680_100002207 3300005336 Bacteria 14358
11 Ga0068868_100008656 3300005338 Bacteria 7288
12 Ga0068868_100031507 3300005338 Bacteria 4074
13 Ga0068868_100039202 3300005338 Bacteria 3681
14 Ga0068868_100518586 3300005338 Bacteria 1046
15 Ga0070660_100017052 3300005339 Bacteria 5288
16 Ga0070689_100087994 3300005340 Bacteria 2444
17 Ga0070687_100254601 3300005343 Bacteria 1092
18 Ga0070661_100002539 3300005344 Bacteria 12500
19 Ga0070661_100005214 3300005344 Bacteria 8948
20 Ga0070661_100014138 3300005344 Bacteria 5622
21 Ga0070661_100218494 3300005344 Bacteria 1461
22 Ga0070692_10010952 3300005345 Bacteria 4150
23 Ga0070668_100002148 3300005347 Bacteria 14431
24 Ga0070669_100000902 3300005353 Bacteria 21625
25 Ga0070675_100005393 3300005354 Bacteria 9777
26 Ga0070675_100012086 3300005354 Bacteria 6767
27 Ga0070671_100025620 3300005355 Bacteria 4841
28 Ga0070671_100027700 3300005355 Bacteria 4665
29 Ga0070673_100008859 3300005364 Bacteria 6720
30 Ga0070673_100029541 3300005364 Bacteria 4089
31 Ga0070659_100165797 3300005366 Bacteria 1808
32 Ga0070667_100005034 3300005367 Bacteria 11058
33 Ga0070667_100020528 3300005367 Bacteria 5485
34 Ga0070667_100048426 3300005367 Bacteria 3577
35 Ga0070703_10022795 3300005406 Bacteria 1840
36 Ga0070709_10043314 3300005434 Bacteria 2783
37 Ga0070709_10317924 3300005434 Bacteria 1142
38 Ga0070714_100000907 3300005435 Bacteria 20951
39 Ga0070714_100161610 3300005435 Bacteria 2027
40 Ga0070713_100024026 3300005436 Bacteria 4741
41 Ga0070713_100274591 3300005436 Bacteria 1545
42 Ga0070711_100136754 3300005439 Bacteria 1832
43 Ga0070708_100348695 3300005445 Bacteria 1395
44 Ga0070663_100119695 3300005455 Bacteria 1987
45 Ga0070663_100165476 3300005455 Bacteria 1705
46 Ga0070678_100011013 3300005456 Bacteria 5556
47 Ga0070662_100418389 3300005457 Bacteria 1108
48 Ga0070681_10013713 3300005458 Bacteria 8067
49 Ga0070681_10021019 3300005458 Bacteria 6539
50 Ga0070681_10039652 3300005458 Bacteria 4721
51 Ga0070681_10060262 3300005458 Bacteria 3773
52 Ga0070681_10236846 3300005458 Bacteria 1739
53 Ga0070681_10792465 3300005458 Bacteria 865
54 Ga0068867_100001642 3300005459 Bacteria 15531
55 Ga0068867_100028049 3300005459 Bacteria 4052
56 Ga0070706_100000025 3300005467 Bacteria 156371
57 Ga0070707_100148919 3300005468 Bacteria 2278
58 Ga0070679_100008661 3300005530 Bacteria 9586
59 Ga0070679_100019317 3300005530 Bacteria 6623
60 Ga0070679_100032622 3300005530 Bacteria 5153
61 Ga0070684_100031057 3300005535 Bacteria 4545
62 Ga0070684_100031806 3300005535 Bacteria 4494
63 Ga0070697_100363806 3300005536 Bacteria 1251
64 Ga0068853_100005415 3300005539 Bacteria 10002
65 Ga0068853_100331286 3300005539 Bacteria 1413
66 Ga0070672_100001696 3300005543 Bacteria 13754
67 Ga0070686_100026508 3300005544 Bacteria 3499
68 Ga0070693_100009090 3300005547 Bacteria 4932
69 Ga0070665_100001166 3300005548 Bacteria 32311
70 Ga0070665_100016646 3300005548 Bacteria 7369
71 Ga0068855_100001261 3300005563 Bacteria 31420
72 Ga0068855_100026942 3300005563 Bacteria 6878
73 Ga0068855_100035818 3300005563 Bacteria 5910
74 Ga0070664_100001374 3300005564 Bacteria 19392
75 Ga0068854_100014241 3300005578 Bacteria 5238
76 Ga0068856_101011246 3300005614 Bacteria 849
77 Ga0070702_100023072 3300005615 Bacteria 3301
78 Ga0068852_100003496 3300005616 Bacteria 10984
79 Ga0068852_100190205 3300005616 Bacteria 1936
80 Ga0068859_100002054 3300005617 Bacteria 20554
81 Ga0068859_100062611 3300005617 Bacteria 3750
82 Ga0068859_100503778 3300005617 Bacteria 1306
83 Ga0068864_100000613 3300005618 Bacteria 30125
84 Ga0068864_100002502 3300005618 Bacteria 15196
85 Ga0068861_100032999 3300005719 Bacteria 3816
86 Ga0068861_100134140 3300005719 Bacteria 2013
87 Ga0068861_100141362 3300005719 Bacteria 1965
88 Ga0068851_10130876 3300005834 Bacteria 1357
89 Ga0068863_100002665 3300005841 Bacteria 17651
90 Ga0068863_100057817 3300005841 Bacteria 3670
91 Ga0068863_100206523 3300005841 Bacteria 1890
92 Ga0068863_100401452 3300005841 Bacteria 1341
93 Ga0068858_100004520 3300005842 Bacteria 13638
94 Ga0068858_100061667 3300005842 Bacteria 3467
95 Ga0068858_100066124 3300005842 Bacteria 3346
96 Ga0068858_100130275 3300005842 Bacteria 2358
97 Ga0068860_100003039 3300005843 Bacteria 17319
98 Ga0068862_100006717 3300005844 Bacteria 9543
99 Ga0068862_100103917 3300005844 Bacteria 2488
100 Ga0081539_10050721 3300005985 Bacteria 2346
101 Ga0070717_10014990 3300006028 Bacteria 5971
102 Ga0075365_10160986 3300006038 Bacteria 1564
103 Ga0070715_10026240 3300006163 Unclassified 2316
104 Ga0070716_100024008 3300006173 Bacteria 3241
105 Ga0070716_100033397 3300006173 Bacteria 2814
106 Ga0070712_100131016 3300006175 Bacteria 1900
107 Ga0097621_100004867 3300006237 Bacteria 9411
108 Ga0068871_100001733 3300006358 Bacteria 14694
109 Ga0075428_100114014 3300006844 Bacteria 2945
110 Ga0075433_10157192 3300006852 Bacteria 2023
111 Ga0075434_100172235 3300006871 Bacteria 2185
112 Ga0068865_100023973 3300006881 Bacteria 4000
113 Ga0068865_100059936 3300006881 Bacteria 2663
114 Ga0068865_100158104 3300006881 Bacteria 1726
115 Ga0097620_100002054 3300006931 Bacteria 20554
116 Ga0097620_100006397 3300006931 Bacteria 11951
117 Ga0097620_100062611 3300006931 Bacteria 3750
118 Ga0097620_100503761 3300006931 Bacteria 1306
119 Ga0099794_10002241 3300007265 Bacteria 7077
120 Ga0105240_10000085 3300009093 Bacteria 189341
121 Ga0105240_10010005 3300009093 Bacteria 13361
122 Ga0105240_10015177 3300009093 Bacteria 10485
123 Ga0105240_10176930 3300009093 Bacteria 2522
124 Ga0105240_10541544 3300009093 Bacteria 1289
125 Ga0105240_11021969 3300009093 Bacteria 883
126 Ga0111539_10043773 3300009094 Bacteria 5367
127 Ga0111539_10131605 3300009094 Bacteria 2929
128 Ga0105245_10030840 3300009098 Bacteria 4741
129 Ga0105245_10034531 3300009098 Bacteria 4486
130 Ga0105245_10153378 3300009098 Bacteria 2180
131 Ga0105245_10311603 3300009098 Bacteria 1548
132 Ga0114129_10004635 3300009147 Bacteria 19400
133 Ga0105243_10043004 3300009148 Bacteria 3540
134 Ga0105243_10254838 3300009148 Bacteria 1568
135 Ga0105248_10016212 3300009177 Bacteria 8201
136 Ga0105248_10023288 3300009177 Bacteria 6878
137 Ga0105248_10606474 3300009177 Bacteria 1235
138 Ga0105237_10018125 3300009545 Bacteria 7290
139 Ga0105237_10025942 3300009545 Bacteria 5991
140 Ga0105237_10203401 3300009545 Bacteria 1981
141 Ga0105238_10005011 3300009551 Bacteria 13089
142 Ga0105238_10188306 3300009551 Bacteria 2040
143 Ga0105238_10262862 3300009551 Bacteria 1705
144 Ga0105239_10000381 3300010375 Bacteria 64672
145 Ga0105239_10206195 3300010375 Bacteria 2203
146 Ga0105239_10392876 3300010375 Bacteria 1569
147 Ga0157342_1015203 3300012507 Bacteria 840
148 Ga0157371_10191225 3300013102 Bacteria 1465
149 Ga0157370_10001215 3300013104 Bacteria 32262
150 Ga0157370_10003299 3300013104 Bacteria 19024
151 Ga0157370_10008587 3300013104 Bacteria 11001
152 Ga0157370_10487154 3300013104 Bacteria 1133
153 Ga0157370_10583589 3300013104 Bacteria 1024
154 Ga0157369_10011912 3300013105 Bacteria 9876
155 Ga0157369_10026580 3300013105 Bacteria 6419
156 Ga0157374_10008322 3300013296 Bacteria 8853
157 Ga0157374_10052178 3300013296 Bacteria 3808
158 Ga0157374_10510951 3300013296 Bacteria 1207
159 Ga0163162_10003019 3300013306 Bacteria 16081
160 Ga0163162_10487913 3300013306 Bacteria 1363
161 Ga0163162_10496222 3300013306 Bacteria 1351
162 Ga0163162_10516440 3300013306 Bacteria 1324
163 Ga0157372_10023566 3300013307 Bacteria 6675
164 Ga0157375_10411405 3300013308 Bacteria 1519
165 Ga0163163_10086457 3300014325 Bacteria 3145
166 Ga0157380_10125785 3300014326 Bacteria 2179
167 Ga0157380_10240834 3300014326 Bacteria 1631
168 Ga0157377_10113842 3300014745 Bacteria 1630
169 Ga0157379_10011216 3300014968 Bacteria 7808
170 Ga0157376_10067119 3300014969 Bacteria 3033
171 Ga0157376_10150566 3300014969 Bacteria 2098
172 Ga0163161_10112427 3300017792 Bacteria 2037
173 Ga0163161_10150083 3300017792 Bacteria 1771
174 Ga0209563_102348 3300025230 Bacteria 4324
175 Ga0207697_10014150 3300025315 Bacteria 3316
176 Ga0207653_10000659 3300025885 Bacteria 11877
177 Ga0207642_10074147 3300025899 Bacteria 1630
178 Ga0207688_10017375 3300025901 Bacteria 3908
179 Ga0207680_10025115 3300025903 Bacteria 3282
180 Ga0207680_10207955 3300025903 Bacteria 1337
181 Ga0207680_10307890 3300025903 Bacteria 1105
182 Ga0207685_10082804 3300025905 Bacteria 1332
183 Ga0207645_10000097 3300025907 Bacteria 64388
184 Ga0207645_10150584 3300025907 Bacteria 1518
185 Ga0207705_10075394 3300025909 Bacteria 2450
186 Ga0207684_10000063 3300025910 Bacteria 196933
187 Ga0207684_10000072 3300025910 Bacteria 185716
188 Ga0207707_10007903 3300025912 Bacteria 9251
189 Ga0207707_10068222 3300025912 Bacteria 3098
190 Ga0207695_10000003 3300025913 Bacteria 1368691
191 Ga0207671_10023865 3300025914 Bacteria 4607
192 Ga0207671_10051862 3300025914 Bacteria 3039
193 Ga0207693_10002359 3300025915 Bacteria 16393
194 Ga0207693_10230832 3300025915 Bacteria 1453
195 Ga0207663_10042166 3300025916 Bacteria 2787
196 Ga0207660_10003146 3300025917 Bacteria 10803
197 Ga0207657_10011545 3300025919 Bacteria 8768
198 Ga0207657_10467470 3300025919 Bacteria 989
199 Ga0207649_10068111 3300025920 Bacteria 2262
200 Ga0207652_10003071 3300025921 Bacteria 13937
201 Ga0207646_10049414 3300025922 Bacteria 3767
202 Ga0207646_10070499 3300025922 Bacteria 3122
203 Ga0207681_10051172 3300025923 Bacteria 2797
204 Ga0207681_10203432 3300025923 Bacteria 1522
205 Ga0207694_10049364 3300025924 Bacteria 3258
206 Ga0207694_10217242 3300025924 Bacteria 1559
207 Ga0207650_10001752 3300025925 Bacteria 15406
208 Ga0207650_10019928 3300025925 Bacteria 4721
209 Ga0207650_10158501 3300025925 Bacteria 1791
210 Ga0207650_10268741 3300025925 Bacteria 1385
211 Ga0207659_10008567 3300025926 Bacteria 6357
212 Ga0207700_10024546 3300025928 Bacteria 4174
213 Ga0207700_10202136 3300025928 Bacteria 1675
214 Ga0207700_10410795 3300025928 Bacteria 1187
215 Ga0207664_10010932 3300025929 Bacteria 6427
216 Ga0207664_10486723 3300025929 Bacteria 1104
217 Ga0207644_10046231 3300025931 Bacteria 3100
218 Ga0207686_10079823 3300025934 Bacteria 2132
219 Ga0207686_10304260 3300025934 Bacteria 1185
220 Ga0207704_10141197 3300025938 Bacteria 1685
221 Ga0207665_10019453 3300025939 Bacteria 4464
222 Ga0207665_10387320 3300025939 Bacteria 1062
223 Ga0207691_10000327 3300025940 Bacteria 47338
224 Ga0207711_10013222 3300025941 Bacteria 6857
225 Ga0207711_10187408 3300025941 Bacteria 1884
226 Ga0207711_10283045 3300025941 Bacteria 1527
227 Ga0207689_10029346 3300025942 Bacteria 4594
228 Ga0207689_10122879 3300025942 Bacteria 2135
229 Ga0207689_10245021 3300025942 Bacteria 1482
230 Ga0207679_10100374 3300025945 Bacteria 2262
231 Ga0207679_10220236 3300025945 Bacteria 1596
232 Ga0207667_10000116 3300025949 Bacteria 128218
233 Ga0207651_10009142 3300025960 Bacteria 5399
234 Ga0207651_10021827 3300025960 Bacteria 3900
235 Ga0207712_10067783 3300025961 Bacteria 2555
236 Ga0207640_10122280 3300025981 Bacteria 1867
237 Ga0207640_10148937 3300025981 Bacteria 1717
238 Ga0207658_10005177 3300025986 Bacteria 8977
239 Ga0207658_10017684 3300025986 Bacteria 4916
240 Ga0207658_10069409 3300025986 Bacteria 2662
241 Ga0207677_10013067 3300026023 Bacteria 4797
242 Ga0207677_10032018 3300026023 Bacteria 3375
243 Ga0207677_10151307 3300026023 Bacteria 1791
244 Ga0207677_10374843 3300026023 Bacteria 1199
245 Ga0207677_10453154 3300026023 Bacteria 1100
246 Ga0207677_10821044 3300026023 Bacteria 833
247 Ga0207703_10064763 3300026035 Bacteria 3001
248 Ga0207703_10106045 3300026035 Bacteria 2390
249 Ga0207703_10167083 3300026035 Bacteria 1932
250 Ga0207703_10340031 3300026035 Bacteria 1379
251 Ga0207639_10348603 3300026041 Bacteria 1322
252 Ga0207678_10127480 3300026067 Bacteria 2171
253 Ga0207678_10203138 3300026067 Bacteria 1695
254 Ga0207708_10002344 3300026075 Bacteria 13905
255 Ga0207702_10314217 3300026078 Bacteria 1490
256 Ga0207641_10028361 3300026088 Bacteria 4625
257 Ga0207641_10099336 3300026088 Bacteria 2561
258 Ga0207648_10000426 3300026089 Bacteria 46419
259 Ga0207648_10208742 3300026089 Bacteria 1733
260 Ga0207648_10427906 3300026089 Bacteria 1203
261 Ga0207676_10077739 3300026095 Bacteria 2685
262 Ga0207676_10185073 3300026095 Bacteria 1827
263 Ga0207675_100002354 3300026118 Bacteria 18699
264 Ga0207675_100039462 3300026118 Bacteria 4406
265 Ga0207675_100164471 3300026118 Bacteria 2118
266 Ga0207675_100173042 3300026118 Bacteria 2065
267 Ga0207683_10000273 3300026121 Bacteria 46113
268 Ga0207698_10043097 3300026142 Bacteria 3378
269 Ga0207698_10244111 3300026142 Bacteria 1639
270 Ga0207428_10205340 3300027907 Bacteria 1482
271 Ga0268266_10012153 3300028379 Bacteria 7451
272 Ga0268266_10067043 3300028379 Bacteria 3105
273 Ga0268265_10125346 3300028380 Bacteria 2124
274 Ga0268265_10234838 3300028380 Bacteria 1614
275 Ga0268264_10014938 3300028381 Bacteria 6376
276 Ga0268264_10133116 3300028381 Bacteria 2207
277 Ga0268264_10468429 3300028381 Bacteria 1223
278 Ga0268264_10621354 3300028381 Bacteria 1067
279 Ga0265338_10204634 3300028800 Bacteria 1486
280 Ga0265338_10347874 3300028800 Bacteria 1067
281 Ga0265324_10044109 3300029957 Bacteria 1538
282 Ga0265320_10014274 3300031240 Bacteria 4528
283 Ga0265340_10052677 3300031247 Bacteria 1967
284 Ga0265331_10008083 3300031250 Bacteria 6009
285 Ga0265316_10000651 3300031344 Bacteria 38560
286 Ga0265314_10179166 3300031711 Bacteria 1272
287 Ga0326468_10006837 3300031889 Bacteria 1066
288 Ga0307415_100001722 3300032126 Bacteria 10643
289 Ga0307510_10158978 3300033180 Bacteria 1860
290 Ga0373960_0054170 3300035121 Bacteria 1199
291 Ga0316574_0237752 3300035398 Bacteria 1165
292 Ga0373931_0240766 3300035691 Bacteria 1097
293 Ga0373927_0100431 3300035695 Bacteria 1881
294 Ga0373933_0165837 3300035724 Bacteria 1404
295 Ga0373947_0074796 3300035725 Bacteria 2085
296 Ga0373937_0016489 3300036401 Bacteria 6563
297 Ga0373925_0002903 3300037068 Bacteria 13525
298 Ga0395899_0000044 3300037312 Bacteria 248735
299 Ga0395900_0000042 3300037418 Bacteria 242667
300 Ga0395898_0000080 3300037466 Bacteria 242667
301 Ga0395905_0000044 3300037471 Bacteria 242916
302 Ga0395905_0021169 3300037471 Bacteria 6156
303 Ga0395901_0000027 3300038443 Bacteria 244204
304 Ga0436365_0747596 3300039437 Bacteria 1394
305 Ga0439449_0139633 3300042007 Bacteria 902
306 Ga0451577_0005641 3300042876 Bacteria 12717
307 Ga0451577_0068778 3300042876 Bacteria 3158
308 Ga0453683_0166429 3300044673 Bacteria 1396
309 Ga0453684_0000841 3300044712 Bacteria 103501
310 Ga0453684_0154651 3300044712 Bacteria 2721
311 Ga0466959_0073112 3300045049 Bacteria 2481
312 Ga0451576_0009034 3300045051 Bacteria 11607
313 Ga0466967_0601827 3300045976 Bacteria 1085
314 Ga0495592_0048388 3300046454 Bacteria 3163
315 Ga0495651_0142604 3300046462 Bacteria 1735
316 Ga0495653_0032468 3300046463 Bacteria 4144
317 Ga0495650_0000018 3300046471 Bacteria 538888
318 Ga0495662_0157993 3300046476 Bacteria 1117
319 Ga0495608_0003409 3300046511 Bacteria 11389
320 Ga0495618_0073679 3300046514 Bacteria 2174
321 Ga0495643_0010116 3300046522 Bacteria 5816
322 Ga0495652_0335743 3300046529 Bacteria 1087
323 Ga0495640_0034338 3300046533 Bacteria 3598
324 Ga0495587_0136821 3300046536 Bacteria 1399
325 Ga0495645_0124646 3300046543 Bacteria 1811
326 Ga0495645_0232839 3300046543 Bacteria 1233
327 Ga0495667_0003850 3300046559 Bacteria 10074
328 Ga0495667_0346798 3300046559 Bacteria 938
329 Ga0495634_0107372 3300046642 Bacteria 1798
330 Ga0495635_0008980 3300046663 Bacteria 6976
331 Ga0495661_0003924 3300046665 Bacteria 10856
332 Ga0495657_0051737 3300046675 Bacteria 2757
333 Ga0495657_0160164 3300046675 Bacteria 1393
334 Ga0495623_0018544 3300046679 Bacteria 4494
335 Ga0495646_0003120 3300046680 Bacteria 10278
336 Ga0495613_0151545 3300046689 Bacteria 1653
337 Ga0495600_0017593 3300046809 Bacteria 4549
338 Ga0495581_0110059 3300047315 Bacteria 1602
339 Ga0495604_0006432 3300047317 Bacteria 9322
340 Ga0495674_0016831 3300047319 Bacteria 6818
341 Ga0495674_0069119 3300047319 Bacteria 3055
342 Ga0495674_0224184 3300047319 Bacteria 1553
343 Ga0495680_0046568 3300047322 Bacteria 3418
344 Ga0495687_003696 3300047443 Bacteria 10874
345 Ga0495675_0075778 3300047444 Bacteria 2120
346 Ga0495602_0017602 3300048088 Bacteria 7160
347 Ga0496101_0337810 3300048904 Bacteria 1183
348 Ga0496102_0063941 3300048905 Bacteria 3370
349 Ga0496102_0224635 3300048905 Bacteria 1770
350 Ga0496102_0476808 3300048905 Bacteria 1169
351 Ga0496104_0002404 3300048907 Bacteria 16117
352 Ga0496104_0077368 3300048907 Bacteria 3170
353 Ga0496105_0069959 3300048908 Bacteria 2901
354 Ga0496106_0056724 3300048909 Bacteria 2961
355 Ga0496106_0631014 3300048909 Bacteria 857
356 Ga0496107_0046856 3300048910 Bacteria 3112
357 Ga0496107_0317258 3300048910 Bacteria 1160
358 Ga0496109_0064433 3300048912 Bacteria 3354
359 Ga0496109_0369309 3300048912 Bacteria 1355
360 Ga0496110_0172679 3300048913 Bacteria 1961
361 Ga0496110_0185885 3300048913 Bacteria 1887
362 Ga0496110_0471042 3300048913 Bacteria 1144
363 Ga0496114_0028963 3300048917 Bacteria 4549
364 Ga0496119_0001511 3300048922 Bacteria 27813
365 Ga0496122_0005927 3300048925 Bacteria 14303
366 Ga0496122_0081181 3300048925 Bacteria 2258
367 Ga0496123_0000792 3300048926 Bacteria 51045
368 Ga0496125_0183016 3300048928 Bacteria 1393
369 Ga0495682_0002300 3300049460 Bacteria 9120
370 Ga0501031_0025706 3300049568 Bacteria 3840
371 Ga0501032_0118802 3300049569 Bacteria 1748
372 Ga0501032_0126839 3300049569 Bacteria 1685
373 Ga0501033_0040650 3300049570 Bacteria 3471
374 Ga0501034_0004787 3300049571 Bacteria 14971
375 Ga0501034_0124552 3300049571 Bacteria 2562
376 Ga0501034_0381695 3300049571 Bacteria 1334
377 Ga0501036_0020555 3300049572 Bacteria 5544
378 Ga0501037_0158110 3300049573 Bacteria 1616
379 Ga0501037_0206633 3300049573 Bacteria 1386
380 Ga0501038_0025422 3300049574 Bacteria 5278
381 Ga0501039_0063133 3300049575 Bacteria 2870
382 Ga0501039_0309125 3300049575 Bacteria 1242
383 Ga0501042_0002188 3300049578 Bacteria 11923
384 Ga0501043_0125058 3300049579 Bacteria 2016
385 Ga0501043_0231735 3300049579 Bacteria 1426
386 Ga0501046_0003878 3300049580 Bacteria 13680
387 Ga0501046_0119187 3300049580 Bacteria 2009
388 Ga0501046_0292903 3300049580 Bacteria 1190
389 Ga0501047_0001576 3300049581 Bacteria 22267
390 Ga0501047_0058228 3300049581 Bacteria 3732
391 Ga0501047_0060020 3300049581 Bacteria 3671
392 Ga0501067_0000855 3300049583 Bacteria 16420
393 Ga0501067_0009581 3300049583 Bacteria 5364
394 Ga0501068_0002310 3300049584 Bacteria 10161
395 Ga0501068_0137907 3300049584 Bacteria 1528
396 Ga0501069_0003760 3300049585 Bacteria 7803
397 Ga0501069_0030501 3300049585 Bacteria 2961
398 Ga0501070_0003737 3300049586 Bacteria 13143
399 Ga0501072_0014867 3300049588 Bacteria 5966
400 Ga0501073_0000326 3300049589 Bacteria 31963
401 Ga0501073_0029505 3300049589 Bacteria 3919
402 Ga0501073_0037948 3300049589 Bacteria 3419
403 Ga0501074_0000161 3300049590 Bacteria 35505
404 Ga0501074_0026688 3300049590 Bacteria 4187
405 Ga0501076_0124907 3300049592 Bacteria 2085
406 Ga0501076_0233132 3300049592 Bacteria 1505
407 Ga0501079_0238740 3300049741 Bacteria 1420
408 Ga0501079_0305589 3300049741 Bacteria 1244
409 Ga0501080_0000713 3300049742 Bacteria 26727
410 Ga0501080_0022235 3300049742 Bacteria 5874
411 Ga0501083_0000202 3300049744 Bacteria 38376
412 Ga0501083_0083188 3300049744 Bacteria 2120
413 Ga0501035_0004618 3300049822 Bacteria 13059
414 Ga0501035_0010215 3300049822 Bacteria 8712
415 Ga0501035_0321027 3300049822 Bacteria 1301
416 Ga0501044_0062945 3300049823 Bacteria 3791
417 Ga0501044_0239058 3300049823 Bacteria 1760
418 Ga0501045_0012731 3300049824 Bacteria 5925
419 nmdc:mga0k408_191138_c1 3300050493 Bacteria 1221
420 nmdc:mga05p37_2781_c1 3300050507 Bacteria 20350
421 nmdc:mga06r32_133970_c1 3300050510 Bacteria 2452
422 nmdc:mga08y16_157779_c1 3300050511 Bacteria 2358
423 nmdc:mga08y16_412674_c1 3300050511 Bacteria 1381
424 nmdc:mga0n895_212665_c1 3300050512 Bacteria 1964
425 nmdc:mga0a205_177819_c1 3300050515 Unclassified 2023
426 nmdc:mga0a205_9430_c1 3300050515 Bacteria 6759
427 Ga0495612_0060723 3300053078 Bacteria 1565
428 Ga0495595_0020746 3300053084 Bacteria 2862
429 Ga0495595_0021701 3300053084 Bacteria 2808
430 Ga0495619_0022654 3300053085 Bacteria 4022
431 Ga0495619_0025460 3300053085 Bacteria 3800
432 Ga0500556_0000155 3300053104 Bacteria 57500
433 Ga0500624_006223 3300053157 Bacteria 1610
434 Ga0500634_0000019 3300053161 Bacteria 109764
435 Ga0500634_0135305 3300053161 Bacteria 1176
436 Ga0500645_034082 3300053730 Bacteria 1521
437 Ga0501084_0000771 3300054114 Bacteria 24363
438 Ga0501084_0008592 3300054114 Bacteria 8445
439 Ga0501082_0000764 3300060353 Bacteria 28162
440 Ga0501082_0160234 3300060353 Bacteria 1955

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006931 Ga0097620_100006397 Ga0097620_1000063977 230
2 3300009177 Ga0105248_10023288 Ga0105248_100232882 230
3 3300025941 Ga0207711_10013222 Ga0207711_100132228 230
4 3300005329 Ga0070683_100079079 Ga0070683_1000790794 234
5 3300005336 Ga0070680_100002207 Ga0070680_1000022078 234
6 3300005339 Ga0070660_100017052 Ga0070660_1000170525 234
7 3300005344 Ga0070661_100002539 Ga0070661_10000253911 234
8 3300005366 Ga0070659_100165797 Ga0070659_1001657972 234
9 3300005458 Ga0070681_10013713 Ga0070681_100137138 234
10 3300005530 Ga0070679_100032622 Ga0070679_1000326222 234
11 3300005535 Ga0070684_100031057 Ga0070684_1000310576 234
12 3300005539 Ga0068853_100005415 Ga0068853_1000054156 234
13 3300005578 Ga0068854_100014241 Ga0068854_1000142416 234
14 3300005616 Ga0068852_100003496 Ga0068852_1000034963 234
15 3300025919 Ga0207657_10011545 Ga0207657_100115456 234
16 3300025981 Ga0207640_10122280 Ga0207640_101222802 234
17 3300025922 Ga0207646_10070499 Ga0207646_100704992 235
18 3300009093 Ga0105240_10015177 Ga0105240_100151773 236
19 3300009545 Ga0105237_10018125 Ga0105237_100181253 236
20 3300010375 Ga0105239_10206195 Ga0105239_102061953 236
21 3300013102 Ga0157371_10191225 Ga0157371_101912252 236
22 3300013104 Ga0157370_10003299 Ga0157370_100032993 236
23 3300013307 Ga0157372_10023566 Ga0157372_100235666 236
24 3300013308 Ga0157375_10411405 Ga0157375_104114051 236
25 3300025912 Ga0207707_10007903 Ga0207707_100079033 236
26 3300025914 Ga0207671_10023865 Ga0207671_100238652 236
27 3300025917 Ga0207660_10003146 Ga0207660_1000314611 236
28 3300025921 Ga0207652_10003071 Ga0207652_100030716 236
29 3300025945 Ga0207679_10100374 Ga0207679_101003743 236
30 3300025981 Ga0207640_10148937 Ga0207640_101489372 236
31 3300026023 Ga0207677_10374843 Ga0207677_103748432 236
32 3300026067 Ga0207678_10203138 Ga0207678_102031382 236
33 3300026078 Ga0207702_10314217 Ga0207702_103142172 236
34 3300026142 Ga0207698_10244111 Ga0207698_102441112 236
35 3300028381 Ga0268264_10468429 Ga0268264_104684292 236
36 3300005455 Ga0070663_100119695 Ga0070663_1001196951 237
37 3300005536 Ga0070697_100363806 Ga0070697_1003638061 237
38 3300025942 Ga0207689_10245021 Ga0207689_102450211 237
39 3300026035 Ga0207703_10340031 Ga0207703_103400311 237
40 3300025924 Ga0207694_10049364 Ga0207694_100493644 238
41 3300032126 Ga0307415_100001722 Ga0307415_1000017227 239
42 3300017792 Ga0163161_10150083 Ga0163161_101500832 240
43 3300005458 Ga0070681_10021019 Ga0070681_100210195 243
44 3300005458 Ga0070681_10039652 Ga0070681_100396522 243
45 3300005458 Ga0070681_10792465 Ga0070681_107924651 243
46 3300005530 Ga0070679_100008661 Ga0070679_1000086619 243
47 3300005530 Ga0070679_100019317 Ga0070679_1000193173 243
48 3300005563 Ga0068855_100026942 Ga0068855_1000269425 243
49 3300005563 Ga0068855_100035818 Ga0068855_1000358182 243
50 3300009093 Ga0105240_10010005 Ga0105240_1001000511 243
51 3300009093 Ga0105240_10176930 Ga0105240_101769302 243
52 3300009551 Ga0105238_10005011 Ga0105238_100050113 243
53 3300009551 Ga0105238_10188306 Ga0105238_101883063 243
54 3300013104 Ga0157370_10008587 Ga0157370_100085873 243
55 3300013105 Ga0157369_10011912 Ga0157369_100119123 243
56 3300026118 Ga0207675_100002354 Ga0207675_10000235414 243
57 3300048925 Ga0496122_0081181 Ga0496122_0081181_904_1680 243
58 3300005841 Ga0068863_100401452 Ga0068863_1004014522 244
59 3300009098 Ga0105245_10311603 Ga0105245_103116032 244
60 3300013104 Ga0157370_10001215 Ga0157370_100012156 244
61 3300026088 Ga0207641_10099336 Ga0207641_100993363 244
62 3300046471 Ga0495650_0000018 Ga0495650_0000018_149065_149808 244
63 3300005435 Ga0070714_100161610 Ga0070714_1001616102 246
64 3300012507 Ga0157342_1015203 Ga0157342_10152031 246
65 3300013306 Ga0163162_10516440 Ga0163162_105164402 246
66 3300025942 Ga0207689_10122879 Ga0207689_101228793 246
67 3300035691 Ga0373931_0240766 Ga0373931_0240766_11_751 246
68 3300048913 Ga0496110_0471042 Ga0496110_0471042_244_984 246
69 iso_pu_bacteria 2684623219 2687239739 246
70 3300005331 Ga0070670_100000942 Ga0070670_1000009426 247
71 3300025925 Ga0207650_10001752 Ga0207650_100017529 247
72 3300048922 Ga0496119_0001511 Ga0496119_0001511_20691_21440 247
73 3300048925 Ga0496122_0005927 Ga0496122_0005927_5717_6466 247
74 3300048926 Ga0496123_0000792 Ga0496123_0000792_31098_31847 247
75 3300053104 Ga0500556_0000155 Ga0500556_0000155_22248_22997 247
76 3300053157 Ga0500624_006223 Ga0500624_006223_705_1508 247
77 3300053161 Ga0500634_0000019 Ga0500634_0000019_24064_24867 247
78 3300053161 Ga0500634_0135305 Ga0500634_0135305_126_929 247
79 3300053730 Ga0500645_034082 Ga0500645_034082_472_1221 247
80 iso_pu_bacteria 2545555834 2545672556 247
81 iso_pu_bacteria 2775506901 2776259270 247
82 iso_pu_bacteria 2919450847 2919451177 247
83 iso_pu_bacteria 641522639 641644324 247
84 iso_pu_bacteria 8001845381 8001848640 247
85 3300005335 Ga0070666_10000980 Ga0070666_100009808 248
86 3300005338 Ga0068868_100039202 Ga0068868_1000392025 248
87 3300005344 Ga0070661_100005214 Ga0070661_1000052148 248
88 3300005344 Ga0070661_100014138 Ga0070661_1000141384 248
89 3300005344 Ga0070661_100218494 Ga0070661_1002184942 248
90 3300005355 Ga0070671_100027700 Ga0070671_1000277003 248
91 3300005364 Ga0070673_100029541 Ga0070673_1000295411 248
92 3300005367 Ga0070667_100005034 Ga0070667_1000050347 248
93 3300005544 Ga0070686_100026508 Ga0070686_1000265083 248
94 3300005563 Ga0068855_100001261 Ga0068855_10000126121 248
95 3300005617 Ga0068859_100503778 Ga0068859_1005037782 248
96 3300005618 Ga0068864_100000613 Ga0068864_10000061312 248
97 3300005841 Ga0068863_100057817 Ga0068863_1000578173 248
98 3300005842 Ga0068858_100061667 Ga0068858_1000616673 248
99 3300006931 Ga0097620_100503761 Ga0097620_1005037611 248
100 3300009093 Ga0105240_10000085 Ga0105240_1000008599 248
101 3300009177 Ga0105248_10606474 Ga0105248_106064742 248
102 3300010375 Ga0105239_10000381 Ga0105239_100003813 248
103 3300013105 Ga0157369_10026580 Ga0157369_100265802 248
104 3300025903 Ga0207680_10025115 Ga0207680_100251153 248
105 3300025913 Ga0207695_10000003 Ga0207695_10000003646 248
106 3300025920 Ga0207649_10068111 Ga0207649_100681112 248
107 3300025925 Ga0207650_10019928 Ga0207650_100199286 248
108 3300025949 Ga0207667_10000116 Ga0207667_10000116112 248
109 3300025960 Ga0207651_10009142 Ga0207651_100091424 248
110 3300025986 Ga0207658_10005177 Ga0207658_100051777 248
111 3300026023 Ga0207677_10032018 Ga0207677_100320183 248
112 3300026035 Ga0207703_10167083 Ga0207703_101670831 248
113 3300026095 Ga0207676_10077739 Ga0207676_100777393 248
114 3300045976 Ga0466967_0601827 Ga0466967_0601827_172_918 248
115 3300046476 Ga0495662_0157993 Ga0495662_0157993_312_1058 248
116 3300046543 Ga0495645_0232839 Ga0495645_0232839_312_1058 248
117 3300046689 Ga0495613_0151545 Ga0495613_0151545_114_860 248
118 3300049460 Ga0495682_0002300 Ga0495682_0002300_219_965 248
119 iso_pu_bacteria 2508501050 2508734889 248
120 iso_pu_bacteria 2508501114 2509078623 248
121 iso_pu_bacteria 2835312727 2835316580 248
122 3300005331 Ga0070670_100119509 Ga0070670_1001195091 249
123 3300005345 Ga0070692_10010952 Ga0070692_100109524 249
124 3300005354 Ga0070675_100005393 Ga0070675_1000053938 249
125 3300005354 Ga0070675_100012086 Ga0070675_1000120868 249
126 3300005455 Ga0070663_100165476 Ga0070663_1001654761 249
127 3300005458 Ga0070681_10236846 Ga0070681_102368462 249
128 3300005459 Ga0068867_100028049 Ga0068867_1000280494 249
129 3300005535 Ga0070684_100031806 Ga0070684_1000318065 249
130 3300005547 Ga0070693_100009090 Ga0070693_1000090904 249
131 3300005564 Ga0070664_100001374 Ga0070664_1000013747 249
132 3300006881 Ga0068865_100158104 Ga0068865_1001581042 249
133 3300009094 Ga0111539_10131605 Ga0111539_101316054 249
134 3300009098 Ga0105245_10030840 Ga0105245_100308404 249
135 3300009148 Ga0105243_10254838 Ga0105243_102548382 249
136 3300009551 Ga0105238_10262862 Ga0105238_102628621 249
137 3300014326 Ga0157380_10240834 Ga0157380_102408341 249
138 3300014745 Ga0157377_10113842 Ga0157377_101138422 249
139 3300025923 Ga0207681_10203432 Ga0207681_102034321 249
140 3300025924 Ga0207694_10217242 Ga0207694_102172422 249
141 3300025925 Ga0207650_10158501 Ga0207650_101585012 249
142 3300025945 Ga0207679_10220236 Ga0207679_102202362 249
143 3300026067 Ga0207678_10127480 Ga0207678_101274801 249
144 3300026075 Ga0207708_10002344 Ga0207708_100023442 249
145 3300026089 Ga0207648_10208742 Ga0207648_102087421 249
146 3300026118 Ga0207675_100173042 Ga0207675_1001730422 249
147 3300027907 Ga0207428_10205340 Ga0207428_102053401 249
148 3300028800 Ga0265338_10204634 Ga0265338_102046342 249
149 3300028800 Ga0265338_10347874 Ga0265338_103478741 249
150 3300031247 Ga0265340_10052677 Ga0265340_100526772 249
151 3300031711 Ga0265314_10179166 Ga0265314_101791662 249
152 3300035398 Ga0316574_0237752 Ga0316574_0237752_345_1094 249
153 3300042876 Ga0451577_0005641 Ga0451577_0005641_3828_4577 249
154 3300044712 Ga0453684_0000841 Ga0453684_0000841_45512_46261 249
155 3300045051 Ga0451576_0009034 Ga0451576_0009034_9743_10492 249
156 3300050511 nmdc:mga08y16_412674_c1 nmdc:mga08y16_412674_c1_555_1352 249
157 3300005338 Ga0068868_100031507 Ga0068868_1000315073 250
158 3300005340 Ga0070689_100087994 Ga0070689_1000879942 250
159 3300005343 Ga0070687_100254601 Ga0070687_1002546011 250
160 3300005355 Ga0070671_100025620 Ga0070671_1000256204 250
161 3300005367 Ga0070667_100020528 Ga0070667_1000205288 250
162 3300005436 Ga0070713_100274591 Ga0070713_1002745912 250
163 3300005467 Ga0070706_100000025 Ga0070706_100000025159 250
164 3300005614 Ga0068856_101011246 Ga0068856_1010112461 250
165 3300005615 Ga0070702_100023072 Ga0070702_1000230723 250
166 3300005617 Ga0068859_100062611 Ga0068859_1000626113 250
167 3300005719 Ga0068861_100032999 Ga0068861_1000329992 250
168 3300005719 Ga0068861_100134140 Ga0068861_1001341403 250
169 3300005834 Ga0068851_10130876 Ga0068851_101308762 250
170 3300005842 Ga0068858_100066124 Ga0068858_1000661244 250
171 3300005843 Ga0068860_100003039 Ga0068860_1000030397 250
172 3300005844 Ga0068862_100006717 Ga0068862_1000067179 250
173 3300005844 Ga0068862_100103917 Ga0068862_1001039173 250
174 3300006844 Ga0075428_100114014 Ga0075428_1001140142 250
175 3300006852 Ga0075433_10157192 Ga0075433_101571923 250
176 3300006881 Ga0068865_100059936 Ga0068865_1000599363 250
177 3300006931 Ga0097620_100062611 Ga0097620_1000626113 250
178 3300009093 Ga0105240_11021969 Ga0105240_110219691 250
179 3300009098 Ga0105245_10034531 Ga0105245_100345314 250
180 3300009147 Ga0114129_10004635 Ga0114129_100046352 250
181 3300009148 Ga0105243_10043004 Ga0105243_100430043 250
182 3300009545 Ga0105237_10203401 Ga0105237_102034012 250
183 3300010375 Ga0105239_10392876 Ga0105239_103928761 250
184 3300013104 Ga0157370_10583589 Ga0157370_105835891 250
185 3300013296 Ga0157374_10510951 Ga0157374_105109511 250
186 3300013306 Ga0163162_10496222 Ga0163162_104962221 250
187 3300025901 Ga0207688_10017375 Ga0207688_100173754 250
188 3300025903 Ga0207680_10207955 Ga0207680_102079552 250
189 3300025910 Ga0207684_10000072 Ga0207684_10000072195 250
190 3300025915 Ga0207693_10230832 Ga0207693_102308321 250
191 3300025916 Ga0207663_10042166 Ga0207663_100421661 250
192 3300025919 Ga0207657_10467470 Ga0207657_104674701 250
193 3300025928 Ga0207700_10202136 Ga0207700_102021362 250
194 3300025931 Ga0207644_10046231 Ga0207644_100462313 250
195 3300025934 Ga0207686_10304260 Ga0207686_103042602 250
196 3300025961 Ga0207712_10067783 Ga0207712_100677831 250
197 3300025986 Ga0207658_10017684 Ga0207658_100176843 250
198 3300026023 Ga0207677_10821044 Ga0207677_108210441 250
199 3300026118 Ga0207675_100039462 Ga0207675_1000394624 250
200 3300026118 Ga0207675_100164471 Ga0207675_1001644711 250
201 3300026142 Ga0207698_10043097 Ga0207698_100430973 250
202 3300028380 Ga0268265_10125346 Ga0268265_101253462 250
203 3300028381 Ga0268264_10133116 Ga0268264_101331162 250
204 3300035724 Ga0373933_0165837 Ga0373933_0165837_125_877 250
205 3300036401 Ga0373937_0016489 Ga0373937_0016489_4689_5441 250
206 3300039437 Ga0436365_0747596 Ga0436365_0747596_273_1028 250
207 3300046454 Ga0495592_0048388 Ga0495592_0048388_363_1115 250
208 3300046462 Ga0495651_0142604 Ga0495651_0142604_625_1377 250
209 3300046463 Ga0495653_0032468 Ga0495653_0032468_2247_2999 250
210 3300046511 Ga0495608_0003409 Ga0495608_0003409_7709_8461 250
211 3300046514 Ga0495618_0073679 Ga0495618_0073679_290_1042 250
212 3300046529 Ga0495652_0335743 Ga0495652_0335743_29_781 250
213 3300046533 Ga0495640_0034338 Ga0495640_0034338_314_1066 250
214 3300046536 Ga0495587_0136821 Ga0495587_0136821_491_1243 250
215 3300046543 Ga0495645_0124646 Ga0495645_0124646_792_1544 250
216 3300046559 Ga0495667_0003850 Ga0495667_0003850_830_1582 250
217 3300046642 Ga0495634_0107372 Ga0495634_0107372_694_1446 250
218 3300046663 Ga0495635_0008980 Ga0495635_0008980_4406_5158 250
219 3300046675 Ga0495657_0051737 Ga0495657_0051737_692_1444 250
220 3300046679 Ga0495623_0018544 Ga0495623_0018544_1547_2299 250
221 3300046680 Ga0495646_0003120 Ga0495646_0003120_6822_7574 250
222 3300046809 Ga0495600_0017593 Ga0495600_0017593_1138_1890 250
223 3300047317 Ga0495604_0006432 Ga0495604_0006432_6698_7450 250
224 3300047319 Ga0495674_0016831 Ga0495674_0016831_1768_2520 250
225 3300047322 Ga0495680_0046568 Ga0495680_0046568_1548_2300 250
226 3300047444 Ga0495675_0075778 Ga0495675_0075778_523_1275 250
227 3300048088 Ga0495602_0017602 Ga0495602_0017602_2059_2811 250
228 3300048905 Ga0496102_0224635 Ga0496102_0224635_1004_1756 250
229 3300048905 Ga0496102_0476808 Ga0496102_0476808_188_940 250
230 3300048909 Ga0496106_0056724 Ga0496106_0056724_985_1737 250
231 3300048910 Ga0496107_0317258 Ga0496107_0317258_286_1038 250
232 3300048913 Ga0496110_0185885 Ga0496110_0185885_991_1743 250
233 3300050507 nmdc:mga05p37_2781_c1 nmdc:mga05p37_2781_c1_12696_13448 250
234 3300050515 nmdc:mga0a205_9430_c1 nmdc:mga0a205_9430_c1_851_1603 250
235 3300053084 Ga0495595_0021701 Ga0495595_0021701_1138_1890 250
236 3300053085 Ga0495619_0022654 Ga0495619_0022654_3131_3883 250
237 iso_pu_bacteria 2643221558 2643814635 250
238 3300005458 Ga0070681_10060262 Ga0070681_100602622 251
239 3300005539 Ga0068853_100331286 Ga0068853_1003312862 251
240 3300006038 Ga0075365_10160986 Ga0075365_101609862 251
241 3300009545 Ga0105237_10025942 Ga0105237_100259424 251
242 3300025912 Ga0207707_10068222 Ga0207707_100682224 251
243 3300025914 Ga0207671_10051862 Ga0207671_100518622 251
244 3300026041 Ga0207639_10348603 Ga0207639_103486032 251
245 3300033180 Ga0307510_10158978 Ga0307510_101589782 251
246 3300035121 Ga0373960_0054170 Ga0373960_0054170_423_1181 251
247 3300035695 Ga0373927_0100431 Ga0373927_0100431_777_1535 251
248 3300035725 Ga0373947_0074796 Ga0373947_0074796_740_1498 251
249 3300037312 Ga0395899_0000044 Ga0395899_0000044_160148_160903 251
250 3300037418 Ga0395900_0000042 Ga0395900_0000042_154308_155063 251
251 3300037466 Ga0395898_0000080 Ga0395898_0000080_154308_155063 251
252 3300037471 Ga0395905_0000044 Ga0395905_0000044_87854_88609 251
253 3300037471 Ga0395905_0021169 Ga0395905_0021169_1284_2042 251
254 3300038443 Ga0395901_0000027 Ga0395901_0000027_87820_88575 251
255 3300042876 Ga0451577_0068778 Ga0451577_0068778_1599_2354 251
256 3300044712 Ga0453684_0154651 Ga0453684_0154651_965_1720 251
257 3300048928 Ga0496125_0183016 Ga0496125_0183016_127_882 251
258 3300049571 Ga0501034_0004787 Ga0501034_0004787_6994_7749 251
259 3300049571 Ga0501034_0381695 Ga0501034_0381695_513_1268 251
260 3300049579 Ga0501043_0231735 Ga0501043_0231735_22_777 251
261 3300049580 Ga0501046_0292903 Ga0501046_0292903_321_1076 251
262 3300049581 Ga0501047_0001576 Ga0501047_0001576_8434_9189 251
263 3300049583 Ga0501067_0009581 Ga0501067_0009581_1699_2454 251
264 3300049585 Ga0501069_0030501 Ga0501069_0030501_270_1025 251
265 3300049586 Ga0501070_0003737 Ga0501070_0003737_2199_2954 251
266 3300049589 Ga0501073_0000326 Ga0501073_0000326_13719_14474 251
267 3300049590 Ga0501074_0000161 Ga0501074_0000161_20635_21390 251
268 3300049592 Ga0501076_0124907 Ga0501076_0124907_149_904 251
269 3300049741 Ga0501079_0238740 Ga0501079_0238740_309_1064 251
270 3300049742 Ga0501080_0000713 Ga0501080_0000713_10699_11454 251
271 3300049744 Ga0501083_0000202 Ga0501083_0000202_25092_25847 251
272 3300049822 Ga0501035_0321027 Ga0501035_0321027_18_773 251
273 3300049823 Ga0501044_0062945 Ga0501044_0062945_120_875 251
274 3300050493 nmdc:mga0k408_191138_c1 nmdc:mga0k408_191138_c1_12_779 251
275 3300050510 nmdc:mga06r32_133970_c1 nmdc:mga06r32_133970_c1_108_863 251
276 3300054114 Ga0501084_0000771 Ga0501084_0000771_14900_15655 251
277 3300060353 Ga0501082_0000764 Ga0501082_0000764_17640_18395 251
278 3300005328 Ga0070676_10001919 Ga0070676_1000191911 252
279 3300005330 Ga0070690_100149786 Ga0070690_1001497861 252
280 3300005331 Ga0070670_100324426 Ga0070670_1003244261 252
281 3300005334 Ga0068869_100162242 Ga0068869_1001622422 252
282 3300005335 Ga0070666_10001480 Ga0070666_1000148011 252
283 3300005338 Ga0068868_100008656 Ga0068868_1000086564 252
284 3300005338 Ga0068868_100518586 Ga0068868_1005185861 252
285 3300005347 Ga0070668_100002148 Ga0070668_1000021486 252
286 3300005353 Ga0070669_100000902 Ga0070669_10000090222 252
287 3300005364 Ga0070673_100008859 Ga0070673_1000088593 252
288 3300005367 Ga0070667_100048426 Ga0070667_1000484264 252
289 3300005406 Ga0070703_10022795 Ga0070703_100227952 252
290 3300005434 Ga0070709_10043314 Ga0070709_100433142 252
291 3300005434 Ga0070709_10317924 Ga0070709_103179241 252
292 3300005435 Ga0070714_100000907 Ga0070714_1000009073 252
293 3300005436 Ga0070713_100024026 Ga0070713_1000240263 252
294 3300005439 Ga0070711_100136754 Ga0070711_1001367542 252
295 3300005445 Ga0070708_100348695 Ga0070708_1003486951 252
296 3300005456 Ga0070678_100011013 Ga0070678_1000110137 252
297 3300005457 Ga0070662_100418389 Ga0070662_1004183892 252
298 3300005459 Ga0068867_100001642 Ga0068867_10000164213 252
299 3300005468 Ga0070707_100148919 Ga0070707_1001489193 252
300 3300005543 Ga0070672_100001696 Ga0070672_1000016963 252
301 3300005548 Ga0070665_100001166 Ga0070665_10000116627 252
302 3300005548 Ga0070665_100016646 Ga0070665_1000166464 252
303 3300005616 Ga0068852_100190205 Ga0068852_1001902052 252
304 3300005617 Ga0068859_100002054 Ga0068859_1000020545 252
305 3300005618 Ga0068864_100002502 Ga0068864_1000025023 252
306 3300005719 Ga0068861_100141362 Ga0068861_1001413622 252
307 3300005841 Ga0068863_100002665 Ga0068863_1000026654 252
308 3300005841 Ga0068863_100206523 Ga0068863_1002065232 252
309 3300005842 Ga0068858_100004520 Ga0068858_10000452016 252
310 3300005842 Ga0068858_100130275 Ga0068858_1001302753 252
311 3300005985 Ga0081539_10050721 Ga0081539_100507213 252
312 3300006028 Ga0070717_10014990 Ga0070717_100149903 252
313 3300006163 Ga0070715_10026240 Ga0070715_100262401 252
314 3300006173 Ga0070716_100024008 Ga0070716_1000240084 252
315 3300006173 Ga0070716_100033397 Ga0070716_1000333973 252
316 3300006175 Ga0070712_100131016 Ga0070712_1001310163 252
317 3300006237 Ga0097621_100004867 Ga0097621_1000048675 252
318 3300006358 Ga0068871_100001733 Ga0068871_1000017334 252
319 3300006871 Ga0075434_100172235 Ga0075434_1001722352 252
320 3300006881 Ga0068865_100023973 Ga0068865_1000239735 252
321 3300006931 Ga0097620_100002054 Ga0097620_10000205417 252
322 3300007265 Ga0099794_10002241 Ga0099794_100022416 252
323 3300009093 Ga0105240_10541544 Ga0105240_105415442 252
324 3300009094 Ga0111539_10043773 Ga0111539_100437733 252
325 3300009098 Ga0105245_10153378 Ga0105245_101533782 252
326 3300009177 Ga0105248_10016212 Ga0105248_100162124 252
327 3300013104 Ga0157370_10487154 Ga0157370_104871541 252
328 3300013296 Ga0157374_10008322 Ga0157374_100083225 252
329 3300013296 Ga0157374_10052178 Ga0157374_100521782 252
330 3300013306 Ga0163162_10003019 Ga0163162_100030193 252
331 3300013306 Ga0163162_10487913 Ga0163162_104879132 252
332 3300014325 Ga0163163_10086457 Ga0163163_100864571 252
333 3300014326 Ga0157380_10125785 Ga0157380_101257853 252
334 3300014968 Ga0157379_10011216 Ga0157379_100112168 252
335 3300014969 Ga0157376_10067119 Ga0157376_100671193 252
336 3300014969 Ga0157376_10150566 Ga0157376_101505662 252
337 3300017792 Ga0163161_10112427 Ga0163161_101124272 252
338 3300025230 Ga0209563_102348 Ga0209563_1023482 252
339 3300025315 Ga0207697_10014150 Ga0207697_100141502 252
340 3300025885 Ga0207653_10000659 Ga0207653_100006599 252
341 3300025899 Ga0207642_10074147 Ga0207642_100741472 252
342 3300025903 Ga0207680_10307890 Ga0207680_103078902 252
343 3300025905 Ga0207685_10082804 Ga0207685_100828042 252
344 3300025907 Ga0207645_10000097 Ga0207645_1000009717 252
345 3300025907 Ga0207645_10150584 Ga0207645_101505841 252
346 3300025909 Ga0207705_10075394 Ga0207705_100753945 252
347 3300025910 Ga0207684_10000063 Ga0207684_1000006318 252
348 3300025915 Ga0207693_10002359 Ga0207693_100023593 252
349 3300025922 Ga0207646_10049414 Ga0207646_100494143 252
350 3300025923 Ga0207681_10051172 Ga0207681_100511724 252
351 3300025925 Ga0207650_10268741 Ga0207650_102687412 252
352 3300025926 Ga0207659_10008567 Ga0207659_100085675 252
353 3300025928 Ga0207700_10024546 Ga0207700_100245466 252
354 3300025928 Ga0207700_10410795 Ga0207700_104107951 252
355 3300025929 Ga0207664_10010932 Ga0207664_100109327 252
356 3300025929 Ga0207664_10486723 Ga0207664_104867231 252
357 3300025934 Ga0207686_10079823 Ga0207686_100798232 252
358 3300025938 Ga0207704_10141197 Ga0207704_101411972 252
359 3300025939 Ga0207665_10019453 Ga0207665_100194532 252
360 3300025939 Ga0207665_10387320 Ga0207665_103873202 252
361 3300025940 Ga0207691_10000327 Ga0207691_1000032719 252
362 3300025941 Ga0207711_10187408 Ga0207711_101874083 252
363 3300025941 Ga0207711_10283045 Ga0207711_102830452 252
364 3300025942 Ga0207689_10029346 Ga0207689_100293463 252
365 3300025960 Ga0207651_10021827 Ga0207651_100218272 252
366 3300025986 Ga0207658_10069409 Ga0207658_100694091 252
367 3300026023 Ga0207677_10013067 Ga0207677_100130673 252
368 3300026023 Ga0207677_10151307 Ga0207677_101513072 252
369 3300026023 Ga0207677_10453154 Ga0207677_104531541 252
370 3300026035 Ga0207703_10064763 Ga0207703_100647633 252
371 3300026035 Ga0207703_10106045 Ga0207703_101060452 252
372 3300026088 Ga0207641_10028361 Ga0207641_100283614 252
373 3300026089 Ga0207648_10000426 Ga0207648_1000042635 252
374 3300026089 Ga0207648_10427906 Ga0207648_104279063 252
375 3300026095 Ga0207676_10185073 Ga0207676_101850733 252
376 3300026121 Ga0207683_10000273 Ga0207683_1000027335 252
377 3300028379 Ga0268266_10012153 Ga0268266_100121533 252
378 3300028379 Ga0268266_10067043 Ga0268266_100670432 252
379 3300028380 Ga0268265_10234838 Ga0268265_102348383 252
380 3300028381 Ga0268264_10014938 Ga0268264_100149383 252
381 3300028381 Ga0268264_10621354 Ga0268264_106213542 252
382 3300029957 Ga0265324_10044109 Ga0265324_100441092 252
383 3300031240 Ga0265320_10014274 Ga0265320_100142742 252
384 3300031250 Ga0265331_10008083 Ga0265331_100080834 252
385 3300031344 Ga0265316_10000651 Ga0265316_1000065113 252
386 3300031889 Ga0326468_10006837 Ga0326468_100068371 252
387 3300037068 Ga0373925_0002903 Ga0373925_0002903_11902_12660 252
388 3300042007 Ga0439449_0139633 Ga0439449_0139633_92_865 252
389 3300044673 Ga0453683_0166429 Ga0453683_0166429_610_1374 252
390 3300045049 Ga0466959_0073112 Ga0466959_0073112_22_780 252
391 3300046522 Ga0495643_0010116 Ga0495643_0010116_2389_3147 252
392 3300046559 Ga0495667_0346798 Ga0495667_0346798_113_871 252
393 3300046665 Ga0495661_0003924 Ga0495661_0003924_7626_8384 252
394 3300046675 Ga0495657_0160164 Ga0495657_0160164_451_1209 252
395 3300047315 Ga0495581_0110059 Ga0495581_0110059_508_1266 252
396 3300047319 Ga0495674_0069119 Ga0495674_0069119_1976_2734 252
397 3300047319 Ga0495674_0224184 Ga0495674_0224184_723_1481 252
398 3300047443 Ga0495687_003696 Ga0495687_003696_3862_4620 252
399 3300048904 Ga0496101_0337810 Ga0496101_0337810_252_1010 252
400 3300048905 Ga0496102_0063941 Ga0496102_0063941_384_1142 252
401 3300048907 Ga0496104_0002404 Ga0496104_0002404_6077_6835 252
402 3300048907 Ga0496104_0077368 Ga0496104_0077368_1501_2262 252
403 3300048908 Ga0496105_0069959 Ga0496105_0069959_1048_1809 252
404 3300048909 Ga0496106_0631014 Ga0496106_0631014_64_822 252
405 3300048910 Ga0496107_0046856 Ga0496107_0046856_1720_2478 252
406 3300048912 Ga0496109_0064433 Ga0496109_0064433_1824_2597 252
407 3300048912 Ga0496109_0369309 Ga0496109_0369309_265_1023 252
408 3300048913 Ga0496110_0172679 Ga0496110_0172679_948_1706 252
409 3300048917 Ga0496114_0028963 Ga0496114_0028963_2504_3262 252
410 3300049568 Ga0501031_0025706 Ga0501031_0025706_208_981 252
411 3300049569 Ga0501032_0118802 Ga0501032_0118802_719_1480 252
412 3300049569 Ga0501032_0126839 Ga0501032_0126839_420_1187 252
413 3300049570 Ga0501033_0040650 Ga0501033_0040650_1152_1919 252
414 3300049571 Ga0501034_0124552 Ga0501034_0124552_1567_2334 252
415 3300049572 Ga0501036_0020555 Ga0501036_0020555_3322_4095 252
416 3300049573 Ga0501037_0158110 Ga0501037_0158110_308_1081 252
417 3300049573 Ga0501037_0206633 Ga0501037_0206633_182_949 252
418 3300049574 Ga0501038_0025422 Ga0501038_0025422_257_1024 252
419 3300049575 Ga0501039_0063133 Ga0501039_0063133_1792_2565 252
420 3300049575 Ga0501039_0309125 Ga0501039_0309125_26_793 252
421 3300049578 Ga0501042_0002188 Ga0501042_0002188_4438_5211 252
422 3300049579 Ga0501043_0125058 Ga0501043_0125058_1101_1868 252
423 3300049580 Ga0501046_0003878 Ga0501046_0003878_12502_13275 252
424 3300049580 Ga0501046_0119187 Ga0501046_0119187_61_828 252
425 3300049581 Ga0501047_0058228 Ga0501047_0058228_208_981 252
426 3300049581 Ga0501047_0060020 Ga0501047_0060020_2686_3453 252
427 3300049583 Ga0501067_0000855 Ga0501067_0000855_15231_16004 252
428 3300049584 Ga0501068_0002310 Ga0501068_0002310_7052_7825 252
429 3300049584 Ga0501068_0137907 Ga0501068_0137907_586_1353 252
430 3300049585 Ga0501069_0003760 Ga0501069_0003760_5881_6654 252
431 3300049588 Ga0501072_0014867 Ga0501072_0014867_4828_5601 252
432 3300049589 Ga0501073_0029505 Ga0501073_0029505_201_968 252
433 3300049589 Ga0501073_0037948 Ga0501073_0037948_2339_3112 252
434 3300049590 Ga0501074_0026688 Ga0501074_0026688_535_1308 252
435 3300049592 Ga0501076_0233132 Ga0501076_0233132_290_1063 252
436 3300049741 Ga0501079_0305589 Ga0501079_0305589_193_966 252
437 3300049742 Ga0501080_0022235 Ga0501080_0022235_3873_4640 252
438 3300049744 Ga0501083_0083188 Ga0501083_0083188_417_1190 252
439 3300049822 Ga0501035_0004618 Ga0501035_0004618_7508_8281 252
440 3300049822 Ga0501035_0010215 Ga0501035_0010215_339_1106 252
441 3300049823 Ga0501044_0239058 Ga0501044_0239058_541_1308 252
442 3300049824 Ga0501045_0012731 Ga0501045_0012731_2872_3645 252
443 3300050511 nmdc:mga08y16_157779_c1 nmdc:mga08y16_157779_c1_552_1310 252
444 3300050512 nmdc:mga0n895_212665_c1 nmdc:mga0n895_212665_c1_99_881 252
445 3300050515 nmdc:mga0a205_177819_c1 nmdc:mga0a205_177819_c1_151_933 252
446 3300053078 Ga0495612_0060723 Ga0495612_0060723_548_1306 252
447 3300053084 Ga0495595_0020746 Ga0495595_0020746_1983_2816 252
448 3300053085 Ga0495619_0025460 Ga0495619_0025460_2637_3395 252
449 3300054114 Ga0501084_0008592 Ga0501084_0008592_3043_3816 252
450 3300060353 Ga0501082_0160234 Ga0501082_0160234_980_1747 252
451 iso_pu_bacteria 2827628540 2827630834 252
452 iso_pu_bacteria 2842264693 2842265267 252
453 iso_pu_bacteria 2842428310 2842428680 252
454 iso_pu_bacteria 2842434925 2842435293 252
455 iso_pu_bacteria 2842441272 2842441844 252
456 iso_pu_bacteria 2842462802 2842463104 252
457 iso_pu_bacteria 2842469257 2842469624 252
458 iso_pu_bacteria 3002141150 3002141965 252

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

40

234

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

46

261

0.9

PF08659

KR

KR domain

41

219

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dyv-assembly1.cif.gz_A crystal structure of a short-chain dehydrogenase/reductase sdr from xanthobacter autotrophicus py2 0.9687 6 244
4dyv-assembly1.cif.gz_A crystal structure of a short-chain dehydrogenase/reductase sdr from xanthobacter autotrophicus py2 0.9598 6 244
4dry-assembly1.cif.gz_A the crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from rhizobium meliloti 0.9407 6 252
4dry-assembly1.cif.gz_D the crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from rhizobium meliloti 0.9403 6 252
4dry-assembly1.cif.gz_A the crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from rhizobium meliloti 0.9369 6 252
ID Description Score Start End Superfamily
4dyvA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9661 6 240 3.40.50.720
4dyvA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9478 6 240 3.40.50.720
2ehdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9408 6 241 3.40.50.720
4dryA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9357 6 252 3.40.50.720
af_P9WGS3_322_571_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9342 6 196 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A5C7QR01-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9897 6 145
AF-A0A382N0H9-F1-model_v4 3-oxoacyl-ACP reductase 0.9777 1 223 GO:0016491
AF-A0A520G145-F1-model_v4 SDR family oxidoreductase 0.9723 2 224 GO:0016491
AF-A0A3C0Y7A3-F1-model_v4 3-oxoacyl-ACP reductase 0.9719 80 232 GO:0016491
AF-A0A536XAS5-F1-model_v4 SDR family oxidoreductase 0.967 1 252 GO:0016491

Feature Viewer

pLDDT pTM Quality
93.35 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map