F448182

General Info

Members Datasets Scaffolds Average Seq Length
458 195 916 352

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10049596|Ga0105248_100495961
Length 388
Sequence VSRRAYLDWLRGVAVLIMVEAHLFDAWVRVSDRSDHPYRWAIAIGGYSAPLFLFLAGVALALAIGSRQRRGLTVSEAAAIARRRGWQILGLGVLFRLQSFIVSGGPFPQTLLKVDILNVMGLSMVLAAVLWRTAAKDLWRGVALSLGALFFVLATPLIRQVTAVASLPYPIQWYFKAVPGSGAFTLFPWVGFLLCGVVIGLWLDRARSDGEERTALKALAITGPLIAVGGYLSTYLPMFYTGTTFWTGSPTFFFVRLGVLITSIPIGYLWNAFFRGWSPIRDFGVASLFVYWIHVEMVYGIASFWLHKALTFEQAVVSYVAFSLFLFGLVKLKDRSSRTPLRHIPRLSRPRLVPERVRPCPRTRAQAFDKNRVGGQRAESTKNSFNFK

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
147 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
148 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
151 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
152 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
153 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
154 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
155 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
156 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
157 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
158 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
159 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
160 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
161 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
162 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
163 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
164 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
179 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
180 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
181 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
188 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
189 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
190 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
191 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
192 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
193 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
194 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
195 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.44
Nodule 0
Rhizoplane 3.93
Rhizosphere 95.63
Stem 0
Stem Tuber 0
Unclassified 20.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10049596 3300009177 Bacteria 4709
2 JGI24746J21847_1003011 3300001977 Bacteria 2651
3 JGI24750J21931_1003076 3300002070 Bacteria 2003
4 JGI24034J26672_10008439 3300002239 Bacteria 1506
5 JGI25406J46586_10020427 3300003203 Bacteria 2679
6 Ga0065704_10080927 3300005289 Unclassified 3853
7 Ga0065712_10000215 3300005290 Bacteria 22266
8 Ga0065712_10013944 3300005290 Unclassified 2597
9 Ga0065715_10002841 3300005293 Bacteria 10003
10 Ga0065715_10003389 3300005293 Bacteria 5312
11 Ga0065715_10097691 3300005293 Unclassified 3666
12 Ga0065715_10124179 3300005293 Bacteria 2160
13 Ga0065707_10001243 3300005295 Bacteria 9166
14 Ga0070676_10000598 3300005328 Bacteria 17526
15 Ga0070683_100019927 3300005329 Bacteria 5963
16 Ga0070690_100001342 3300005330 Bacteria 12783
17 Ga0070690_100068769 3300005330 Bacteria 2297
18 Ga0070690_100109763 3300005330 Unclassified 1839
19 Ga0070670_100001524 3300005331 Bacteria 18652
20 Ga0070670_100002231 3300005331 Bacteria 15925
21 Ga0070670_100011254 3300005331 Bacteria 7648
22 Ga0070670_100042365 3300005331 Bacteria 3913
23 Ga0070670_100124249 3300005331 Bacteria 2227
24 Ga0070677_10000337 3300005333 Bacteria 16445
25 Ga0070677_10008460 3300005333 Unclassified 3463
26 Ga0070677_10079727 3300005333 Unclassified 1398
27 Ga0068869_100013142 3300005334 Bacteria 5498
28 Ga0068869_100017867 3300005334 Bacteria 4818
29 Ga0070666_10005505 3300005335 Bacteria 7767
30 Ga0068868_100003165 3300005338 Bacteria 11455
31 Ga0070689_100006284 3300005340 Bacteria 8202
32 Ga0070689_100067957 3300005340 Bacteria 2779
33 Ga0070689_100082830 3300005340 Bacteria 2521
34 Ga0070689_100141650 3300005340 Unclassified 1934
35 Ga0070689_100164320 3300005340 Unclassified 1796
36 Ga0070687_100008529 3300005343 Bacteria 4349
37 Ga0070687_100043871 3300005343 Bacteria 2275
38 Ga0070661_100020808 3300005344 Bacteria 4681
39 Ga0070692_10038991 3300005345 Bacteria 2424
40 Ga0070669_100027884 3300005353 Bacteria 4065
41 Ga0070669_100107698 3300005353 Unclassified 2111
42 Ga0070675_100001781 3300005354 Bacteria 15890
43 Ga0070675_100003217 3300005354 Bacteria 12375
44 Ga0070675_100012580 3300005354 Bacteria 6634
45 Ga0070675_100030169 3300005354 Unclassified 4376
46 Ga0070675_100126873 3300005354 Bacteria 2171
47 Ga0070675_100154136 3300005354 Bacteria 1972
48 Ga0070675_100266072 3300005354 Bacteria 1503
49 Ga0070671_100022382 3300005355 Bacteria 5161
50 Ga0070671_100152896 3300005355 Bacteria 1949
51 Ga0070671_100170934 3300005355 Bacteria 1838
52 Ga0070674_100001502 3300005356 Bacteria 12433
53 Ga0070674_100026700 3300005356 Bacteria 3775
54 Ga0070673_100007350 3300005364 Bacteria 7256
55 Ga0070673_100067268 3300005364 Bacteria 2865
56 Ga0070673_100067488 3300005364 Bacteria 2860
57 Ga0070673_100121407 3300005364 Unclassified 2180
58 Ga0070673_100320163 3300005364 Bacteria 1370
59 Ga0070688_100004377 3300005365 Bacteria 7348
60 Ga0070688_100010032 3300005365 Bacteria 5204
61 Ga0070688_100017502 3300005365 Bacteria 4114
62 Ga0070688_100047724 3300005365 Bacteria 2658
63 Ga0070688_100112515 3300005365 Unclassified 1813
64 Ga0070667_100008350 3300005367 Bacteria 8583
65 Ga0070667_100226178 3300005367 Unclassified 1667
66 Ga0070705_100000092 3300005440 Bacteria 50020
67 Ga0070705_100013854 3300005440 Bacteria 4133
68 Ga0070705_100129171 3300005440 Unclassified 1645
69 Ga0070700_100021964 3300005441 Bacteria 3715
70 Ga0070700_100104131 3300005441 Unclassified 1875
71 Ga0070694_100023579 3300005444 Bacteria 3960
72 Ga0070694_100034492 3300005444 Bacteria 3338
73 Ga0070694_100077783 3300005444 Bacteria 2299
74 Ga0070694_100080454 3300005444 Bacteria 2264
75 Ga0070694_100097270 3300005444 Bacteria 2076
76 Ga0070678_100025468 3300005456 Unclassified 3980
77 Ga0070678_100029621 3300005456 Unclassified 3751
78 Ga0070678_100085266 3300005456 Bacteria 2406
79 Ga0070662_100024531 3300005457 Bacteria 4156
80 Ga0070662_100076774 3300005457 Bacteria 2477
81 Ga0070681_10001922 3300005458 Bacteria 18745
82 Ga0068867_100006595 3300005459 Bacteria 8203
83 Ga0068867_100010868 3300005459 Bacteria 6421
84 Ga0070685_10005994 3300005466 Bacteria 6192
85 Ga0070685_10026237 3300005466 Unclassified 3210
86 Ga0070685_10124557 3300005466 Unclassified 1604
87 Ga0070706_100028334 3300005467 Bacteria 5157
88 Ga0070706_100074102 3300005467 Bacteria 3152
89 Ga0070698_100002447 3300005471 Bacteria 20474
90 Ga0070698_100013673 3300005471 Bacteria 8593
91 Ga0070698_100134094 3300005471 Bacteria 2431
92 Ga0070699_100003641 3300005518 Bacteria 13637
93 Ga0070699_100005915 3300005518 Bacteria 10688
94 Ga0070699_100051101 3300005518 Bacteria 3579
95 Ga0070699_100097729 3300005518 Unclassified 2572
96 Ga0070679_100070093 3300005530 Bacteria 3498
97 Ga0070684_100112334 3300005535 Unclassified 2444
98 Ga0070697_100032880 3300005536 Bacteria 4176
99 Ga0070697_100166594 3300005536 Bacteria 1863
100 Ga0070672_100003669 3300005543 Bacteria 9973
101 Ga0070672_100057855 3300005543 Bacteria 3045
102 Ga0070672_100091183 3300005543 Unclassified 2459
103 Ga0070672_100226078 3300005543 Bacteria 1571
104 Ga0070686_100008016 3300005544 Bacteria 5903
105 Ga0070686_100014421 3300005544 Bacteria 4557
106 Ga0070686_100137469 3300005544 Unclassified 1697
107 Ga0070695_100000002 3300005545 Bacteria 128335
108 Ga0070695_100094447 3300005545 Bacteria 2003
109 Ga0070696_100000679 3300005546 Bacteria 21808
110 Ga0070696_100027288 3300005546 Bacteria 3889
111 Ga0070696_100061147 3300005546 Bacteria 2634
112 Ga0070665_100006818 3300005548 Bacteria 11616
113 Ga0070665_100157127 3300005548 Bacteria 2276
114 Ga0070704_100000924 3300005549 Bacteria 14800
115 Ga0070704_100012991 3300005549 Bacteria 5153
116 Ga0070704_100045273 3300005549 Unclassified 3061
117 Ga0070704_100054952 3300005549 Unclassified 2820
118 Ga0070664_100003208 3300005564 Bacteria 13215
119 Ga0070664_100024399 3300005564 Bacteria 5001
120 Ga0070664_100074443 3300005564 Bacteria 2915
121 Ga0068857_100030011 3300005577 Bacteria 4797
122 Ga0068857_100138109 3300005577 Bacteria 2202
123 Ga0068852_100007293 3300005616 Bacteria 8062
124 Ga0068852_100051966 3300005616 Bacteria 3520
125 Ga0068859_100009883 3300005617 Bacteria 9635
126 Ga0068859_100143233 3300005617 Bacteria 2463
127 Ga0068859_100320975 3300005617 Bacteria 1643
128 Ga0068859_100354251 3300005617 Bacteria 1563
129 Ga0068864_100042097 3300005618 Unclassified 3908
130 Ga0068864_100062268 3300005618 Unclassified 3233
131 Ga0068866_10128080 3300005718 Unclassified 1440
132 Ga0068861_100012605 3300005719 Bacteria 5898
133 Ga0068861_100309873 3300005719 Bacteria 1371
134 Ga0068851_10022966 3300005834 Bacteria 3045
135 Ga0068870_10001767 3300005840 Bacteria 8867
136 Ga0068870_10007801 3300005840 Bacteria 4787
137 Ga0068870_10039240 3300005840 Bacteria 2449
138 Ga0068870_10040510 3300005840 Unclassified 2416
139 Ga0068870_10070519 3300005840 Bacteria 1905
140 Ga0068863_100001713 3300005841 Bacteria 21711
141 Ga0068863_100019777 3300005841 Bacteria 6440
142 Ga0068863_100092653 3300005841 Bacteria 2867
143 Ga0068863_100111946 3300005841 Bacteria 2600
144 Ga0068858_100031047 3300005842 Unclassified 4961
145 Ga0068860_100002981 3300005843 Bacteria 17491
146 Ga0068860_100006331 3300005843 Bacteria 11886
147 Ga0068860_100126857 3300005843 Unclassified 2446
148 Ga0068862_100000748 3300005844 Bacteria 32573
149 Ga0068862_100002984 3300005844 Bacteria 14771
150 Ga0068862_100215339 3300005844 Bacteria 1737
151 Ga0081539_10000012 3300005985 Bacteria 440369
152 Ga0081539_10000211 3300005985 Bacteria 136221
153 Ga0081539_10001641 3300005985 Bacteria 36374
154 Ga0081539_10085685 3300005985 Bacteria 1642
155 Ga0075366_10003884 3300006195 Bacteria 7967
156 Ga0097621_100037813 3300006237 Unclassified 3870
157 Ga0097621_100039347 3300006237 Unclassified 3797
158 Ga0068871_100036670 3300006358 Bacteria 3905
159 Ga0068871_100083289 3300006358 Bacteria 2653
160 Ga0068871_100089896 3300006358 Bacteria 2557
161 Ga0068871_100171806 3300006358 Bacteria 1858
162 Ga0075428_100001571 3300006844 Bacteria 24485
163 Ga0075428_100011251 3300006844 Bacteria 9957
164 Ga0075428_100052011 3300006844 Bacteria 4492
165 Ga0075428_100211436 3300006844 Bacteria 2096
166 Ga0075428_100412591 3300006844 Bacteria 1447
167 Ga0075430_100002598 3300006846 Bacteria 15073
168 Ga0075430_100056136 3300006846 Bacteria 3311
169 Ga0075430_100075781 3300006846 Bacteria 2820
170 Ga0075430_100197683 3300006846 Bacteria 1670
171 Ga0075431_100000025 3300006847 Bacteria 79014
172 Ga0075431_100069013 3300006847 Unclassified 3647
173 Ga0075431_100138476 3300006847 Unclassified 2509
174 Ga0075431_100202105 3300006847 Bacteria 2033
175 Ga0075433_10006953 3300006852 Bacteria 8966
176 Ga0075433_10027012 3300006852 Bacteria 4866
177 Ga0075433_10068947 3300006852 Unclassified 3105
178 Ga0075433_10099371 3300006852 Bacteria 2576
179 Ga0075434_100001488 3300006871 Bacteria 19749
180 Ga0075434_100001685 3300006871 Bacteria 18885
181 Ga0075434_100038439 3300006871 Bacteria 4740
182 Ga0075434_100054761 3300006871 Unclassified 3963
183 Ga0075434_100070394 3300006871 Unclassified 3489
184 Ga0075434_100138346 3300006871 Unclassified 2455
185 Ga0075429_100000919 3300006880 Bacteria 23334
186 Ga0075429_100019271 3300006880 Bacteria 5909
187 Ga0068865_100028412 3300006881 Bacteria 3702
188 Ga0068865_100086452 3300006881 Bacteria 2264
189 Ga0068865_100152478 3300006881 Unclassified 1755
190 Ga0068865_100168831 3300006881 Bacteria 1675
191 Ga0097620_100009883 3300006931 Bacteria 9635
192 Ga0097620_100143228 3300006931 Bacteria 2463
193 Ga0097620_100320993 3300006931 Bacteria 1643
194 Ga0097620_100354249 3300006931 Bacteria 1563
195 Ga0075435_100000749 3300007076 Bacteria 20129
196 Ga0075435_100029955 3300007076 Bacteria 4276
197 Ga0075435_100163893 3300007076 Bacteria 1874
198 Ga0075435_100322383 3300007076 Bacteria 1322
199 Ga0111539_10000778 3300009094 Bacteria 41485
200 Ga0111539_10011302 3300009094 Bacteria 11215
201 Ga0111539_10013953 3300009094 Bacteria 10043
202 Ga0111539_10024835 3300009094 Bacteria 7349
203 Ga0111539_10390567 3300009094 Bacteria 1620
204 Ga0105245_10038123 3300009098 Bacteria 4275
205 Ga0114129_10002377 3300009147 Bacteria 26132
206 Ga0114129_10003696 3300009147 Bacteria 21547
207 Ga0114129_10005733 3300009147 Bacteria 17597
208 Ga0114129_10013409 3300009147 Bacteria 11680
209 Ga0114129_10030711 3300009147 Bacteria 7599
210 Ga0114129_10170463 3300009147 Bacteria 2968
211 Ga0114129_10291941 3300009147 Bacteria 2176
212 Ga0114129_10637808 3300009147 Bacteria 1376
213 Ga0114129_10701149 3300009147 Bacteria 1301
214 Ga0105243_10046908 3300009148 Bacteria 3400
215 Ga0105243_10139027 3300009148 Bacteria 2070
216 Ga0105241_10117789 3300009174 Bacteria 2135
217 Ga0105242_10235278 3300009176 Unclassified 1644
218 Ga0105248_10277782 3300009177 Bacteria 1886
219 Ga0105248_10429409 3300009177 Bacteria 1488
220 Ga0105238_10011856 3300009551 Bacteria 8779
221 Ga0105249_10009534 3300009553 Bacteria 8508
222 Ga0105249_10044106 3300009553 Bacteria 4056
223 Ga0105249_10091279 3300009553 Unclassified 2850
224 Ga0105246_10017998 3300011119 Bacteria 4500
225 Ga0157374_10237385 3300013296 Bacteria 1792
226 Ga0157374_10346040 3300013296 Bacteria 1476
227 Ga0157378_10266985 3300013297 Bacteria 1644
228 Ga0163162_10031164 3300013306 Bacteria 5288
229 Ga0163162_10102943 3300013306 Bacteria 2949
230 Ga0157375_10033165 3300013308 Bacteria 4904
231 Ga0157375_10222357 3300013308 Bacteria 2046
232 Ga0157375_10375348 3300013308 Unclassified 1589
233 Ga0163163_10033405 3300014325 Bacteria 4976
234 Ga0163163_10037720 3300014325 Bacteria 4703
235 Ga0163163_10185917 3300014325 Bacteria 2126
236 Ga0163163_10424442 3300014325 Unclassified 1389
237 Ga0157380_10026601 3300014326 Unclassified 4393
238 Ga0157380_10052466 3300014326 Bacteria 3229
239 Ga0157380_10056363 3300014326 Bacteria 3125
240 Ga0157380_10223177 3300014326 Bacteria 1687
241 Ga0157380_10259993 3300014326 Unclassified 1576
242 Ga0157377_10027492 3300014745 Unclassified 3055
243 Ga0157377_10049327 3300014745 Unclassified 2366
244 Ga0157379_10005616 3300014968 Bacteria 10779
245 Ga0163161_10003762 3300017792 Bacteria 10627
246 Ga0163161_10007596 3300017792 Bacteria 7499
247 Ga0207697_10000023 3300025315 Bacteria 54675
248 Ga0207697_10000030 3300025315 Bacteria 51253
249 Ga0207656_10060261 3300025321 Bacteria 1663
250 Ga0207682_10000114 3300025893 Bacteria 37193
251 Ga0207682_10007758 3300025893 Unclassified 4264
252 Ga0207688_10000023 3300025901 Bacteria 49264
253 Ga0207688_10010867 3300025901 Bacteria 4954
254 Ga0207680_10182678 3300025903 Bacteria 1419
255 Ga0207645_10000933 3300025907 Bacteria 24243
256 Ga0207645_10010512 3300025907 Bacteria 6356
257 Ga0207645_10073697 3300025907 Unclassified 2186
258 Ga0207643_10000802 3300025908 Bacteria 19135
259 Ga0207643_10004638 3300025908 Bacteria 7383
260 Ga0207643_10010346 3300025908 Bacteria 5023
261 Ga0207643_10055775 3300025908 Unclassified 2247
262 Ga0207643_10167733 3300025908 Unclassified 1323
263 Ga0207707_10162051 3300025912 Bacteria 1955
264 Ga0207662_10001403 3300025918 Bacteria 11658
265 Ga0207662_10008680 3300025918 Bacteria 5573
266 Ga0207662_10081221 3300025918 Unclassified 1978
267 Ga0207662_10085780 3300025918 Unclassified 1928
268 Ga0207649_10109357 3300025920 Bacteria 1844
269 Ga0207646_10366156 3300025922 Unclassified 1302
270 Ga0207681_10012884 3300025923 Bacteria 5170
271 Ga0207681_10019727 3300025923 Bacteria 4265
272 Ga0207681_10026591 3300025923 Unclassified 3734
273 Ga0207681_10106842 3300025923 Bacteria 2029
274 Ga0207694_10023542 3300025924 Bacteria 4675
275 Ga0207650_10005151 3300025925 Bacteria 8920
276 Ga0207650_10030480 3300025925 Bacteria 3886
277 Ga0207650_10064198 3300025925 Bacteria 2748
278 Ga0207650_10139589 3300025925 Bacteria 1904
279 Ga0207659_10001400 3300025926 Bacteria 14361
280 Ga0207659_10010386 3300025926 Bacteria 5852
281 Ga0207659_10021370 3300025926 Bacteria 4294
282 Ga0207659_10026503 3300025926 Bacteria 3912
283 Ga0207659_10056738 3300025926 Bacteria 2806
284 Ga0207659_10216671 3300025926 Bacteria 1537
285 Ga0207644_10069572 3300025931 Bacteria 2570
286 Ga0207690_10055852 3300025932 Bacteria 2661
287 Ga0207690_10075228 3300025932 Bacteria 2341
288 Ga0207706_10001458 3300025933 Bacteria 23647
289 Ga0207706_10054945 3300025933 Unclassified 3513
290 Ga0207670_10008520 3300025936 Bacteria 5794
291 Ga0207670_10027103 3300025936 Unclassified 3619
292 Ga0207670_10115785 3300025936 Unclassified 1940
293 Ga0207669_10008201 3300025937 Unclassified 4893
294 Ga0207704_10012611 3300025938 Bacteria 4198
295 Ga0207704_10028494 3300025938 Bacteria 3099
296 Ga0207704_10111293 3300025938 Unclassified 1852
297 Ga0207691_10000739 3300025940 Bacteria 32250
298 Ga0207691_10001178 3300025940 Bacteria 25991
299 Ga0207691_10006173 3300025940 Bacteria 11583
300 Ga0207691_10049793 3300025940 Unclassified 3838
301 Ga0207691_10238960 3300025940 Bacteria 1571
302 Ga0207711_10125653 3300025941 Bacteria 2294
303 Ga0207689_10017770 3300025942 Bacteria 6009
304 Ga0207689_10116227 3300025942 Bacteria 2199
305 Ga0207661_10018515 3300025944 Bacteria 5175
306 Ga0207661_10349547 3300025944 Unclassified 1334
307 Ga0207679_10027232 3300025945 Unclassified 3952
308 Ga0207679_10088234 3300025945 Bacteria 2391
309 Ga0207679_10158539 3300025945 Bacteria 1850
310 Ga0207651_10003819 3300025960 Bacteria 7466
311 Ga0207651_10064016 3300025960 Bacteria 2571
312 Ga0207651_10088068 3300025960 Unclassified 2262
313 Ga0207651_10109686 3300025960 Bacteria 2068
314 Ga0207712_10003637 3300025961 Bacteria 9721
315 Ga0207712_10015122 3300025961 Bacteria 4973
316 Ga0207658_10098793 3300025986 Bacteria 2282
317 Ga0207703_10152294 3300026035 Unclassified 2018
318 Ga0207708_10003405 3300026075 Bacteria 11718
319 Ga0207708_10014530 3300026075 Bacteria 5893
320 Ga0207708_10057273 3300026075 Unclassified 2973
321 Ga0207708_10247713 3300026075 Bacteria 1435
322 Ga0207641_10013736 3300026088 Bacteria 6643
323 Ga0207641_10069496 3300026088 Unclassified 3024
324 Ga0207648_10000409 3300026089 Bacteria 47845
325 Ga0207648_10018739 3300026089 Bacteria 6259
326 Ga0207676_10015510 3300026095 Bacteria 5498
327 Ga0207676_10025931 3300026095 Bacteria 4353
328 Ga0207674_10027118 3300026116 Bacteria 6068
329 Ga0207674_10069972 3300026116 Bacteria 3528
330 Ga0207674_10154836 3300026116 Bacteria 2247
331 Ga0207675_100008895 3300026118 Bacteria 9422
332 Ga0207675_100015819 3300026118 Bacteria 7036
333 Ga0207675_100106342 3300026118 Bacteria 2645
334 Ga0207675_100235194 3300026118 Bacteria 1769
335 Ga0207675_100309173 3300026118 Bacteria 1541
336 Ga0207683_10019745 3300026121 Bacteria 5757
337 Ga0207683_10039743 3300026121 Unclassified 4105
338 Ga0207683_10149278 3300026121 Unclassified 2109
339 Ga0209974_10045872 3300027876 Bacteria 1460
340 Ga0207428_10000330 3300027907 Bacteria 61384
341 Ga0207428_10000885 3300027907 Bacteria 33608
342 Ga0207428_10043174 3300027907 Bacteria 3643
343 Ga0268266_10072641 3300028379 Bacteria 2984
344 Ga0268266_10236208 3300028379 Bacteria 1685
345 Ga0268265_10000725 3300028380 Bacteria 32189
346 Ga0268265_10009376 3300028380 Bacteria 6615
347 Ga0268264_10012654 3300028381 Bacteria 6946
348 Ga0268264_10044178 3300028381 Bacteria 3696
349 Ga0268264_10124171 3300028381 Unclassified 2279
350 Ga0307405_10016224 3300031731 Bacteria 4055
351 Ga0307413_10024518 3300031824 Bacteria 3290
352 Ga0307410_10224994 3300031852 Bacteria 1445
353 Ga0307406_10013871 3300031901 Bacteria 4626
354 Ga0307407_10008673 3300031903 Bacteria 4681
355 Ga0307407_10176717 3300031903 Bacteria 1411
356 Ga0307412_10004040 3300031911 Bacteria 8177
357 Ga0307409_100006799 3300031995 Bacteria 6767
358 Ga0307409_100035856 3300031995 Unclassified 3638
359 Ga0307409_100087214 3300031995 Unclassified 2543
360 Ga0307416_100295947 3300032002 Bacteria 1605
361 Ga0307414_10014357 3300032004 Bacteria 4748
362 Ga0307411_10049548 3300032005 Bacteria 2730
363 Ga0307415_100015466 3300032126 Bacteria 4519
364 Ga0373931_0029035 3300035691 Bacteria 2836
365 Ga0439453_0014240 3300041408 Unclassified 1361
366 Ga0439435_0004139 3300042436 Unclassified 3099
367 Ga0439435_0005543 3300042436 Bacteria 2781
368 Ga0439435_0037733 3300042436 Bacteria 1340
369 Ga0451576_0007759 3300045051 Bacteria 12734
370 Ga0451576_0081155 3300045051 Bacteria 3373
371 Ga0451576_0315587 3300045051 Bacteria 1635
372 Ga0495603_0009158 3300046455 Bacteria 5982
373 Ga0495629_0001607 3300046459 Bacteria 17758
374 Ga0495584_0067172 3300046491 Unclassified 1803
375 Ga0495594_0011148 3300046499 Bacteria 4666
376 Ga0495663_0011807 3300046525 Bacteria 2433
377 Ga0495598_0015810 3300046537 Unclassified 1913
378 Ga0495621_0007848 3300046539 Bacteria 3173
379 Ga0495621_0027273 3300046539 Bacteria 1933
380 Ga0495633_0050763 3300046558 Unclassified 1955
381 Ga0495656_0022193 3300046615 Bacteria 2483
382 Ga0495635_0183054 3300046663 Bacteria 1424
383 Ga0495659_0012577 3300046664 Unclassified 2744
384 Ga0495659_0049297 3300046664 Unclassified 1529
385 Ga0495659_0071359 3300046664 Bacteria 1301
386 Ga0495588_0180250 3300046674 Bacteria 1116
387 Ga0495658_0066830 3300046683 Unclassified 2078
388 Ga0495658_0100601 3300046683 Bacteria 1725
389 Ga0495670_0047354 3300046691 Unclassified 2149
390 Ga0495685_072405 3300047447 Bacteria 1153
391 Ga0496101_0007832 3300048904 Bacteria 6948
392 Ga0496104_0021355 3300048907 Bacteria 5944
393 Ga0496104_0064693 3300048907 Unclassified 3469
394 Ga0496106_0223124 3300048909 Unclassified 1503
395 Ga0496108_0034566 3300048911 Unclassified 4200
396 Ga0496108_0093568 3300048911 Bacteria 2557
397 Ga0496109_0001812 3300048912 Bacteria 17780
398 Ga0496109_0037645 3300048912 Unclassified 4371
399 Ga0496109_0061862 3300048912 Bacteria 3424
400 Ga0496110_0057920 3300048913 Bacteria 3412
401 Ga0496110_0100668 3300048913 Bacteria 2590
402 Ga0496110_0160977 3300048913 Bacteria 2035
403 Ga0496112_0003609 3300048915 Bacteria 12880
404 Ga0496113_0008241 3300048916 Bacteria 6775
405 Ga0496113_0033753 3300048916 Unclassified 3729
406 Ga0496114_0001659 3300048917 Bacteria 16880
407 Ga0496114_0019103 3300048917 Bacteria 5553
408 Ga0496115_0097107 3300048918 Bacteria 2413
409 Ga0501040_0106481 3300049576 Bacteria 1959
410 Ga0501041_0124266 3300049577 Bacteria 1605
411 Ga0501048_0040313 3300049582 Bacteria 3348
412 Ga0501071_0020608 3300049587 Bacteria 4584
413 Ga0501071_0084170 3300049587 Bacteria 2331
414 Ga0501072_0005490 3300049588 Bacteria 9653
415 Ga0501072_0034912 3300049588 Unclassified 3941
416 Ga0501081_0326213 3300049743 Bacteria 1129
417 nmdc:mga0k408_36905_c1 3300050493 Bacteria 2805
418 nmdc:mga05p37_117172_c1 3300050507 Bacteria 3273
419 nmdc:mga05p37_11976_c1 3300050507 Bacteria 10348
420 nmdc:mga05p37_19976_c1 3300050507 Bacteria 8105
421 nmdc:mga05p37_237048_c1 3300050507 Bacteria 2195
422 nmdc:mga05p37_292537_c1 3300050507 Bacteria 1938
423 nmdc:mga05p37_37923_c1 3300050507 Bacteria 5911
424 nmdc:mga05p37_7492_c1 3300050507 Bacteria 12866
425 nmdc:mga05p37_800_c1 3300050507 Bacteria 35071
426 nmdc:mga09592_1650_c2 3300050508 Bacteria 9810
427 nmdc:mga09592_568368_c1 3300050508 Bacteria 973
428 nmdc:mga09592_6671_c1 3300050508 Bacteria 9401
429 nmdc:mga0qj67_1714_c1 3300050509 Bacteria 15457
430 nmdc:mga0qj67_55619_c1 3300050509 Bacteria 3135
431 nmdc:mga0qj67_60846_c1 3300050509 Bacteria 2997
432 nmdc:mga06r32_127920_c1 3300050510 Bacteria 2510
433 nmdc:mga06r32_2253_c1 3300050510 Bacteria 17260
434 nmdc:mga06r32_58227_c1 3300050510 Bacteria 3040
435 nmdc:mga06r32_62956_c1 3300050510 Unclassified 3574
436 nmdc:mga08y16_1943_c1 3300050511 Bacteria 21101
437 nmdc:mga08y16_417751_c1 3300050511 Unclassified 1371
438 nmdc:mga0n895_103243_c1 3300050512 Bacteria 2862
439 nmdc:mga0n895_13022_c1 3300050512 Bacteria 7482
440 nmdc:mga0n895_401_c1 3300050512 Bacteria 29147
441 nmdc:mga0n895_64860_c1 3300050512 Bacteria 3614
442 nmdc:mga0n895_67102_c1 3300050512 Unclassified 3552
443 nmdc:mga0n895_80029_c1 3300050512 Unclassified 3255
444 nmdc:mga0n895_98922_c1 3300050512 Bacteria 2925
445 nmdc:mga0rr50_24331_c1 3300050513 Bacteria 4193
446 nmdc:mga0rr50_63790_c1 3300050513 Bacteria 2783
447 nmdc:mga0a205_1284_c1 3300050515 Bacteria 21158
448 nmdc:mga0a205_15831_c1 3300050515 Bacteria 7053
449 nmdc:mga0a205_16322_c1 3300050515 Bacteria 6953
450 nmdc:mga0a205_287616_c1 3300050515 Bacteria 1519
451 nmdc:mga0a205_3098_c1 3300050515 Bacteria 14745
452 Ga0495595_0027266 3300053084 Bacteria 2544
453 Ga0495619_0014674 3300053085 Bacteria 4949
454 Ga0501084_0057013 3300054114 Bacteria 3269
455 Ga0590071_004332 3300059421 Bacteria 3451
456 Ga0590074_000139 3300059423 Bacteria 8584
457 Ga0590074_013742 3300059423 Archaea 1369
458 Ga0590077_000868 3300059426 Bacteria 7753
459 Ga0105248_10049596
460 JGI24746J21847_1003011
461 JGI24750J21931_1003076
462 JGI24034J26672_10008439
463 JGI25406J46586_10020427
464 Ga0065704_10080927
465 Ga0065712_10000215
466 Ga0065712_10013944
467 Ga0065715_10002841
468 Ga0065715_10003389
469 Ga0065715_10097691
470 Ga0065715_10124179
471 Ga0065707_10001243
472 Ga0070676_10000598
473 Ga0070683_100019927
474 Ga0070690_100001342
475 Ga0070690_100068769
476 Ga0070690_100109763
477 Ga0070670_100001524
478 Ga0070670_100002231
479 Ga0070670_100011254
480 Ga0070670_100042365
481 Ga0070670_100124249
482 Ga0070677_10000337
483 Ga0070677_10008460
484 Ga0070677_10079727
485 Ga0068869_100013142
486 Ga0068869_100017867
487 Ga0070666_10005505
488 Ga0068868_100003165
489 Ga0070689_100006284
490 Ga0070689_100067957
491 Ga0070689_100082830
492 Ga0070689_100141650
493 Ga0070689_100164320
494 Ga0070687_100008529
495 Ga0070687_100043871
496 Ga0070661_100020808
497 Ga0070692_10038991
498 Ga0070669_100027884
499 Ga0070669_100107698
500 Ga0070675_100001781
501 Ga0070675_100003217
502 Ga0070675_100012580
503 Ga0070675_100030169
504 Ga0070675_100126873
505 Ga0070675_100154136
506 Ga0070675_100266072
507 Ga0070671_100022382
508 Ga0070671_100152896
509 Ga0070671_100170934
510 Ga0070674_100001502
511 Ga0070674_100026700
512 Ga0070673_100007350
513 Ga0070673_100067268
514 Ga0070673_100067488
515 Ga0070673_100121407
516 Ga0070673_100320163
517 Ga0070688_100004377
518 Ga0070688_100010032
519 Ga0070688_100017502
520 Ga0070688_100047724
521 Ga0070688_100112515
522 Ga0070667_100008350
523 Ga0070667_100226178
524 Ga0070705_100000092
525 Ga0070705_100013854
526 Ga0070705_100129171
527 Ga0070700_100021964
528 Ga0070700_100104131
529 Ga0070694_100023579
530 Ga0070694_100034492
531 Ga0070694_100077783
532 Ga0070694_100080454
533 Ga0070694_100097270
534 Ga0070678_100025468
535 Ga0070678_100029621
536 Ga0070678_100085266
537 Ga0070662_100024531
538 Ga0070662_100076774
539 Ga0070681_10001922
540 Ga0068867_100006595
541 Ga0068867_100010868
542 Ga0070685_10005994
543 Ga0070685_10026237
544 Ga0070685_10124557
545 Ga0070706_100028334
546 Ga0070706_100074102
547 Ga0070698_100002447
548 Ga0070698_100013673
549 Ga0070698_100134094
550 Ga0070699_100003641
551 Ga0070699_100005915
552 Ga0070699_100051101
553 Ga0070699_100097729
554 Ga0070679_100070093
555 Ga0070684_100112334
556 Ga0070697_100032880
557 Ga0070697_100166594
558 Ga0070672_100003669
559 Ga0070672_100057855
560 Ga0070672_100091183
561 Ga0070672_100226078
562 Ga0070686_100008016
563 Ga0070686_100014421
564 Ga0070686_100137469
565 Ga0070695_100000002
566 Ga0070695_100094447
567 Ga0070696_100000679
568 Ga0070696_100027288
569 Ga0070696_100061147
570 Ga0070665_100006818
571 Ga0070665_100157127
572 Ga0070704_100000924
573 Ga0070704_100012991
574 Ga0070704_100045273
575 Ga0070704_100054952
576 Ga0070664_100003208
577 Ga0070664_100024399
578 Ga0070664_100074443
579 Ga0068857_100030011
580 Ga0068857_100138109
581 Ga0068852_100007293
582 Ga0068852_100051966
583 Ga0068859_100009883
584 Ga0068859_100143233
585 Ga0068859_100320975
586 Ga0068859_100354251
587 Ga0068864_100042097
588 Ga0068864_100062268
589 Ga0068866_10128080
590 Ga0068861_100012605
591 Ga0068861_100309873
592 Ga0068851_10022966
593 Ga0068870_10001767
594 Ga0068870_10007801
595 Ga0068870_10039240
596 Ga0068870_10040510
597 Ga0068870_10070519
598 Ga0068863_100001713
599 Ga0068863_100019777
600 Ga0068863_100092653
601 Ga0068863_100111946
602 Ga0068858_100031047
603 Ga0068860_100002981
604 Ga0068860_100006331
605 Ga0068860_100126857
606 Ga0068862_100000748
607 Ga0068862_100002984
608 Ga0068862_100215339
609 Ga0081539_10000012
610 Ga0081539_10000211
611 Ga0081539_10001641
612 Ga0081539_10085685
613 Ga0075366_10003884
614 Ga0097621_100037813
615 Ga0097621_100039347
616 Ga0068871_100036670
617 Ga0068871_100083289
618 Ga0068871_100089896
619 Ga0068871_100171806
620 Ga0075428_100001571
621 Ga0075428_100011251
622 Ga0075428_100052011
623 Ga0075428_100211436
624 Ga0075428_100412591
625 Ga0075430_100002598
626 Ga0075430_100056136
627 Ga0075430_100075781
628 Ga0075430_100197683
629 Ga0075431_100000025
630 Ga0075431_100069013
631 Ga0075431_100138476
632 Ga0075431_100202105
633 Ga0075433_10006953
634 Ga0075433_10027012
635 Ga0075433_10068947
636 Ga0075433_10099371
637 Ga0075434_100001488
638 Ga0075434_100001685
639 Ga0075434_100038439
640 Ga0075434_100054761
641 Ga0075434_100070394
642 Ga0075434_100138346
643 Ga0075429_100000919
644 Ga0075429_100019271
645 Ga0068865_100028412
646 Ga0068865_100086452
647 Ga0068865_100152478
648 Ga0068865_100168831
649 Ga0097620_100009883
650 Ga0097620_100143228
651 Ga0097620_100320993
652 Ga0097620_100354249
653 Ga0075435_100000749
654 Ga0075435_100029955
655 Ga0075435_100163893
656 Ga0075435_100322383
657 Ga0111539_10000778
658 Ga0111539_10011302
659 Ga0111539_10013953
660 Ga0111539_10024835
661 Ga0111539_10390567
662 Ga0105245_10038123
663 Ga0114129_10002377
664 Ga0114129_10003696
665 Ga0114129_10005733
666 Ga0114129_10013409
667 Ga0114129_10030711
668 Ga0114129_10170463
669 Ga0114129_10291941
670 Ga0114129_10637808
671 Ga0114129_10701149
672 Ga0105243_10046908
673 Ga0105243_10139027
674 Ga0105241_10117789
675 Ga0105242_10235278
676 Ga0105248_10277782
677 Ga0105248_10429409
678 Ga0105238_10011856
679 Ga0105249_10009534
680 Ga0105249_10044106
681 Ga0105249_10091279
682 Ga0105246_10017998
683 Ga0157374_10237385
684 Ga0157374_10346040
685 Ga0157378_10266985
686 Ga0163162_10031164
687 Ga0163162_10102943
688 Ga0157375_10033165
689 Ga0157375_10222357
690 Ga0157375_10375348
691 Ga0163163_10033405
692 Ga0163163_10037720
693 Ga0163163_10185917
694 Ga0163163_10424442
695 Ga0157380_10026601
696 Ga0157380_10052466
697 Ga0157380_10056363
698 Ga0157380_10223177
699 Ga0157380_10259993
700 Ga0157377_10027492
701 Ga0157377_10049327
702 Ga0157379_10005616
703 Ga0163161_10003762
704 Ga0163161_10007596
705 Ga0207697_10000023
706 Ga0207697_10000030
707 Ga0207656_10060261
708 Ga0207682_10000114
709 Ga0207682_10007758
710 Ga0207688_10000023
711 Ga0207688_10010867
712 Ga0207680_10182678
713 Ga0207645_10000933
714 Ga0207645_10010512
715 Ga0207645_10073697
716 Ga0207643_10000802
717 Ga0207643_10004638
718 Ga0207643_10010346
719 Ga0207643_10055775
720 Ga0207643_10167733
721 Ga0207707_10162051
722 Ga0207662_10001403
723 Ga0207662_10008680
724 Ga0207662_10081221
725 Ga0207662_10085780
726 Ga0207649_10109357
727 Ga0207646_10366156
728 Ga0207681_10012884
729 Ga0207681_10019727
730 Ga0207681_10026591
731 Ga0207681_10106842
732 Ga0207694_10023542
733 Ga0207650_10005151
734 Ga0207650_10030480
735 Ga0207650_10064198
736 Ga0207650_10139589
737 Ga0207659_10001400
738 Ga0207659_10010386
739 Ga0207659_10021370
740 Ga0207659_10026503
741 Ga0207659_10056738
742 Ga0207659_10216671
743 Ga0207644_10069572
744 Ga0207690_10055852
745 Ga0207690_10075228
746 Ga0207706_10001458
747 Ga0207706_10054945
748 Ga0207670_10008520
749 Ga0207670_10027103
750 Ga0207670_10115785
751 Ga0207669_10008201
752 Ga0207704_10012611
753 Ga0207704_10028494
754 Ga0207704_10111293
755 Ga0207691_10000739
756 Ga0207691_10001178
757 Ga0207691_10006173
758 Ga0207691_10049793
759 Ga0207691_10238960
760 Ga0207711_10125653
761 Ga0207689_10017770
762 Ga0207689_10116227
763 Ga0207661_10018515
764 Ga0207661_10349547
765 Ga0207679_10027232
766 Ga0207679_10088234
767 Ga0207679_10158539
768 Ga0207651_10003819
769 Ga0207651_10064016
770 Ga0207651_10088068
771 Ga0207651_10109686
772 Ga0207712_10003637
773 Ga0207712_10015122
774 Ga0207658_10098793
775 Ga0207703_10152294
776 Ga0207708_10003405
777 Ga0207708_10014530
778 Ga0207708_10057273
779 Ga0207708_10247713
780 Ga0207641_10013736
781 Ga0207641_10069496
782 Ga0207648_10000409
783 Ga0207648_10018739
784 Ga0207676_10015510
785 Ga0207676_10025931
786 Ga0207674_10027118
787 Ga0207674_10069972
788 Ga0207674_10154836
789 Ga0207675_100008895
790 Ga0207675_100015819
791 Ga0207675_100106342
792 Ga0207675_100235194
793 Ga0207675_100309173
794 Ga0207683_10019745
795 Ga0207683_10039743
796 Ga0207683_10149278
797 Ga0209974_10045872
798 Ga0207428_10000330
799 Ga0207428_10000885
800 Ga0207428_10043174
801 Ga0268266_10072641
802 Ga0268266_10236208
803 Ga0268265_10000725
804 Ga0268265_10009376
805 Ga0268264_10012654
806 Ga0268264_10044178
807 Ga0268264_10124171
808 Ga0307405_10016224
809 Ga0307413_10024518
810 Ga0307410_10224994
811 Ga0307406_10013871
812 Ga0307407_10008673
813 Ga0307407_10176717
814 Ga0307412_10004040
815 Ga0307409_100006799
816 Ga0307409_100035856
817 Ga0307409_100087214
818 Ga0307416_100295947
819 Ga0307414_10014357
820 Ga0307411_10049548
821 Ga0307415_100015466
822 Ga0373931_0029035
823 Ga0439453_0014240
824 Ga0439435_0004139
825 Ga0439435_0005543
826 Ga0439435_0037733
827 Ga0451576_0007759
828 Ga0451576_0081155
829 Ga0451576_0315587
830 Ga0495603_0009158
831 Ga0495629_0001607
832 Ga0495584_0067172
833 Ga0495594_0011148
834 Ga0495663_0011807
835 Ga0495598_0015810
836 Ga0495621_0007848
837 Ga0495621_0027273
838 Ga0495633_0050763
839 Ga0495656_0022193
840 Ga0495635_0183054
841 Ga0495659_0012577
842 Ga0495659_0049297
843 Ga0495659_0071359
844 Ga0495588_0180250
845 Ga0495658_0066830
846 Ga0495658_0100601
847 Ga0495670_0047354
848 Ga0495685_072405
849 Ga0496101_0007832
850 Ga0496104_0021355
851 Ga0496104_0064693
852 Ga0496106_0223124
853 Ga0496108_0034566
854 Ga0496108_0093568
855 Ga0496109_0001812
856 Ga0496109_0037645
857 Ga0496109_0061862
858 Ga0496110_0057920
859 Ga0496110_0100668
860 Ga0496110_0160977
861 Ga0496112_0003609
862 Ga0496113_0008241
863 Ga0496113_0033753
864 Ga0496114_0001659
865 Ga0496114_0019103
866 Ga0496115_0097107
867 Ga0501040_0106481
868 Ga0501041_0124266
869 Ga0501048_0040313
870 Ga0501071_0020608
871 Ga0501071_0084170
872 Ga0501072_0005490
873 Ga0501072_0034912
874 Ga0501081_0326213
875 nmdc:mga0k408_36905_c1
876 nmdc:mga05p37_117172_c1
877 nmdc:mga05p37_11976_c1
878 nmdc:mga05p37_19976_c1
879 nmdc:mga05p37_237048_c1
880 nmdc:mga05p37_292537_c1
881 nmdc:mga05p37_37923_c1
882 nmdc:mga05p37_7492_c1
883 nmdc:mga05p37_800_c1
884 nmdc:mga09592_1650_c2
885 nmdc:mga09592_568368_c1
886 nmdc:mga09592_6671_c1
887 nmdc:mga0qj67_1714_c1
888 nmdc:mga0qj67_55619_c1
889 nmdc:mga0qj67_60846_c1
890 nmdc:mga06r32_127920_c1
891 nmdc:mga06r32_2253_c1
892 nmdc:mga06r32_58227_c1
893 nmdc:mga06r32_62956_c1
894 nmdc:mga08y16_1943_c1
895 nmdc:mga08y16_417751_c1
896 nmdc:mga0n895_103243_c1
897 nmdc:mga0n895_13022_c1
898 nmdc:mga0n895_401_c1
899 nmdc:mga0n895_64860_c1
900 nmdc:mga0n895_67102_c1
901 nmdc:mga0n895_80029_c1
902 nmdc:mga0n895_98922_c1
903 nmdc:mga0rr50_24331_c1
904 nmdc:mga0rr50_63790_c1
905 nmdc:mga0a205_1284_c1
906 nmdc:mga0a205_15831_c1
907 nmdc:mga0a205_16322_c1
908 nmdc:mga0a205_287616_c1
909 nmdc:mga0a205_3098_c1
910 Ga0495595_0027266
911 Ga0495619_0014674
912 Ga0501084_0057013
913 Ga0590071_004332
914 Ga0590074_000139
915 Ga0590074_013742
916 Ga0590077_000868

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07786

HGSNAT_cat

Heparan-alpha-glucosaminide N-acetyltransferase, catalytic

3

238

0.8

PF01757

Acyl_transf_3

Acyltransferase family

4

331

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wva-assembly1.cif.gz_A takifugu rubripes vkor-like with vitamin k1 epoxide at non-catalytic state 0.4143 124 258
7z80-assembly1.cif.gz_L complex i from e. coli, ddm/lmng-purified, under turnover at ph 8, closed state 0.3306 40 255
7s4l-assembly1.cif.gz_I cryoem structure of methylotuvimicrobium alcaliphilum 20z pmmo in a popc nanodisc at 2.46 angstrom resolution 0.3142 71 254
6nsj-assembly1.cif.gz_A cryoem structure of helicobacter pylori urea channel in closed state 0.3137 34 261
6nsj-assembly1.cif.gz_A cryoem structure of helicobacter pylori urea channel in closed state 0.3097 34 261
ID Description Score Start End Superfamily
af_A0A0R0HMJ0_13_161_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4492 102 249 1.20.1250.20
af_A0A0R0HMJ0_13_161_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3991 102 249 1.20.1250.20
af_A0A1D6K713_308_470_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3918 60 211 1.20.1250.20
af_A0A1D6LAI1_28_181_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.3842 51 184 1.20.140.40
af_A0A1D6K713_308_470_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3739 60 211 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2V8GXV3-F1-model_v4 Heparan-alpha-glucosaminide N-acetyltransferase catalytic domain-containing protein 0.9859 1 321 GO:0016020
AF-A0A7W1DTQ8-F1-model_v4 DUF1624 domain-containing protein 0.9759 1 236 GO:0016020
AF-A0A1F2V0Y9-F1-model_v4 Heparan-alpha-glucosaminide N-acetyltransferase catalytic domain-containing protein 0.9699 1 322 GO:0016020
AF-A0A7Y5U0P1-F1-model_v4 Acyltransferase 0.9698 1 321 GO:0016020
GO:0016746
AF-A0A2V8EG21-F1-model_v4 Heparan-alpha-glucosaminide N-acetyltransferase catalytic domain-containing protein 0.9677 1 321 GO:0016020

Map