F448130

General Info

Members Datasets Scaffolds Average Seq Length
458 204 916 151

Family's Representative Sequence

Representative Sequence 3300005344|Ga0070661_100005854|Ga0070661_1000058542
Length 179
Sequence MDGTRPSREQSIAKRNDLAHLPAHSSSGDLMNYSPILAPVVALVAWSLVMQVWMYVSRFTAMKRAGISLQGRVGTRGNALEGAIPDQANWKAHNYAHLMEQPTLFYAIALTLALMGWGGGINYWLAWGYVGLRIVHSLIQATANVVTYRFLVFTLASVCLLGLTVHAGLKILHDCGIIG

Samples

Sample ID Description Type Environment
1 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
157 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
158 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
168 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
169 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
170 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
171 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
172 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
173 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
174 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
177 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
178 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
179 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
180 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
187 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
188 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
193 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
194 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
195 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
196 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
197 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
200 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
201 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
202 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
203 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
204 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.66
Nodule 0
Rhizoplane 2.4
Rhizosphere 96.51
Stem 0
Stem Tuber 0
Unclassified 0.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070661_100005854 3300005344 Bacteria 8451
2 JGI24736J21556_1038910 3300001904 Bacteria 732
3 JGI24741J21665_1001492 3300001915 Bacteria 6673
4 JGI24741J21665_1022920 3300001915 Bacteria 966
5 JGI24741J21665_1038469 3300001915 Bacteria 707
6 JGI24740J21852_10002523 3300001979 Bacteria 8262
7 JGI24740J21852_10014577 3300001979 Bacteria 2893
8 JGI24740J21852_10024769 3300001979 Bacteria 2031
9 JGI24740J21852_10040377 3300001979 Bacteria 1415
10 JGI24739J22299_10008608 3300001989 Bacteria 3807
11 JGI24739J22299_10023632 3300001989 Bacteria 2170
12 JGI24739J22299_10032648 3300001989 Bacteria 1789
13 JGI24739J22299_10034651 3300001989 Bacteria 1718
14 JGI24739J22299_10200010 3300001989 Bacteria 586
15 JGI24737J22298_10000016 3300001990 Bacteria 49280
16 JGI24737J22298_10000460 3300001990 Bacteria 14004
17 JGI24737J22298_10004737 3300001990 Bacteria 4723
18 JGI24737J22298_10015999 3300001990 Bacteria 2422
19 JGI24735J21928_10005531 3300002067 Bacteria 4189
20 JGI24735J21928_10049895 3300002067 Bacteria 1209
21 JGI24735J21928_10058223 3300002067 Bacteria 1112
22 JGI24738J21930_10009960 3300002075 Bacteria 2128
23 JGI24738J21930_10064198 3300002075 Bacteria 755
24 Ga0065714_10463813 3300005288 Bacteria 545
25 Ga0065712_10033728 3300005290 Bacteria 1258
26 Ga0065707_10139297 3300005295 Bacteria 1794
27 Ga0070658_10000210 3300005327 Bacteria 51793
28 Ga0070658_10093618 3300005327 Bacteria 2478
29 Ga0070658_10452374 3300005327 Bacteria 1106
30 Ga0070658_11143574 3300005327 Bacteria 677
31 Ga0070676_10016057 3300005328 Bacteria 4136
32 Ga0070676_10228833 3300005328 Bacteria 1232
33 Ga0070683_100005036 3300005329 Bacteria 10968
34 Ga0070683_100177899 3300005329 Bacteria 2019
35 Ga0070690_100032799 3300005330 Bacteria 3246
36 Ga0070690_100036863 3300005330 Bacteria 3077
37 Ga0070670_100015136 3300005331 Bacteria 6620
38 Ga0070670_100031141 3300005331 Bacteria 4594
39 Ga0070670_100192079 3300005331 Bacteria 1774
40 Ga0070670_100227533 3300005331 Bacteria 1623
41 Ga0070670_100310405 3300005331 Bacteria 1380
42 Ga0070670_100634463 3300005331 Bacteria 958
43 Ga0070670_101321990 3300005331 Bacteria 660
44 Ga0068869_100009135 3300005334 Bacteria 6423
45 Ga0068869_100060335 3300005334 Bacteria 2779
46 Ga0070666_10000173 3300005335 Bacteria 44032
47 Ga0070666_10031891 3300005335 Bacteria 3480
48 Ga0070666_10237298 3300005335 Bacteria 1289
49 Ga0070666_10355730 3300005335 Bacteria 1048
50 Ga0070666_11226697 3300005335 Unclassified 559
51 Ga0070680_100660797 3300005336 Bacteria 898
52 Ga0070682_100019552 3300005337 Bacteria 3974
53 Ga0070682_100167349 3300005337 Bacteria 1524
54 Ga0070682_100185456 3300005337 Bacteria 1457
55 Ga0068868_100000343 3300005338 Bacteria 31537
56 Ga0068868_100287740 3300005338 Bacteria 1393
57 Ga0068868_101046540 3300005338 Bacteria 749
58 Ga0070660_100000033 3300005339 Bacteria 83079
59 Ga0070660_100055359 3300005339 Bacteria 3065
60 Ga0070660_100099829 3300005339 Bacteria 2299
61 Ga0070660_100146573 3300005339 Bacteria 1896
62 Ga0070660_100433944 3300005339 Bacteria 1088
63 Ga0070660_100456070 3300005339 Bacteria 1061
64 Ga0070660_100571384 3300005339 Bacteria 944
65 Ga0070691_10219665 3300005341 Bacteria 1006
66 Ga0070687_100970307 3300005343 Bacteria 614
67 Ga0070661_100114130 3300005344 Bacteria 2019
68 Ga0070661_100115995 3300005344 Bacteria 2003
69 Ga0070661_100132892 3300005344 Bacteria 1870
70 Ga0070661_100215848 3300005344 Bacteria 1470
71 Ga0070692_10051207 3300005345 Bacteria 2146
72 Ga0070668_100272604 3300005347 Bacteria 1411
73 Ga0070669_100000811 3300005353 Bacteria 22744
74 Ga0070669_100090416 3300005353 Bacteria 2294
75 Ga0070669_100761754 3300005353 Bacteria 821
76 Ga0070675_100217204 3300005354 Bacteria 1664
77 Ga0070671_100005670 3300005355 Bacteria 9937
78 Ga0070671_100069137 3300005355 Bacteria 2945
79 Ga0070671_100644982 3300005355 Bacteria 917
80 Ga0070671_101623897 3300005355 Bacteria 573
81 Ga0070674_100125120 3300005356 Bacteria 1908
82 Ga0070674_100434999 3300005356 Bacteria 1079
83 Ga0070673_100028279 3300005364 Bacteria 4167
84 Ga0070673_100052933 3300005364 Bacteria 3186
85 Ga0070673_100143500 3300005364 Bacteria 2016
86 Ga0070673_100628841 3300005364 Bacteria 981
87 Ga0070673_100981067 3300005364 Bacteria 786
88 Ga0070688_100052962 3300005365 Bacteria 2537
89 Ga0070659_100000659 3300005366 Bacteria 25102
90 Ga0070659_100056808 3300005366 Bacteria 3086
91 Ga0070659_100158391 3300005366 Bacteria 1850
92 Ga0070659_100288890 3300005366 Bacteria 1365
93 Ga0070659_100869536 3300005366 Bacteria 787
94 Ga0070667_100148664 3300005367 Bacteria 2056
95 Ga0070667_100196659 3300005367 Bacteria 1788
96 Ga0070667_101166971 3300005367 Bacteria 720
97 Ga0070709_10013335 3300005434 Bacteria 4619
98 Ga0070714_100066472 3300005435 Bacteria 3107
99 Ga0070713_100029807 3300005436 Bacteria 4325
100 Ga0070711_101060663 3300005439 Bacteria 697
101 Ga0070663_100001734 3300005455 Bacteria 12110
102 Ga0070663_100031990 3300005455 Bacteria 3621
103 Ga0070663_100203681 3300005455 Bacteria 1545
104 Ga0070663_100396350 3300005455 Bacteria 1127
105 Ga0070662_100000022 3300005457 Bacteria 92004
106 Ga0070662_100003174 3300005457 Bacteria 10217
107 Ga0070662_100377317 3300005457 Bacteria 1166
108 Ga0070662_100389102 3300005457 Bacteria 1149
109 Ga0070662_100486023 3300005457 Bacteria 1028
110 Ga0070681_10047280 3300005458 Bacteria 4301
111 Ga0068867_100188841 3300005459 Bacteria 1643
112 Ga0068867_100318515 3300005459 Bacteria 1288
113 Ga0070685_10058374 3300005466 Bacteria 2249
114 Ga0070679_100410146 3300005530 Bacteria 1300
115 Ga0070684_100015409 3300005535 Bacteria 6226
116 Ga0070684_100141834 3300005535 Bacteria 2173
117 Ga0068853_100000861 3300005539 Bacteria 21166
118 Ga0068853_100001973 3300005539 Bacteria 15125
119 Ga0068853_100157124 3300005539 Bacteria 2049
120 Ga0068853_100247000 3300005539 Bacteria 1637
121 Ga0070696_100062937 3300005546 Bacteria 2598
122 Ga0070696_100913187 3300005546 Bacteria 729
123 Ga0070693_100000497 3300005547 Bacteria 17569
124 Ga0070693_100295488 3300005547 Bacteria 1090
125 Ga0070665_100011828 3300005548 Bacteria 8817
126 Ga0068855_100002206 3300005563 Bacteria 24089
127 Ga0068855_100047107 3300005563 Bacteria 5094
128 Ga0070664_100000138 3300005564 Bacteria 49167
129 Ga0070664_100008852 3300005564 Bacteria 8158
130 Ga0070664_100010070 3300005564 Bacteria 7663
131 Ga0070664_100113514 3300005564 Bacteria 2366
132 Ga0068857_100010239 3300005577 Bacteria 8150
133 Ga0068857_100030688 3300005577 Bacteria 4747
134 Ga0068857_100033529 3300005577 Bacteria 4541
135 Ga0068854_100049394 3300005578 Bacteria 3004
136 Ga0068854_100066883 3300005578 Bacteria 2616
137 Ga0068856_100000081 3300005614 Bacteria 88388
138 Ga0068856_101080340 3300005614 Bacteria 820
139 Ga0068856_101891584 3300005614 Bacteria 608
140 Ga0068852_100070462 3300005616 Bacteria 3067
141 Ga0068852_100303695 3300005616 Bacteria 1546
142 Ga0068859_100061271 3300005617 Bacteria 3791
143 Ga0068859_100093969 3300005617 Bacteria 3050
144 Ga0068859_102434097 3300005617 Bacteria 577
145 Ga0068864_100020980 3300005618 Bacteria 5471
146 Ga0068861_100194379 3300005719 Bacteria 1699
147 Ga0068851_10009158 3300005834 Bacteria 4599
148 Ga0068851_10890060 3300005834 Bacteria 557
149 Ga0068863_100012003 3300005841 Bacteria 8371
150 Ga0068863_100022191 3300005841 Bacteria 6060
151 Ga0068863_100060047 3300005841 Bacteria 3596
152 Ga0068858_100003560 3300005842 Bacteria 15415
153 Ga0068858_100287334 3300005842 Bacteria 1567
154 Ga0068858_100299471 3300005842 Bacteria 1534
155 Ga0068860_100189801 3300005843 Bacteria 1988
156 Ga0068862_100279341 3300005844 Bacteria 1530
157 Ga0081539_10021781 3300005985 Bacteria 4267
158 Ga0070717_10118482 3300006028 Bacteria 2266
159 Ga0070716_100045492 3300006173 Bacteria 2464
160 Ga0070712_100121662 3300006175 Bacteria 1964
161 Ga0075369_10126992 3300006186 Bacteria 1157
162 Ga0075366_10371666 3300006195 Bacteria 879
163 Ga0097621_101073895 3300006237 Bacteria 755
164 Ga0097621_101295110 3300006237 Bacteria 688
165 Ga0068871_100132886 3300006358 Bacteria 2111
166 Ga0097620_100061273 3300006931 Bacteria 3791
167 Ga0097620_100093962 3300006931 Bacteria 3050
168 Ga0097620_102434602 3300006931 Bacteria 577
169 Ga0111539_11034965 3300009094 Bacteria 954
170 Ga0105245_10059545 3300009098 Bacteria 3439
171 Ga0105243_10077053 3300009148 Bacteria 2711
172 Ga0105241_10085591 3300009174 Bacteria 2478
173 Ga0105248_10000182 3300009177 Bacteria 73487
174 Ga0105248_10022877 3300009177 Bacteria 6939
175 Ga0105238_10019329 3300009551 Bacteria 6938
176 Ga0105238_11198050 3300009551 Bacteria 784
177 Ga0105249_10095226 3300009553 Bacteria 2791
178 Ga0105239_10380813 3300010375 Bacteria 1595
179 Ga0105239_10911791 3300010375 Bacteria 1009
180 Ga0105246_10041483 3300011119 Bacteria 3111
181 Ga0105246_10588281 3300011119 Bacteria 960
182 Ga0157373_10025045 3300013100 Bacteria 4319
183 Ga0157373_10047850 3300013100 Bacteria 3049
184 Ga0157373_10083538 3300013100 Bacteria 2251
185 Ga0157373_10166168 3300013100 Bacteria 1553
186 Ga0157373_10595149 3300013100 Bacteria 805
187 Ga0157373_10739286 3300013100 Bacteria 723
188 Ga0157373_11133385 3300013100 Bacteria 588
189 Ga0157371_10000975 3300013102 Bacteria 31794
190 Ga0157371_10004512 3300013102 Bacteria 12129
191 Ga0157371_10017714 3300013102 Bacteria 5286
192 Ga0157371_10146102 3300013102 Bacteria 1685
193 Ga0157371_10150181 3300013102 Bacteria 1661
194 Ga0157371_10766932 3300013102 Bacteria 725
195 Ga0157369_10471555 3300013105 Bacteria 1299
196 Ga0157374_10264516 3300013296 Bacteria 1695
197 Ga0157378_10001598 3300013297 Bacteria 20501
198 Ga0163162_10059306 3300013306 Bacteria 3858
199 Ga0163162_10846301 3300013306 Bacteria 1030
200 Ga0157372_10093115 3300013307 Bacteria 3429
201 Ga0157372_12204333 3300013307 Bacteria 633
202 Ga0157375_10044016 3300013308 Bacteria 4333
203 Ga0157375_10600645 3300013308 Bacteria 1259
204 Ga0163163_10000288 3300014325 Bacteria 50036
205 Ga0163163_10338813 3300014325 Bacteria 1559
206 Ga0157380_10168413 3300014326 Bacteria 1911
207 Ga0157380_11316546 3300014326 Bacteria 770
208 Ga0157377_10322792 3300014745 Bacteria 1026
209 Ga0207688_10044686 3300025901 Bacteria 2469
210 Ga0207680_10000521 3300025903 Bacteria 18396
211 Ga0207680_10298980 3300025903 Bacteria 1122
212 Ga0207680_10394941 3300025903 Bacteria 977
213 Ga0207680_10734540 3300025903 Bacteria 708
214 Ga0207647_10040424 3300025904 Bacteria 2937
215 Ga0207647_10055878 3300025904 Bacteria 2424
216 Ga0207647_10110949 3300025904 Bacteria 1622
217 Ga0207647_10154177 3300025904 Bacteria 1342
218 Ga0207647_10449781 3300025904 Bacteria 722
219 Ga0207699_10121528 3300025906 Bacteria 1689
220 Ga0207645_10714143 3300025907 Bacteria 681
221 Ga0207705_10000074 3300025909 Bacteria 123863
222 Ga0207705_10007313 3300025909 Bacteria 8120
223 Ga0207654_10081734 3300025911 Bacteria 1946
224 Ga0207707_10006125 3300025912 Bacteria 10514
225 Ga0207693_10089807 3300025915 Bacteria 2408
226 Ga0207660_10002493 3300025917 Bacteria 12101
227 Ga0207662_10357360 3300025918 Bacteria 982
228 Ga0207657_10002687 3300025919 Bacteria 19162
229 Ga0207657_10005878 3300025919 Bacteria 12782
230 Ga0207657_10045428 3300025919 Bacteria 3855
231 Ga0207657_10408479 3300025919 Bacteria 1068
232 Ga0207649_10000433 3300025920 Bacteria 30337
233 Ga0207649_10085965 3300025920 Bacteria 2048
234 Ga0207649_10090945 3300025920 Bacteria 1998
235 Ga0207649_11074473 3300025920 Bacteria 634
236 Ga0207652_10008918 3300025921 Bacteria 8082
237 Ga0207652_10903756 3300025921 Bacteria 780
238 Ga0207681_10595982 3300025923 Bacteria 913
239 Ga0207694_10077602 3300025924 Bacteria 2603
240 Ga0207650_10062765 3300025925 Bacteria 2776
241 Ga0207650_10073127 3300025925 Bacteria 2582
242 Ga0207650_10092786 3300025925 Bacteria 2310
243 Ga0207650_10100769 3300025925 Bacteria 2222
244 Ga0207650_10207043 3300025925 Bacteria 1574
245 Ga0207659_10888567 3300025926 Bacteria 766
246 Ga0207700_10401626 3300025928 Bacteria 1201
247 Ga0207664_10103584 3300025929 Bacteria 2355
248 Ga0207644_10006041 3300025931 Bacteria 7895
249 Ga0207644_10436552 3300025931 Bacteria 1074
250 Ga0207644_10449146 3300025931 Bacteria 1059
251 Ga0207644_10655642 3300025931 Bacteria 874
252 Ga0207690_10004880 3300025932 Bacteria 7910
253 Ga0207690_10033236 3300025932 Bacteria 3315
254 Ga0207690_10144462 3300025932 Bacteria 1757
255 Ga0207690_11123570 3300025932 Bacteria 655
256 Ga0207706_10002170 3300025933 Bacteria 19162
257 Ga0207706_10013943 3300025933 Bacteria 7288
258 Ga0207706_10160500 3300025933 Bacteria 1976
259 Ga0207706_10386052 3300025933 Bacteria 1215
260 Ga0207665_10029444 3300025939 Bacteria 3629
261 Ga0207691_10293615 3300025940 Bacteria 1397
262 Ga0207711_10001076 3300025941 Bacteria 26074
263 Ga0207689_10018361 3300025942 Bacteria 5901
264 Ga0207661_10024293 3300025944 Bacteria 4591
265 Ga0207661_10345498 3300025944 Bacteria 1341
266 Ga0207661_10406631 3300025944 Bacteria 1235
267 Ga0207679_10008105 3300025945 Bacteria 6682
268 Ga0207679_10019649 3300025945 Bacteria 4543
269 Ga0207679_10599753 3300025945 Bacteria 992
270 Ga0207667_10002956 3300025949 Bacteria 21095
271 Ga0207667_10144488 3300025949 Bacteria 2449
272 Ga0207651_10145778 3300025960 Bacteria 1836
273 Ga0207651_10561216 3300025960 Bacteria 994
274 Ga0207712_10009687 3300025961 Bacteria 6106
275 Ga0207668_10029318 3300025972 Bacteria 3607
276 Ga0207668_10772434 3300025972 Bacteria 849
277 Ga0207668_11182099 3300025972 Bacteria 687
278 Ga0207640_10062352 3300025981 Bacteria 2473
279 Ga0207658_10107318 3300025986 Bacteria 2200
280 Ga0207658_10802794 3300025986 Bacteria 854
281 Ga0207703_10031339 3300026035 Bacteria 4203
282 Ga0207703_10036822 3300026035 Bacteria 3896
283 Ga0207703_10292915 3300026035 Bacteria 1482
284 Ga0207703_10611538 3300026035 Bacteria 1031
285 Ga0207639_10017657 3300026041 Bacteria 5059
286 Ga0207639_10024548 3300026041 Bacteria 4364
287 Ga0207639_10215606 3300026041 Bacteria 1655
288 Ga0207678_10002294 3300026067 Bacteria 17328
289 Ga0207678_10002627 3300026067 Bacteria 16366
290 Ga0207678_10013081 3300026067 Bacteria 7281
291 Ga0207678_10195874 3300026067 Bacteria 1727
292 Ga0207678_11612725 3300026067 Unclassified 571
293 Ga0207702_10001420 3300026078 Bacteria 23930
294 Ga0207641_10007415 3300026088 Bacteria 9124
295 Ga0207648_10399307 3300026089 Bacteria 1245
296 Ga0207676_10030732 3300026095 Bacteria 4034
297 Ga0207676_10050358 3300026095 Bacteria 3247
298 Ga0207674_10000501 3300026116 Bacteria 51694
299 Ga0207674_10002056 3300026116 Bacteria 25550
300 Ga0207674_10005899 3300026116 Bacteria 14519
301 Ga0207675_100162637 3300026118 Bacteria 2130
302 Ga0207675_100201133 3300026118 Bacteria 1913
303 Ga0207698_10999086 3300026142 Bacteria 847
304 Ga0209973_1064717 3300027252 Bacteria 566
305 Ga0209974_10023010 3300027876 Bacteria 2063
306 Ga0268266_10119885 3300028379 Bacteria 2340
307 Ga0268265_10275479 3300028380 Bacteria 1503
308 Ga0268265_10304435 3300028380 Bacteria 1436
309 Ga0307515_10530497 3300028794 Bacteria 787
310 Ga0316182_1191358 3300030745 Bacteria 924
311 Ga0307408_100111700 3300031548 Bacteria 2100
312 Ga0307408_100213489 3300031548 Bacteria 1570
313 Ga0307408_100482688 3300031548 Bacteria 1081
314 Ga0307408_100992012 3300031548 Bacteria 774
315 Ga0307405_10079819 3300031731 Bacteria 2134
316 Ga0307405_10122512 3300031731 Bacteria 1781
317 Ga0307405_10181028 3300031731 Bacteria 1513
318 Ga0307405_10217725 3300031731 Bacteria 1399
319 Ga0307405_10246515 3300031731 Bacteria 1326
320 Ga0307405_10622034 3300031731 Bacteria 884
321 Ga0307405_10869212 3300031731 Bacteria 760
322 Ga0307413_10015603 3300031824 Bacteria 3899
323 Ga0307413_10057371 3300031824 Bacteria 2381
324 Ga0307413_10121501 3300031824 Bacteria 1770
325 Ga0307413_10151114 3300031824 Bacteria 1618
326 Ga0307413_10242659 3300031824 Bacteria 1331
327 Ga0307413_10253855 3300031824 Bacteria 1306
328 Ga0307413_10295357 3300031824 Bacteria 1226
329 Ga0307413_10403353 3300031824 Bacteria 1072
330 Ga0307413_10440487 3300031824 Bacteria 1031
331 Ga0307413_10553756 3300031824 Bacteria 933
332 Ga0307413_10609767 3300031824 Bacteria 894
333 Ga0307410_10010906 3300031852 Bacteria 5173
334 Ga0307410_10027235 3300031852 Bacteria 3610
335 Ga0307410_10050736 3300031852 Bacteria 2792
336 Ga0307410_10060724 3300031852 Bacteria 2584
337 Ga0307410_10098922 3300031852 Bacteria 2087
338 Ga0307410_10114668 3300031852 Bacteria 1955
339 Ga0307410_10188648 3300031852 Bacteria 1566
340 Ga0307410_10497590 3300031852 Bacteria 1002
341 Ga0307406_10016826 3300031901 Bacteria 4254
342 Ga0307406_10406843 3300031901 Bacteria 1080
343 Ga0307407_10028181 3300031903 Bacteria 2999
344 Ga0307407_10031445 3300031903 Bacteria 2874
345 Ga0307407_11185037 3300031903 Bacteria 596
346 Ga0307412_10034910 3300031911 Bacteria 3208
347 Ga0307412_10071162 3300031911 Bacteria 2373
348 Ga0307412_10290140 3300031911 Bacteria 1288
349 Ga0307412_10292762 3300031911 Bacteria 1283
350 Ga0307412_10342930 3300031911 Bacteria 1196
351 Ga0307412_10617542 3300031911 Bacteria 920
352 Ga0307409_100055382 3300031995 Bacteria 3061
353 Ga0307409_100106275 3300031995 Bacteria 2342
354 Ga0307409_100393460 3300031995 Bacteria 1321
355 Ga0307409_100474925 3300031995 Bacteria 1212
356 Ga0307409_100573889 3300031995 Bacteria 1111
357 Ga0307409_100674333 3300031995 Bacteria 1030
358 Ga0307409_100745746 3300031995 Bacteria 982
359 Ga0307409_101606246 3300031995 Bacteria 678
360 Ga0307416_100017942 3300032002 Bacteria 4970
361 Ga0307416_100119855 3300032002 Bacteria 2342
362 Ga0307416_100143987 3300032002 Bacteria 2172
363 Ga0307414_10085882 3300032004 Bacteria 2320
364 Ga0307414_10266357 3300032004 Bacteria 1432
365 Ga0307414_10349553 3300032004 Bacteria 1268
366 Ga0307414_10369998 3300032004 Bacteria 1236
367 Ga0307414_10404506 3300032004 Bacteria 1186
368 Ga0307411_10014906 3300032005 Bacteria 4343
369 Ga0307411_10021195 3300032005 Bacteria 3797
370 Ga0307411_10022748 3300032005 Bacteria 3698
371 Ga0307411_10025745 3300032005 Bacteria 3530
372 Ga0307411_10033821 3300032005 Bacteria 3174
373 Ga0307411_10073486 3300032005 Bacteria 2326
374 Ga0307411_10573668 3300032005 Bacteria 966
375 Ga0307411_11075309 3300032005 Bacteria 724
376 Ga0307415_100013397 3300032126 Bacteria 4787
377 Ga0307415_100025272 3300032126 Bacteria 3723
378 Ga0307415_100051447 3300032126 Bacteria 2795
379 Ga0307415_100500218 3300032126 Bacteria 1062
380 Ga0307415_100524673 3300032126 Bacteria 1040
381 Ga0307415_100537046 3300032126 Bacteria 1029
382 Ga0373939_0113313 3300035114 Bacteria 947
383 Ga0373946_0136015 3300035171 Bacteria 1135
384 Ga0373942_0058067 3300035207 Bacteria 1102
385 Ga0373931_0099769 3300035691 Bacteria 1631
386 Ga0373935_0003447 3300035692 Bacteria 9188
387 Ga0373925_1467676 3300037068 Bacteria 558
388 Ga0395899_0191181 3300037312 Bacteria 1432
389 Ga0395900_0002834 3300037418 Bacteria 18925
390 Ga0395900_0019388 3300037418 Bacteria 6937
391 Ga0395900_0035288 3300037418 Bacteria 5151
392 Ga0395900_0084599 3300037418 Bacteria 3260
393 Ga0395900_0197330 3300037418 Bacteria 2038
394 Ga0395898_0021493 3300037466 Bacteria 6544
395 Ga0395898_1265494 3300037466 Bacteria 668
396 Ga0395898_1431189 3300037466 Bacteria 618
397 Ga0395905_0002771 3300037471 Bacteria 19201
398 Ga0395905_0014298 3300037471 Bacteria 7584
399 Ga0395905_0018665 3300037471 Bacteria 6578
400 Ga0395905_0034286 3300037471 Bacteria 4766
401 Ga0395905_0037795 3300037471 Bacteria 4531
402 Ga0395905_0078754 3300037471 Bacteria 3089
403 Ga0395905_0175602 3300037471 Bacteria 2011
404 Ga0395905_0362738 3300037471 Bacteria 1342
405 Ga0395905_0402479 3300037471 Bacteria 1264
406 Ga0395901_0002990 3300038443 Bacteria 17050
407 Ga0395901_0012364 3300038443 Bacteria 8659
408 Ga0395901_0012598 3300038443 Bacteria 8582
409 Ga0395901_0018225 3300038443 Bacteria 7168
410 Ga0395901_0063382 3300038443 Bacteria 3847
411 Ga0395901_0110459 3300038443 Bacteria 2886
412 Ga0395901_0406602 3300038443 Bacteria 1398
413 Ga0395901_0435874 3300038443 Bacteria 1342
414 Ga0395901_0677473 3300038443 Bacteria 1031
415 Ga0451835_0621127 3300041492 Bacteria 580
416 Ga0439448_0031307 3300042005 Bacteria 1689
417 Ga0439448_0085704 3300042005 Bacteria 1061
418 Ga0439455_0023754 3300042012 Bacteria 1478
419 Ga0439462_0190905 3300042015 Bacteria 582
420 Ga0439458_0000161 3300042157 Bacteria 14947
421 Ga0466963_1047243 3300044694 Bacteria 574
422 Ga0466957_0907680 3300044842 Bacteria 630
423 Ga0466960_0273168 3300044901 Bacteria 945
424 Ga0466967_0102545 3300045976 Bacteria 2618
425 Ga0466967_0640682 3300045976 Bacteria 1050
426 Ga0495590_0213374 3300046457 Bacteria 712
427 Ga0495598_0001383 3300046537 Bacteria 4781
428 Ga0495621_0000042 3300046539 Bacteria 25037
429 Ga0495621_0210854 3300046539 Bacteria 784
430 Ga0495669_0329192 3300046684 Bacteria 738
431 Ga0495670_0000672 3300046691 Bacteria 16268
432 Ga0496100_0163398 3300048903 Bacteria 1598
433 Ga0496101_1036062 3300048904 Bacteria 645
434 Ga0496105_0827757 3300048908 Bacteria 702
435 Ga0496107_0168298 3300048910 Bacteria 1626
436 Ga0496107_0401459 3300048910 Bacteria 1019
437 Ga0496108_0018205 3300048911 Bacteria 5750
438 Ga0496109_0829020 3300048912 Bacteria 863
439 Ga0496109_1420688 3300048912 Bacteria 629
440 Ga0496110_0466210 3300048913 Bacteria 1151
441 Ga0496111_0194370 3300048914 Bacteria 1508
442 Ga0496112_0649964 3300048915 Bacteria 984
443 Ga0501071_0583281 3300049587 Bacteria 859
444 Ga0501072_0723223 3300049588 Bacteria 782
445 Ga0501074_0103481 3300049590 Bacteria 2038
446 Ga0501202_106566 3300049652 Bacteria 689
447 Ga0501242_003019 3300049674 Bacteria 1800
448 Ga0501243_017097 3300049675 Bacteria 1175
449 Ga0501243_031217 3300049675 Bacteria 910
450 Ga0501249_066921 3300049679 Bacteria 837
451 Ga0501258_025890 3300049687 Bacteria 716
452 Ga0501080_0047928 3300049742 Bacteria 3978
453 Ga0501270_055389 3300049767 Bacteria 730
454 Ga0501204_065309 3300049850 Bacteria 588
455 Ga0501212_126456 3300049851 Bacteria 500
456 nmdc:mga08x19_1336084_c1 3300050514 Bacteria 507
457 Ga0495655_0218481 3300053083 Bacteria 630
458 Ga0500587_003422 3300053739 Bacteria 2220
459 Ga0070661_100005854
460 JGI24736J21556_1038910
461 JGI24741J21665_1001492
462 JGI24741J21665_1022920
463 JGI24741J21665_1038469
464 JGI24740J21852_10002523
465 JGI24740J21852_10014577
466 JGI24740J21852_10024769
467 JGI24740J21852_10040377
468 JGI24739J22299_10008608
469 JGI24739J22299_10023632
470 JGI24739J22299_10032648
471 JGI24739J22299_10034651
472 JGI24739J22299_10200010
473 JGI24737J22298_10000016
474 JGI24737J22298_10000460
475 JGI24737J22298_10004737
476 JGI24737J22298_10015999
477 JGI24735J21928_10005531
478 JGI24735J21928_10049895
479 JGI24735J21928_10058223
480 JGI24738J21930_10009960
481 JGI24738J21930_10064198
482 Ga0065714_10463813
483 Ga0065712_10033728
484 Ga0065707_10139297
485 Ga0070658_10000210
486 Ga0070658_10093618
487 Ga0070658_10452374
488 Ga0070658_11143574
489 Ga0070676_10016057
490 Ga0070676_10228833
491 Ga0070683_100005036
492 Ga0070683_100177899
493 Ga0070690_100032799
494 Ga0070690_100036863
495 Ga0070670_100015136
496 Ga0070670_100031141
497 Ga0070670_100192079
498 Ga0070670_100227533
499 Ga0070670_100310405
500 Ga0070670_100634463
501 Ga0070670_101321990
502 Ga0068869_100009135
503 Ga0068869_100060335
504 Ga0070666_10000173
505 Ga0070666_10031891
506 Ga0070666_10237298
507 Ga0070666_10355730
508 Ga0070666_11226697
509 Ga0070680_100660797
510 Ga0070682_100019552
511 Ga0070682_100167349
512 Ga0070682_100185456
513 Ga0068868_100000343
514 Ga0068868_100287740
515 Ga0068868_101046540
516 Ga0070660_100000033
517 Ga0070660_100055359
518 Ga0070660_100099829
519 Ga0070660_100146573
520 Ga0070660_100433944
521 Ga0070660_100456070
522 Ga0070660_100571384
523 Ga0070691_10219665
524 Ga0070687_100970307
525 Ga0070661_100114130
526 Ga0070661_100115995
527 Ga0070661_100132892
528 Ga0070661_100215848
529 Ga0070692_10051207
530 Ga0070668_100272604
531 Ga0070669_100000811
532 Ga0070669_100090416
533 Ga0070669_100761754
534 Ga0070675_100217204
535 Ga0070671_100005670
536 Ga0070671_100069137
537 Ga0070671_100644982
538 Ga0070671_101623897
539 Ga0070674_100125120
540 Ga0070674_100434999
541 Ga0070673_100028279
542 Ga0070673_100052933
543 Ga0070673_100143500
544 Ga0070673_100628841
545 Ga0070673_100981067
546 Ga0070688_100052962
547 Ga0070659_100000659
548 Ga0070659_100056808
549 Ga0070659_100158391
550 Ga0070659_100288890
551 Ga0070659_100869536
552 Ga0070667_100148664
553 Ga0070667_100196659
554 Ga0070667_101166971
555 Ga0070709_10013335
556 Ga0070714_100066472
557 Ga0070713_100029807
558 Ga0070711_101060663
559 Ga0070663_100001734
560 Ga0070663_100031990
561 Ga0070663_100203681
562 Ga0070663_100396350
563 Ga0070662_100000022
564 Ga0070662_100003174
565 Ga0070662_100377317
566 Ga0070662_100389102
567 Ga0070662_100486023
568 Ga0070681_10047280
569 Ga0068867_100188841
570 Ga0068867_100318515
571 Ga0070685_10058374
572 Ga0070679_100410146
573 Ga0070684_100015409
574 Ga0070684_100141834
575 Ga0068853_100000861
576 Ga0068853_100001973
577 Ga0068853_100157124
578 Ga0068853_100247000
579 Ga0070696_100062937
580 Ga0070696_100913187
581 Ga0070693_100000497
582 Ga0070693_100295488
583 Ga0070665_100011828
584 Ga0068855_100002206
585 Ga0068855_100047107
586 Ga0070664_100000138
587 Ga0070664_100008852
588 Ga0070664_100010070
589 Ga0070664_100113514
590 Ga0068857_100010239
591 Ga0068857_100030688
592 Ga0068857_100033529
593 Ga0068854_100049394
594 Ga0068854_100066883
595 Ga0068856_100000081
596 Ga0068856_101080340
597 Ga0068856_101891584
598 Ga0068852_100070462
599 Ga0068852_100303695
600 Ga0068859_100061271
601 Ga0068859_100093969
602 Ga0068859_102434097
603 Ga0068864_100020980
604 Ga0068861_100194379
605 Ga0068851_10009158
606 Ga0068851_10890060
607 Ga0068863_100012003
608 Ga0068863_100022191
609 Ga0068863_100060047
610 Ga0068858_100003560
611 Ga0068858_100287334
612 Ga0068858_100299471
613 Ga0068860_100189801
614 Ga0068862_100279341
615 Ga0081539_10021781
616 Ga0070717_10118482
617 Ga0070716_100045492
618 Ga0070712_100121662
619 Ga0075369_10126992
620 Ga0075366_10371666
621 Ga0097621_101073895
622 Ga0097621_101295110
623 Ga0068871_100132886
624 Ga0097620_100061273
625 Ga0097620_100093962
626 Ga0097620_102434602
627 Ga0111539_11034965
628 Ga0105245_10059545
629 Ga0105243_10077053
630 Ga0105241_10085591
631 Ga0105248_10000182
632 Ga0105248_10022877
633 Ga0105238_10019329
634 Ga0105238_11198050
635 Ga0105249_10095226
636 Ga0105239_10380813
637 Ga0105239_10911791
638 Ga0105246_10041483
639 Ga0105246_10588281
640 Ga0157373_10025045
641 Ga0157373_10047850
642 Ga0157373_10083538
643 Ga0157373_10166168
644 Ga0157373_10595149
645 Ga0157373_10739286
646 Ga0157373_11133385
647 Ga0157371_10000975
648 Ga0157371_10004512
649 Ga0157371_10017714
650 Ga0157371_10146102
651 Ga0157371_10150181
652 Ga0157371_10766932
653 Ga0157369_10471555
654 Ga0157374_10264516
655 Ga0157378_10001598
656 Ga0163162_10059306
657 Ga0163162_10846301
658 Ga0157372_10093115
659 Ga0157372_12204333
660 Ga0157375_10044016
661 Ga0157375_10600645
662 Ga0163163_10000288
663 Ga0163163_10338813
664 Ga0157380_10168413
665 Ga0157380_11316546
666 Ga0157377_10322792
667 Ga0207688_10044686
668 Ga0207680_10000521
669 Ga0207680_10298980
670 Ga0207680_10394941
671 Ga0207680_10734540
672 Ga0207647_10040424
673 Ga0207647_10055878
674 Ga0207647_10110949
675 Ga0207647_10154177
676 Ga0207647_10449781
677 Ga0207699_10121528
678 Ga0207645_10714143
679 Ga0207705_10000074
680 Ga0207705_10007313
681 Ga0207654_10081734
682 Ga0207707_10006125
683 Ga0207693_10089807
684 Ga0207660_10002493
685 Ga0207662_10357360
686 Ga0207657_10002687
687 Ga0207657_10005878
688 Ga0207657_10045428
689 Ga0207657_10408479
690 Ga0207649_10000433
691 Ga0207649_10085965
692 Ga0207649_10090945
693 Ga0207649_11074473
694 Ga0207652_10008918
695 Ga0207652_10903756
696 Ga0207681_10595982
697 Ga0207694_10077602
698 Ga0207650_10062765
699 Ga0207650_10073127
700 Ga0207650_10092786
701 Ga0207650_10100769
702 Ga0207650_10207043
703 Ga0207659_10888567
704 Ga0207700_10401626
705 Ga0207664_10103584
706 Ga0207644_10006041
707 Ga0207644_10436552
708 Ga0207644_10449146
709 Ga0207644_10655642
710 Ga0207690_10004880
711 Ga0207690_10033236
712 Ga0207690_10144462
713 Ga0207690_11123570
714 Ga0207706_10002170
715 Ga0207706_10013943
716 Ga0207706_10160500
717 Ga0207706_10386052
718 Ga0207665_10029444
719 Ga0207691_10293615
720 Ga0207711_10001076
721 Ga0207689_10018361
722 Ga0207661_10024293
723 Ga0207661_10345498
724 Ga0207661_10406631
725 Ga0207679_10008105
726 Ga0207679_10019649
727 Ga0207679_10599753
728 Ga0207667_10002956
729 Ga0207667_10144488
730 Ga0207651_10145778
731 Ga0207651_10561216
732 Ga0207712_10009687
733 Ga0207668_10029318
734 Ga0207668_10772434
735 Ga0207668_11182099
736 Ga0207640_10062352
737 Ga0207658_10107318
738 Ga0207658_10802794
739 Ga0207703_10031339
740 Ga0207703_10036822
741 Ga0207703_10292915
742 Ga0207703_10611538
743 Ga0207639_10017657
744 Ga0207639_10024548
745 Ga0207639_10215606
746 Ga0207678_10002294
747 Ga0207678_10002627
748 Ga0207678_10013081
749 Ga0207678_10195874
750 Ga0207678_11612725
751 Ga0207702_10001420
752 Ga0207641_10007415
753 Ga0207648_10399307
754 Ga0207676_10030732
755 Ga0207676_10050358
756 Ga0207674_10000501
757 Ga0207674_10002056
758 Ga0207674_10005899
759 Ga0207675_100162637
760 Ga0207675_100201133
761 Ga0207698_10999086
762 Ga0209973_1064717
763 Ga0209974_10023010
764 Ga0268266_10119885
765 Ga0268265_10275479
766 Ga0268265_10304435
767 Ga0307515_10530497
768 Ga0316182_1191358
769 Ga0307408_100111700
770 Ga0307408_100213489
771 Ga0307408_100482688
772 Ga0307408_100992012
773 Ga0307405_10079819
774 Ga0307405_10122512
775 Ga0307405_10181028
776 Ga0307405_10217725
777 Ga0307405_10246515
778 Ga0307405_10622034
779 Ga0307405_10869212
780 Ga0307413_10015603
781 Ga0307413_10057371
782 Ga0307413_10121501
783 Ga0307413_10151114
784 Ga0307413_10242659
785 Ga0307413_10253855
786 Ga0307413_10295357
787 Ga0307413_10403353
788 Ga0307413_10440487
789 Ga0307413_10553756
790 Ga0307413_10609767
791 Ga0307410_10010906
792 Ga0307410_10027235
793 Ga0307410_10050736
794 Ga0307410_10060724
795 Ga0307410_10098922
796 Ga0307410_10114668
797 Ga0307410_10188648
798 Ga0307410_10497590
799 Ga0307406_10016826
800 Ga0307406_10406843
801 Ga0307407_10028181
802 Ga0307407_10031445
803 Ga0307407_11185037
804 Ga0307412_10034910
805 Ga0307412_10071162
806 Ga0307412_10290140
807 Ga0307412_10292762
808 Ga0307412_10342930
809 Ga0307412_10617542
810 Ga0307409_100055382
811 Ga0307409_100106275
812 Ga0307409_100393460
813 Ga0307409_100474925
814 Ga0307409_100573889
815 Ga0307409_100674333
816 Ga0307409_100745746
817 Ga0307409_101606246
818 Ga0307416_100017942
819 Ga0307416_100119855
820 Ga0307416_100143987
821 Ga0307414_10085882
822 Ga0307414_10266357
823 Ga0307414_10349553
824 Ga0307414_10369998
825 Ga0307414_10404506
826 Ga0307411_10014906
827 Ga0307411_10021195
828 Ga0307411_10022748
829 Ga0307411_10025745
830 Ga0307411_10033821
831 Ga0307411_10073486
832 Ga0307411_10573668
833 Ga0307411_11075309
834 Ga0307415_100013397
835 Ga0307415_100025272
836 Ga0307415_100051447
837 Ga0307415_100500218
838 Ga0307415_100524673
839 Ga0307415_100537046
840 Ga0373939_0113313
841 Ga0373946_0136015
842 Ga0373942_0058067
843 Ga0373931_0099769
844 Ga0373935_0003447
845 Ga0373925_1467676
846 Ga0395899_0191181
847 Ga0395900_0002834
848 Ga0395900_0019388
849 Ga0395900_0035288
850 Ga0395900_0084599
851 Ga0395900_0197330
852 Ga0395898_0021493
853 Ga0395898_1265494
854 Ga0395898_1431189
855 Ga0395905_0002771
856 Ga0395905_0014298
857 Ga0395905_0018665
858 Ga0395905_0034286
859 Ga0395905_0037795
860 Ga0395905_0078754
861 Ga0395905_0175602
862 Ga0395905_0362738
863 Ga0395905_0402479
864 Ga0395901_0002990
865 Ga0395901_0012364
866 Ga0395901_0012598
867 Ga0395901_0018225
868 Ga0395901_0063382
869 Ga0395901_0110459
870 Ga0395901_0406602
871 Ga0395901_0435874
872 Ga0395901_0677473
873 Ga0451835_0621127
874 Ga0439448_0031307
875 Ga0439448_0085704
876 Ga0439455_0023754
877 Ga0439462_0190905
878 Ga0439458_0000161
879 Ga0466963_1047243
880 Ga0466957_0907680
881 Ga0466960_0273168
882 Ga0466967_0102545
883 Ga0466967_0640682
884 Ga0495590_0213374
885 Ga0495598_0001383
886 Ga0495621_0000042
887 Ga0495621_0210854
888 Ga0495669_0329192
889 Ga0495670_0000672
890 Ga0496100_0163398
891 Ga0496101_1036062
892 Ga0496105_0827757
893 Ga0496107_0168298
894 Ga0496107_0401459
895 Ga0496108_0018205
896 Ga0496109_0829020
897 Ga0496109_1420688
898 Ga0496110_0466210
899 Ga0496111_0194370
900 Ga0496112_0649964
901 Ga0501071_0583281
902 Ga0501072_0723223
903 Ga0501074_0103481
904 Ga0501202_106566
905 Ga0501242_003019
906 Ga0501243_017097
907 Ga0501243_031217
908 Ga0501249_066921
909 Ga0501258_025890
910 Ga0501080_0047928
911 Ga0501270_055389
912 Ga0501204_065309
913 Ga0501212_126456
914 nmdc:mga08x19_1336084_c1
915 Ga0495655_0218481
916 Ga0500587_003422

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01124

MAPEG

MAPEG family

36

169

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wld-assembly1.cif.gz_S cryo-em structure of the human glycosylphosphatidylinositol transamidase complex at 2.53 angstrom resolution 0.6006 57 130
3dww-assembly1.cif.gz_B electron crystallographic structure of human microsomal prostaglandin e synthase 1 0.5996 5 145
3dww-assembly1.cif.gz_B electron crystallographic structure of human microsomal prostaglandin e synthase 1 0.5829 5 145
3dww-assembly1.cif.gz_C electron crystallographic structure of human microsomal prostaglandin e synthase 1 0.5753 6 145
3dww-assembly1.cif.gz_C electron crystallographic structure of human microsomal prostaglandin e synthase 1 0.5664 6 145
ID Description Score Start End Superfamily
af_F6P2J8_249_388_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7053 5 142 1.20.120.550
af_Q54BJ9_2_159_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6783 1 143 1.20.120.550
af_P10620_2_155_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6772 9 137 1.20.120.550
af_B0R1E9_1_152_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6718 9 143 1.20.120.550
af_Q54BJ9_2_159_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6662 1 143 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A6P1B7G6-F1-model_v4 deleted 0.9827 55 135
AF-A0A431J614-F1-model_v4 deleted 0.9737 3 122
AF-A0A2A2JYC2-F1-model_v4 MAPEG family protein 0.9717 3 143 GO:0016020
AF-A0A031HI83-F1-model_v4 MAPEG family protein 0.9713 1 139 GO:0016020
AF-A0A245ZEG1-F1-model_v4 MAPEG family protein 0.9674 5 139 GO:0016020

Map