metagRoot

F448068

General Info

Members	Datasets	Scaffolds	Average Seq Length
457	291	419	421

Family's Representative Sequence

Representative Sequence	3300048927\|Ga0496124_0079014\|Ga0496124_0079014_1026_2507
Length	493
Sequence	VEQLTCTEAVINRAEKAISLVVGWYAGMLQTTDVCNNAEAGGHFFIGRGIAFNSRNPSFVCLTIFLMKVVIVGGGFAGINLAKQLAGNSAIEVVLVDKNNYHFFPPLIYQVATSFIEASNISYPFRKMFQYKKNLRFHYGALLNIVAAESKIETTTGDVPYDRLVLALGTQTNYFGMQNVQQHALPMKTINDALDLRNHILQVLEKAALEHDAAEREKLLNIVIAGGGPTGVELAGMLAYMGKNIVAKDYPDVPDARRANIYLVDMLPVLLGPMSKKSQTEAYEVLTGMGVKVQLNQSVKDYVDGAVVFGDGSRIPTHSLIWTSGVIACEAPGLPKESVGRGRRLQVDAFNKVQGTEHIYAIGDVCVQTTDAAYPNGHPQLAQVAIQQGKLLAKNLQRELRHAPMEPFAYTDKGSMAIISKNKAVGDLPKNIFIRGFFAWLTWLFIHILPIAGFRNKLKLFNNWIVSFISNDPNLRLIIRPKNDWAAKGEEEA

Samples

	Sample ID	Description	Type	Environment
1	2511231000	Chryseobacterium populi CF314	Isolate	Rhizosphere
2	2522125168	Dyadobacter beijingensis DSM 21582	Isolate	Rhizosphere
3	2582581278	Chryseobacterium sp. CF365	Isolate	Rhizosphere
4	2582581281	Chryseobacterium sp. CF284	Isolate	Rhizosphere
5	2582581282	Chryseobacterium sp. CF299	Isolate	Rhizosphere
6	2585428045	Chryseobacterium sp. OV705	Isolate	Rhizosphere
7	2585428061	Chryseobacterium sp. CF356	Isolate	Rhizosphere
8	2585428182	Chryseobacterium sp. YR477	Isolate	Rhizosphere
9	2585428184	Chryseobacterium sp. YR480	Isolate	Rhizosphere
10	2585428187	Chryseobacterium sp. YR460	Isolate	Rhizosphere
11	2588254257	Chryseobacterium sp. YR203	Isolate	Rhizosphere
12	2728369107	Chryseobacterium kwangjuense KJ1R5	Isolate	Unclassified
13	2739367874	Chryseobacterium sp. T16E-39	Isolate	Unclassified
14	2751185877	Chryseobacterium artocarpi UTM-3	Isolate	Rhizosphere
15	2765235839	Chryseobacterium indologenes AA5	Isolate	Unclassified
16	2772190705	Chryseobacterium contaminans C-26	Isolate	Rhizosphere
17	2816332188	Chryseobacterium aquifrigidense 110 (version 2)	Isolate	Unclassified
18	2818991444	Filimonas endophytica 3197	Isolate	Unclassified
19	2842083920	Chryseobacterium lathyri KCTC 22544	Isolate	Rhizosphere
20	2842903701	Olivibacter sp. R-72191	Isolate	Unclassified
21	2871720351	Chryseobacterium sp. KLBC 52	Isolate	Nodule
22	2881955468	Edaphocola flava HME-24	Isolate	Rhizosphere
23	2889290771	Chryseobacterium sp. PvR013	Isolate	Rhizosphere
24	2896317667	Sphingobacterium sp. SGR-19	Isolate	Rhizosphere
25	2905999023	Chryseobacterium elymi KCTC 22547	Isolate	Rhizosphere
26	2929154850	Filimonas sp. R-72421 Hybrid assembly	Isolate	Unclassified
27	2929177148	Chitinophaga sp. R-72269 Hybrid assembly	Isolate	Unclassified
28	2945924605	Chryseobacterium ginsenosidimutans W1I9	Isolate	Rhizosphere
29	2945977869	Chitinophaga sp. W2I13	Isolate	Rhizosphere
30	2946013367	Chitinophaga sp. W3I9	Isolate	Rhizosphere
31	2946019816	Chryseobacterium sp. W4I1	Isolate	Rhizosphere
32	2977243572	Chryseobacterium sp. SORGH_AS 447	Isolate	Unclassified
33	2984572630	Chryseobacterium sp. SORGH_AS909	Isolate	Aerial Root
34	2984606641	Chryseobacterium sp. SORGH_AS1175	Isolate	Aerial Root
35	2993480792	Chryseobacterium nepalense SLBN-92	Isolate	Rhizosphere
36	3003233435	Sphingobacterium shayense CrR18	Isolate	Unclassified
37	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
38	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
39	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
40	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
41	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
42	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
43	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
44	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
45	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
46	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
47	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
48	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
49	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
50	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
51	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
52	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
53	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
54	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
55	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
56	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
57	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
58	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
59	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
60	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
61	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
62	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
63	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
64	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
65	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
66	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
67	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
68	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
69	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
70	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
71	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
72	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
73	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
74	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
75	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
76	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
77	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
78	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
79	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
80	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
81	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
82	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
83	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
84	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
85	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
86	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
87	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
88	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
89	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
90	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
91	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
92	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
93	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
94	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
95	3300006942	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW	Metagenome	Nodule
96	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
97	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
98	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
99	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
100	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
101	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
102	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
103	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
104	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
105	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
106	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
107	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
108	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
109	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
110	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
111	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
112	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
113	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
114	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
115	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
116	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
117	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
118	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
119	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
120	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
121	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
122	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
123	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
124	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
125	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
158	3300027361	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2)	Metagenome	Nodule
159	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
160	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
162	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
163	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
164	3300030731	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3	Metagenome	Rhizosphere
165	3300030732	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1	Metagenome	Rhizosphere
166	3300030742	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9	Metagenome	Rhizosphere
167	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
168	3300030745	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8	Metagenome	Rhizosphere
169	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
170	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
171	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
172	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
173	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
174	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
175	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
176	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
177	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
178	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
179	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
180	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
181	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
182	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
183	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
184	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
185	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
186	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
187	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
188	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
189	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
190	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
191	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
192	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
193	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
194	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
195	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
196	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
197	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
198	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
199	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
200	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
201	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
202	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
203	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
204	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
205	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
206	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
207	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
208	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
209	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
210	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
211	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
212	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
213	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
214	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
215	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
216	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
217	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
218	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
219	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
220	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
221	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
222	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
223	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
224	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
225	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
226	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
227	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
228	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
229	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
230	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
231	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
232	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
233	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
234	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
235	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
236	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
237	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
238	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
239	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
240	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
241	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
242	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
243	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
244	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
245	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
246	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
247	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
248	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
249	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
250	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
251	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
252	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
253	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
254	3300049523	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control	Metagenome	Rhizosphere
255	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
256	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
257	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
258	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
259	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
260	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
261	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
262	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
263	3300049661	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control	Metagenome	Rhizosphere
264	3300049671	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought	Metagenome	Rhizosphere
265	3300049679	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought	Metagenome	Rhizosphere
266	3300049686	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control	Metagenome	Rhizosphere
267	3300049703	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control	Metagenome	Rhizosphere
268	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
269	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
270	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
271	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
272	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
273	3300049758	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought	Metagenome	Rhizosphere
274	3300049761	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control	Metagenome	Rhizosphere
275	3300049763	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control	Metagenome	Rhizosphere
276	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
277	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
278	3300050005	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought	Metagenome	Rhizosphere
279	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
280	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
281	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
282	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
283	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
284	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
285	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
286	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
287	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
288	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
289	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
290	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
291	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	91.47
Metatranscriptomes	0.22
Isolates	8.32

Biome Distribution

Category	Percentage (%)
Aerial Root	0.44
Bulb	0
Endosphere	3.5
Nodule	1.09
Rhizoplane	0.66
Rhizosphere	83.59
Stem	0
Stem Tuber	0
Unclassified	10.72

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25162J39368_1000005	3300002737	Bacteria	435925
2	JGI25406J46586_10030426	3300003203	Unclassified	2032
3	rootH1_10071545	3300003316	Unclassified	4250
4	rootH2_10001891	3300003320	Bacteria	464318
5	rootH2_10043772	3300003320	Bacteria	2127
6	rootL2_10060107	3300003322	Bacteria	7258
7	rootL2_10065114	3300003322	Bacteria	10258
8	rootL2_10284751	3300003322	Bacteria	2291
9	rootL2_10367446	3300003322	Bacteria	1639
10	rootH1_10021842	3300003323	Bacteria	49730
11	rootH1_10108082	3300003323	Bacteria	8341
12	rootH1_10186396	3300003323	Bacteria	2085
13	rootH1_10253110	3300003323	Bacteria	2345
14	rootH1_10307374	3300003323	Bacteria	2181
15	JGI25160J50197_1000376	3300003354	Bacteria	29172
16	Ga0006562J51391_1018829	3300003578	Bacteria	1306
17	Ga0055536_1007819	3300003781	Bacteria	4716
18	Ga0065165_1000145	3300005262	Bacteria	123255
19	Ga0065714_10065832	3300005288	Bacteria	8344
20	Ga0065714_10066911	3300005288	Bacteria	6110
21	Ga0065714_10067184	3300005288	Bacteria	5802
22	Ga0065712_10006089	3300005290	Bacteria	4213
23	Ga0070658_10011805	3300005327	Bacteria	7010
24	Ga0070658_10046286	3300005327	Bacteria	3520
25	Ga0070658_10268090	3300005327	Unclassified	1451
26	Ga0070683_100055678	3300005329	Bacteria	3671
27	Ga0068869_100005145	3300005334	Bacteria	8204
28	Ga0070680_100048351	3300005336	Bacteria	3466
29	Ga0070682_100002913	3300005337	Bacteria	9493
30	Ga0068868_100025310	3300005338	Bacteria	4513
31	Ga0070660_100006247	3300005339	Bacteria	8249
32	Ga0070660_100062303	3300005339	Bacteria	2897
33	Ga0070689_100186538	3300005340	Bacteria	1687
34	Ga0070661_100130179	3300005344	Bacteria	1889
35	Ga0070668_100008443	3300005347	Bacteria	7648
36	Ga0070669_100008614	3300005353	Bacteria	7277
37	Ga0070669_100028225	3300005353	Bacteria	4041
38	Ga0070675_100002058	3300005354	Bacteria	14910
39	Ga0070675_100190142	3300005354	Unclassified	1778
40	Ga0070673_100021860	3300005364	Bacteria	4648
41	Ga0070688_100026789	3300005365	Unclassified	3428
42	Ga0070659_100015428	3300005366	Bacteria	5722
43	Ga0070659_100076996	3300005366	Bacteria	2659
44	Ga0070709_10007631	3300005434	Bacteria	5936
45	Ga0070714_100011414	3300005435	Bacteria	7047
46	Ga0070713_100000251	3300005436	Bacteria	35250
47	Ga0070713_100007891	3300005436	Bacteria	7511
48	Ga0070711_100058165	3300005439	Bacteria	2679
49	Ga0070708_100033733	3300005445	Bacteria	4448
50	Ga0070681_10087036	3300005458	Bacteria	3077
51	Ga0068867_100033309	3300005459	Bacteria	3730
52	Ga0070685_10118628	3300005466	Unclassified	1640
53	Ga0070698_100123006	3300005471	Unclassified	2553
54	Ga0070679_100003446	3300005530	Bacteria	14482
55	Ga0070684_100127625	3300005535	Bacteria	2292
56	Ga0068853_100229627	3300005539	Bacteria	1697
57	Ga0068853_100471915	3300005539	Bacteria	1182
58	Ga0070693_100024173	3300005547	Bacteria	3255
59	Ga0068855_100006274	3300005563	Bacteria	14489
60	Ga0068855_100023805	3300005563	Bacteria	7336
61	Ga0068855_100124110	3300005563	Bacteria	2954
62	Ga0068855_100374684	3300005563	Unclassified	1564
63	Ga0070664_100048964	3300005564	Bacteria	3573
64	Ga0068857_100005970	3300005577	Bacteria	10405
65	Ga0068857_100026557	3300005577	Bacteria	5104
66	Ga0068857_100035653	3300005577	Bacteria	4406
67	Ga0068857_100114550	3300005577	Bacteria	2425
68	Ga0068854_100098702	3300005578	Unclassified	2186
69	Ga0068856_100049618	3300005614	Bacteria	4137
70	Ga0068859_100090081	3300005617	Bacteria	3118
71	Ga0068864_100012517	3300005618	Bacteria	7016
72	Ga0068864_100170308	3300005618	Bacteria	1985
73	Ga0068861_100009873	3300005719	Bacteria	6604
74	Ga0068861_100080620	3300005719	Unclassified	2546
75	Ga0068870_10044802	3300005840	Bacteria	2313
76	Ga0068870_10062730	3300005840	Unclassified	2003
77	Ga0068858_100143647	3300005842	Bacteria	2241
78	Ga0068862_100027839	3300005844	Bacteria	4760
79	Ga0068862_100047367	3300005844	Bacteria	3668
80	Ga0081539_10003431	3300005985	Bacteria	19492
81	Ga0070717_10000372	3300006028	Bacteria	28578
82	Ga0070712_100010977	3300006175	Bacteria	5732
83	Ga0070712_100052145	3300006175	Bacteria	2852
84	Ga0075430_100004129	3300006846	Bacteria	12254
85	Ga0075431_100074491	3300006847	Bacteria	3503
86	Ga0075431_100147249	3300006847	Unclassified	2426
87	Ga0075429_100073353	3300006880	Bacteria	2981
88	Ga0097620_100090080	3300006931	Bacteria	3118
89	Ga0099824_1000204	3300006942	Bacteria	57939
90	Ga0079104_1001587	3300006946	Bacteria	14842
91	Ga0105244_10000058	3300009036	Bacteria	128877
92	Ga0105244_10000063	3300009036	Bacteria	122746
93	Ga0105240_10007171	3300009093	Bacteria	16232
94	Ga0105240_10243132	3300009093	Bacteria	2085
95	Ga0111539_10030967	3300009094	Bacteria	6500
96	Ga0111539_10062482	3300009094	Bacteria	4408
97	Ga0105241_10009442	3300009174	Bacteria	7164
98	Ga0105237_10000013	3300009545	Bacteria	297699
99	Ga0105237_10013166	3300009545	Bacteria	8678
100	Ga0105237_10058142	3300009545	Bacteria	3870
101	Ga0105238_10070407	3300009551	Bacteria	3497
102	Ga0105238_10204634	3300009551	Bacteria	1950
103	Ga0105249_10000075	3300009553	Bacteria	145150
104	Ga0105249_10004262	3300009553	Bacteria	12360
105	Ga0105239_10000609	3300010375	Bacteria	50949
106	Ga0105239_10004531	3300010375	Bacteria	16569
107	Ga0157373_10000002	3300013100	Bacteria	750094
108	Ga0157373_10000009	3300013100	Bacteria	201551
109	Ga0157373_10003582	3300013100	Bacteria	11731
110	Ga0157373_10004753	3300013100	Bacteria	10222
111	Ga0157373_10019316	3300013100	Bacteria	4963
112	Ga0157371_10001101	3300013102	Bacteria	29303
113	Ga0157371_10001777	3300013102	Bacteria	21790
114	Ga0157371_10003314	3300013102	Bacteria	14722
115	Ga0157371_10004025	3300013102	Bacteria	13006
116	Ga0157371_10006532	3300013102	Bacteria	9594
117	Ga0157371_10022641	3300013102	Bacteria	4599
118	Ga0157371_10056291	3300013102	Bacteria	2789
119	Ga0157371_10074445	3300013102	Bacteria	2405
120	Ga0157371_10148722	3300013102	Bacteria	1670
121	Ga0157370_10001332	3300013104	Bacteria	30666
122	Ga0157370_10001649	3300013104	Bacteria	27558
123	Ga0157370_10001675	3300013104	Bacteria	27295
124	Ga0157370_10002569	3300013104	Bacteria	21784
125	Ga0157370_10006311	3300013104	Bacteria	13099
126	Ga0157370_10025287	3300013104	Bacteria	5877
127	Ga0157370_10033912	3300013104	Bacteria	4975
128	Ga0157370_10056755	3300013104	Bacteria	3726
129	Ga0157370_10059434	3300013104	Bacteria	3633
130	Ga0157370_10066143	3300013104	Bacteria	3419
131	Ga0157370_10123902	3300013104	Bacteria	2413
132	Ga0157370_10132413	3300013104	Bacteria	2325
133	Ga0157369_10007435	3300013105	Bacteria	12615
134	Ga0157369_10015073	3300013105	Bacteria	8726
135	Ga0157369_10042118	3300013105	Bacteria	4982
136	Ga0157369_10131945	3300013105	Bacteria	2646
137	Ga0157374_10000455	3300013296	Bacteria	37317
138	Ga0163162_10000608	3300013306	Bacteria	33219
139	Ga0163162_10005346	3300013306	Bacteria	12396
140	Ga0163162_10108329	3300013306	Bacteria	2874
141	Ga0163162_10245132	3300013306	Bacteria	1923
142	Ga0157372_10010829	3300013307	Bacteria	9709
143	Ga0157372_10021372	3300013307	Bacteria	6992
144	Ga0157372_10140291	3300013307	Bacteria	2784
145	Ga0157372_10181653	3300013307	Bacteria	2435
146	Ga0157375_10000313	3300013308	Bacteria	43467
147	Ga0157375_10000695	3300013308	Bacteria	29734
148	Ga0163163_10000075	3300014325	Bacteria	109545
149	Ga0157380_10036583	3300014326	Bacteria	3799
150	Ga0157380_10162269	3300014326	Bacteria	1944
151	Ga0182008_10000028	3300014497	Bacteria	176968
152	Ga0157377_10008865	3300014745	Bacteria	4920
153	Ga0157376_10020537	3300014969	Bacteria	5111
154	Ga0182006_1000016	3300015261	Bacteria	303558
155	Ga0182006_1001059	3300015261	Bacteria	17747
156	Ga0163161_10000271	3300017792	Bacteria	45502
157	Ga0163161_10004631	3300017792	Bacteria	9571
158	Ga0163161_10004844	3300017792	Bacteria	9376
159	Ga0163161_10006744	3300017792	Bacteria	7936
160	Ga0213876_10006242	3300021384	Bacteria	6502
161	Ga0209437_100043	3300025233	Bacteria	440454
162	Ga0209675_1000033	3300025291	Bacteria	271576
163	Ga0209676_1000740	3300025292	Bacteria	44339
164	Ga0209050_1001111	3300025298	Bacteria	32578
165	Ga0207655_1000608	3300025728	Bacteria	43328
166	Ga0207655_1000693	3300025728	Bacteria	39160
167	Ga0207647_10109973	3300025904	Bacteria	1629
168	Ga0207699_10032782	3300025906	Bacteria	2930
169	Ga0207643_10002082	3300025908	Bacteria	11021
170	Ga0207705_10072796	3300025909	Bacteria	2493
171	Ga0207705_10110631	3300025909	Bacteria	2029
172	Ga0207654_10115405	3300025911	Unclassified	1678
173	Ga0207707_10002978	3300025912	Bacteria	15071
174	Ga0207671_10000024	3300025914	Bacteria	274628
175	Ga0207671_10078377	3300025914	Bacteria	2474
176	Ga0207693_10034486	3300025915	Bacteria	3991
177	Ga0207693_10038724	3300025915	Bacteria	3753
178	Ga0207660_10038298	3300025917	Bacteria	3346
179	Ga0207660_10072155	3300025917	Bacteria	2514
180	Ga0207657_10034674	3300025919	Bacteria	4535
181	Ga0207652_10000159	3300025921	Bacteria	73101
182	Ga0207652_10000166	3300025921	Bacteria	71226
183	Ga0207681_10003233	3300025923	Bacteria	10219
184	Ga0207694_10019653	3300025924	Bacteria	5110
185	Ga0207659_10005720	3300025926	Bacteria	7570
186	Ga0207659_10117012	3300025926	Unclassified	2036
187	Ga0207700_10010772	3300025928	Bacteria	5795
188	Ga0207664_10008816	3300025929	Bacteria	7054
189	Ga0207690_10012516	3300025932	Bacteria	5077
190	Ga0207690_10201411	3300025932	Unclassified	1512
191	Ga0207706_10032766	3300025933	Bacteria	4625
192	Ga0207689_10143615	3300025942	Unclassified	1966
193	Ga0207661_10044898	3300025944	Bacteria	3495
194	Ga0207667_10024111	3300025949	Bacteria	6686
195	Ga0207667_10043720	3300025949	Bacteria	4752
196	Ga0207667_10151225	3300025949	Bacteria	2389
197	Ga0207651_10041289	3300025960	Unclassified	3061
198	Ga0207712_10004795	3300025961	Bacteria	8545
199	Ga0207668_10057030	3300025972	Bacteria	2723
200	Ga0207703_10265299	3300026035	Bacteria	1553
201	Ga0207678_10022022	3300026067	Bacteria	5585
202	Ga0207678_10269642	3300026067	Bacteria	1460
203	Ga0207678_10273004	3300026067	Bacteria	1450
204	Ga0207708_10124038	3300026075	Unclassified	2015
205	Ga0207708_10178021	3300026075	Bacteria	1687
206	Ga0207702_10064532	3300026078	Bacteria	3134
207	Ga0207702_10087810	3300026078	Bacteria	2716
208	Ga0207702_10180479	3300026078	Unclassified	1944
209	Ga0207676_10008113	3300026095	Bacteria	7464
210	Ga0207674_10020855	3300026116	Bacteria	7071
211	Ga0207674_10040160	3300026116	Bacteria	4849
212	Ga0207674_10052505	3300026116	Bacteria	4157
213	Ga0207674_10066598	3300026116	Bacteria	3627
214	Ga0207675_100000597	3300026118	Bacteria	35284
215	Ga0207675_100021734	3300026118	Bacteria	5972
216	Ga0209281_1000244	3300027111	Bacteria	109979
217	Ga0209489_120529	3300027361	Bacteria	1875
218	Ga0207428_10034442	3300027907	Bacteria	4149
219	Ga0268265_10012717	3300028380	Bacteria	5711
220	Ga0268265_10013596	3300028380	Bacteria	5534
221	Ga0307517_10015766	3300028786	Bacteria	10008
222	Ga0307515_10000174	3300028794	Bacteria	157501
223	Ga0307511_10001867	3300030521	Bacteria	22132
224	Ga0316177_1134237	3300030731	Bacteria	18489
225	Ga0316176_1057051	3300030732	Bacteria	34395
226	Ga0316176_1179773	3300030732	Bacteria	7963
227	Ga0316183_1093843	3300030742	Bacteria	22860
228	Ga0316183_1116825	3300030742	Bacteria	56435
229	Ga0316181_1082642	3300030744	Bacteria	18700
230	Ga0316181_1214641	3300030744	Bacteria	2619
231	Ga0316182_1070171	3300030745	Bacteria	1996
232	Ga0265320_10053188	3300031240	Bacteria	1958
233	Ga0265339_10011914	3300031249	Bacteria	5330
234	Ga0265331_10044102	3300031250	Bacteria	2158
235	Ga0265316_10022745	3300031344	Bacteria	5277
236	Ga0265314_10032332	3300031711	Bacteria	3849
237	Ga0307405_10000392	3300031731	Bacteria	16393
238	Ga0307410_10000067	3300031852	Bacteria	37092
239	Ga0307410_10226129	3300031852	Bacteria	1442
240	Ga0307406_10000035	3300031901	Bacteria	82953
241	Ga0307406_10079708	3300031901	Bacteria	2172
242	Ga0307412_10000022	3300031911	Bacteria	241533
243	Ga0307412_10000451	3300031911	Bacteria	24824
244	Ga0307412_10048565	3300031911	Bacteria	2792
245	Ga0307412_10055509	3300031911	Bacteria	2635
246	Ga0307416_100000003	3300032002	Bacteria	509060
247	Ga0307416_100019284	3300032002	Bacteria	4831
248	Ga0307414_10000009	3300032004	Bacteria	359782
249	Ga0307414_10000063	3300032004	Bacteria	107710
250	Ga0307414_10008875	3300032004	Bacteria	5738
251	Ga0307414_10160240	3300032004	Unclassified	1786
252	Ga0307414_10236852	3300032004	Bacteria	1508
253	Ga0307411_10000001	3300032005	Bacteria	931810
254	Ga0307415_100051098	3300032126	Bacteria	2804
255	Ga0373926_0039099	3300035083	Bacteria	1690
256	Ga0373934_0033676	3300035086	Bacteria	2011
257	Ga0373944_0007642	3300035089	Bacteria	2902
258	Ga0373956_0001589	3300035119	Bacteria	9360
259	Ga0373957_0009427	3300035120	Bacteria	3194
260	Ga0373943_0007820	3300035170	Bacteria	4802
261	Ga0373955_0008426	3300035172	Bacteria	4788
262	Ga0373935_0004478	3300035692	Bacteria	8204
263	Ga0373937_0006520	3300036401	Bacteria	10076
264	Ga0373925_0009242	3300037068	Bacteria	7176
265	Ga0373925_0102394	3300037068	Bacteria	2203
266	Ga0395899_0001157	3300037312	Bacteria	23307
267	Ga0395899_0049940	3300037312	Bacteria	3107
268	Ga0395899_0052558	3300037312	Bacteria	3019
269	Ga0395900_0001840	3300037418	Bacteria	24172
270	Ga0395900_0006015	3300037418	Bacteria	12653
271	Ga0395900_0032537	3300037418	Bacteria	5363
272	Ga0395900_0051603	3300037418	Bacteria	4236
273	Ga0395900_0100672	3300037418	Bacteria	2968
274	Ga0395900_0132808	3300037418	Bacteria	2550
275	Ga0395900_0232798	3300037418	Bacteria	1852
276	Ga0395898_0000480	3300037466	Bacteria	79611
277	Ga0395898_0002406	3300037466	Bacteria	22205
278	Ga0395898_0114401	3300037466	Bacteria	2585
279	Ga0395905_0003208	3300037471	Bacteria	17617
280	Ga0395905_0014981	3300037471	Bacteria	7394
281	Ga0395905_0087706	3300037471	Bacteria	2917
282	Ga0395901_0005715	3300038443	Bacteria	12593
283	Ga0395901_0011060	3300038443	Bacteria	9145
284	Ga0395901_0020996	3300038443	Bacteria	6689
285	Ga0395901_0161484	3300038443	Bacteria	2353
286	Ga0395901_0334346	3300038443	Bacteria	1565
287	Ga0395901_0397495	3300038443	Bacteria	1416
288	Ga0436365_0301783	3300039437	Bacteria	10292
289	Ga0439466_0006343	3300041411	Bacteria	4501
290	Ga0439445_0000328	3300042004	Bacteria	9260
291	Ga0451577_0000001	3300042876	Bacteria	2461803
292	Ga0466969_0000629	3300044656	Bacteria	19111
293	Ga0466959_0000236	3300045049	Bacteria	34631
294	Ga0466959_0012697	3300045049	Bacteria	6093
295	Ga0466967_0031358	3300045976	Bacteria	4474
296	Ga0495627_000002	3300046453	Bacteria	903861
297	Ga0495592_0060396	3300046454	Bacteria	2788
298	Ga0495592_0100927	3300046454	Bacteria	2057
299	Ga0495603_0000875	3300046455	Bacteria	17301
300	Ga0495629_0004622	3300046459	Bacteria	10309
301	Ga0495629_0079396	3300046459	Bacteria	2291
302	Ga0495629_0083977	3300046459	Bacteria	2222
303	Ga0495638_0000005	3300046460	Bacteria	680627
304	Ga0495651_0010749	3300046462	Bacteria	7038
305	Ga0495653_0014535	3300046463	Bacteria	6424
306	Ga0495653_0015654	3300046463	Bacteria	6182
307	Ga0495580_0002790	3300046472	Bacteria	15025
308	Ga0495582_0000646	3300046473	Bacteria	19156
309	Ga0495639_0000028	3300046475	Bacteria	67975
310	Ga0495639_0009164	3300046475	Bacteria	4243
311	Ga0495664_0007645	3300046477	Bacteria	6009
312	Ga0495606_0019712	3300046507	Bacteria	5003
313	Ga0495606_0021092	3300046507	Bacteria	4779
314	Ga0495610_0000009	3300046512	Bacteria	554843
315	Ga0495628_0071858	3300046516	Bacteria	2697
316	Ga0495628_0104270	3300046516	Bacteria	2185
317	Ga0495630_0000452	3300046517	Bacteria	31051
318	Ga0495643_0057029	3300046522	Bacteria	2083
319	Ga0495652_0043188	3300046529	Bacteria	3884
320	Ga0495654_0000001	3300046530	Bacteria	1513197
321	Ga0495665_0001779	3300046531	Bacteria	11591
322	Ga0495609_0004547	3300046538	Bacteria	7540
323	Ga0495645_0008059	3300046543	Bacteria	7339
324	Ga0495645_0023980	3300046543	Bacteria	4422
325	Ga0495633_0001799	3300046558	Bacteria	15821
326	Ga0495667_0009250	3300046559	Bacteria	6682
327	Ga0495667_0012355	3300046559	Bacteria	5788
328	Ga0495668_0000639	3300046616	Bacteria	42159
329	Ga0495668_0007378	3300046616	Bacteria	7039
330	Ga0495634_0014442	3300046642	Bacteria	5694
331	Ga0495588_0000686	3300046674	Bacteria	15594
332	Ga0495599_0006014	3300046678	Bacteria	7303
333	Ga0495623_0022183	3300046679	Bacteria	4101
334	Ga0495623_0037498	3300046679	Bacteria	3101
335	Ga0495658_0000525	3300046683	Bacteria	20888
336	Ga0495613_0089041	3300046689	Bacteria	2236
337	Ga0495613_0096782	3300046689	Bacteria	2134
338	Ga0495600_0069346	3300046809	Unclassified	2304
339	Ga0495581_0000676	3300047315	Bacteria	17862
340	Ga0495581_0034750	3300047315	Bacteria	2917
341	Ga0495604_0006639	3300047317	Bacteria	9170
342	Ga0495604_0023554	3300047317	Bacteria	4912
343	Ga0495674_0039053	3300047319	Bacteria	4256
344	Ga0495674_0081033	3300047319	Bacteria	2785
345	Ga0495686_0000086	3300047472	Bacteria	197490
346	Ga0495686_0001041	3300047472	Bacteria	33277
347	Ga0495686_0011234	3300047472	Bacteria	6315
348	Ga0495593_0000015	3300047673	Bacteria	80492
349	Ga0495602_0044348	3300048088	Bacteria	4035
350	Ga0495614_0001287	3300048089	Bacteria	10804
351	Ga0496102_0007635	3300048905	Bacteria	9243
352	Ga0496113_0033785	3300048916	Bacteria	3727
353	Ga0496114_0000437	3300048917	Bacteria	30764
354	Ga0496116_0000032	3300048919	Bacteria	419997
355	Ga0496116_0000053	3300048919	Bacteria	291837
356	Ga0496117_0000089	3300048920	Bacteria	210551
357	Ga0496118_0000221	3300048921	Bacteria	99682
358	Ga0496118_0109301	3300048921	Bacteria	1841
359	Ga0496119_0000038	3300048922	Bacteria	209546
360	Ga0496122_0000465	3300048925	Bacteria	84396
361	Ga0496122_0000700	3300048925	Bacteria	66410
362	Ga0496122_0002035	3300048925	Bacteria	30015
363	Ga0496122_0020942	3300048925	Bacteria	5876
364	Ga0496123_0000930	3300048926	Bacteria	45779
365	Ga0496123_0006125	3300048926	Bacteria	11794
366	Ga0496124_0001049	3300048927	Bacteria	43602
367	Ga0496124_0014102	3300048927	Bacteria	7748
368	Ga0496124_0079014	3300048927	Bacteria	2710
369	Ga0496125_0000059	3300048928	Bacteria	264149
370	Ga0496125_0000547	3300048928	Bacteria	64865
371	Ga0496125_0017073	3300048928	Bacteria	6935
372	Ga0496126_0135247	3300048929	Bacteria	2127
373	Ga0496126_0156224	3300048929	Bacteria	1952
374	Ga0501300_005309	3300049523	Bacteria	1902
375	Ga0501033_0083716	3300049570	Unclassified	2338
376	Ga0501034_0046485	3300049571	Bacteria	4385
377	Ga0501034_0059935	3300049571	Unclassified	3823
378	Ga0501037_0038929	3300049573	Unclassified	3502
379	Ga0501047_0121072	3300049581	Bacteria	2499
380	Ga0501070_0117991	3300049586	Unclassified	2192
381	Ga0501071_0204287	3300049587	Unclassified	1485
382	Ga0501073_0039574	3300049589	Unclassified	3339
383	Ga0501076_0253477	3300049592	Bacteria	1440
384	Ga0501217_008812	3300049661	Bacteria	2186
385	Ga0501238_000571	3300049671	Bacteria	4227
386	Ga0501249_000009	3300049679	Bacteria	173938
387	Ga0501249_001009	3300049679	Bacteria	6048
388	Ga0501257_014364	3300049686	Bacteria	1820
389	Ga0501219_000364	3300049703	Bacteria	7608
390	Ga0501225_0025872	3300049705	Bacteria	1614
391	Ga0501079_0091867	3300049741	Bacteria	2352
392	Ga0501080_0083336	3300049742	Bacteria	2970
393	Ga0501081_0044054	3300049743	Bacteria	3062
394	Ga0501083_0006687	3300049744	Bacteria	8179
395	Ga0501241_000019	3300049758	Bacteria	88612
396	Ga0501264_000151	3300049761	Bacteria	11113
397	Ga0501266_000039	3300049763	Bacteria	26126
398	Ga0501035_0088175	3300049822	Unclassified	2734
399	Ga0501035_0139711	3300049822	Bacteria	2107
400	Ga0501044_0051861	3300049823	Bacteria	4230
401	Ga0501044_0227505	3300049823	Unclassified	1814
402	Ga0501284_00013	3300050005	Bacteria	115944
403	nmdc:mga09592_11461_c1	3300050508	Bacteria	7213
404	nmdc:mga09592_1424_c1	3300050508	Bacteria	19204
405	nmdc:mga0qj67_19054_c1	3300050509	Bacteria	5239
406	nmdc:mga0qj67_25885_c1	3300050509	Bacteria	4538
407	nmdc:mga06r32_64932_c1	3300050510	Bacteria	3520
408	nmdc:mga08y16_18443_c1	3300050511	Bacteria	7353
409	Ga0495601_0063401	3300053077	Bacteria	2349
410	Ga0495595_0057572	3300053084	Bacteria	1813
411	Ga0500646_0000495	3300053090	Bacteria	11533
412	Ga0500641_0000019	3300053096	Bacteria	123198
413	Ga0500641_0000554	3300053096	Bacteria	13497
414	Ga0500658_0000003	3300053134	Bacteria	512506
415	Ga0500568_0002111	3300053139	Bacteria	12003
416	Ga0500616_0000003	3300053153	Bacteria	1220687
417	Ga0500622_0000640	3300053156	Bacteria	31322
418	Ga0500622_0000986	3300053156	Bacteria	24174
419	Ga0501082_0280538	3300060353	Unclassified	1450

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300005539	Ga0068853_100471915	Ga0068853_1004719151	344
2	3300013104	Ga0157370_10066143	Ga0157370_100661433	354
3	3300049686	Ga0501257_014364	Ga0501257_014364_441_1547	354
4	3300049822	Ga0501035_0139711	Ga0501035_0139711_55_1134	354
5	3300049592	Ga0501076_0253477	Ga0501076_0253477_298_1419	356
6	3300049523	Ga0501300_005309	Ga0501300_005309_684_1859	369
7	3300005466	Ga0070685_10118628	Ga0070685_101186281	385
8	3300006846	Ga0075430_100004129	Ga0075430_10000412910	385
9	3300050509	nmdc:mga0qj67_25885_c1	nmdc:mga0qj67_25885_c1_2053_3384	385
10	3300009545	Ga0105237_10058142	Ga0105237_100581421	387
11	3300025914	Ga0207671_10078377	Ga0207671_100783771	387
12	3300038443	Ga0395901_0397495	Ga0395901_0397495_212_1390	387
13	iso_pu_bacteria	2945977869	2945978442	388
14	3300006847	Ga0075431_100074491	Ga0075431_1000744913	394
15	3300050510	nmdc:mga06r32_64932_c1	nmdc:mga06r32_64932_c1_212_1537	394
16	3300009094	Ga0111539_10030967	Ga0111539_100309675	395
17	3300009553	Ga0105249_10000075	Ga0105249_100000753	395
18	3300014326	Ga0157380_10162269	Ga0157380_101622691	395
19	3300049741	Ga0501079_0091867	Ga0501079_0091867_647_1888	396
20	3300049743	Ga0501081_0044054	Ga0501081_0044054_622_1863	396
21	3300028786	Ga0307517_10015766	Ga0307517_100157663	397
22	3300031911	Ga0307412_10000022	Ga0307412_1000002282	398
23	3300032002	Ga0307416_100000003	Ga0307416_100000003389	398
24	3300005471	Ga0070698_100123006	Ga0070698_1001230061	399
25	3300005340	Ga0070689_100186538	Ga0070689_1001865381	400
26	3300031249	Ga0265339_10011914	Ga0265339_100119143	400
27	3300031344	Ga0265316_10022745	Ga0265316_100227454	400
28	3300009093	Ga0105240_10243132	Ga0105240_102431322	401
29	3300009551	Ga0105238_10204634	Ga0105238_102046342	401
30	3300013307	Ga0157372_10010829	Ga0157372_100108292	401
31	3300017792	Ga0163161_10000271	Ga0163161_100002711	401
32	3300025924	Ga0207694_10019653	Ga0207694_100196534	401
33	3300035086	Ga0373934_0033676	Ga0373934_0033676_651_1889	401
34	3300035120	Ga0373957_0009427	Ga0373957_0009427_117_1355	401
35	3300036401	Ga0373937_0006520	Ga0373937_0006520_4793_6031	401
36	3300037068	Ga0373925_0102394	Ga0373925_0102394_585_1823	401
37	3300046454	Ga0495592_0100927	Ga0495592_0100927_559_1797	401
38	3300046459	Ga0495629_0083977	Ga0495629_0083977_30_1268	401
39	3300046462	Ga0495651_0010749	Ga0495651_0010749_969_2207	401
40	3300046463	Ga0495653_0015654	Ga0495653_0015654_2453_3691	401
41	3300046472	Ga0495580_0002790	Ga0495580_0002790_10109_11347	401
42	3300046475	Ga0495639_0009164	Ga0495639_0009164_2804_4042	401
43	3300046477	Ga0495664_0007645	Ga0495664_0007645_1082_2320	401
44	3300046516	Ga0495628_0071858	Ga0495628_0071858_1012_2250	401
45	3300046529	Ga0495652_0043188	Ga0495652_0043188_1136_2374	401
46	3300046543	Ga0495645_0023980	Ga0495645_0023980_195_1433	401
47	3300046559	Ga0495667_0009250	Ga0495667_0009250_1839_3077	401
48	3300046642	Ga0495634_0014442	Ga0495634_0014442_2050_3288	401
49	3300046679	Ga0495623_0022183	Ga0495623_0022183_2586_3824	401
50	3300046689	Ga0495613_0089041	Ga0495613_0089041_205_1443	401
51	3300047315	Ga0495581_0034750	Ga0495581_0034750_1447_2685	401
52	3300047317	Ga0495604_0023554	Ga0495604_0023554_812_2050	401
53	3300047319	Ga0495674_0039053	Ga0495674_0039053_668_1906	401
54	3300053077	Ga0495601_0063401	Ga0495601_0063401_93_1331	401
55	3300053084	Ga0495595_0057572	Ga0495595_0057572_286_1524	401
56	3300003578	Ga0006562J51391_1018829	Ga0006562J51391_10188291	402
57	3300005288	Ga0065714_10065832	Ga0065714_100658324	402
58	3300005288	Ga0065714_10066911	Ga0065714_100669113	402
59	3300006942	Ga0099824_1000204	Ga0099824_100020444	402
60	3300006946	Ga0079104_1001587	Ga0079104_100158714	402
61	3300009036	Ga0105244_10000063	Ga0105244_1000006362	402
62	3300013100	Ga0157373_10000002	Ga0157373_10000002549	402
63	3300013102	Ga0157371_10022641	Ga0157371_100226413	402
64	3300013104	Ga0157370_10001332	Ga0157370_1000133216	402
65	3300013104	Ga0157370_10002569	Ga0157370_100025697	402
66	3300013104	Ga0157370_10025287	Ga0157370_100252872	402
67	3300013104	Ga0157370_10033912	Ga0157370_100339123	402
68	3300013105	Ga0157369_10015073	Ga0157369_100150737	402
69	3300015261	Ga0182006_1000016	Ga0182006_100001649	402
70	3300015261	Ga0182006_1001059	Ga0182006_100105917	402
71	3300025728	Ga0207655_1000608	Ga0207655_100060828	402
72	3300027111	Ga0209281_1000244	Ga0209281_100024496	402
73	3300027361	Ga0209489_120529	Ga0209489_1205292	402
74	3300031852	Ga0307410_10000067	Ga0307410_1000006731	402
75	3300031901	Ga0307406_10000035	Ga0307406_1000003571	402
76	3300031911	Ga0307412_10055509	Ga0307412_100555091	402
77	3300032004	Ga0307414_10000063	Ga0307414_1000006358	402
78	3300032004	Ga0307414_10008875	Ga0307414_100088753	402
79	3300032005	Ga0307411_10000001	Ga0307411_10000001423	402
80	3300041411	Ga0439466_0006343	Ga0439466_0006343_1496_2755	402
81	3300048919	Ga0496116_0000032	Ga0496116_0000032_113822_115090	402
82	3300048927	Ga0496124_0014102	Ga0496124_0014102_5378_6646	402
83	3300048928	Ga0496125_0000059	Ga0496125_0000059_110770_112038	402
84	3300048929	Ga0496126_0135247	Ga0496126_0135247_431_1699	402
85	3300049671	Ga0501238_000571	Ga0501238_000571_722_1981	402
86	3300049679	Ga0501249_000009	Ga0501249_000009_146586_147851	402
87	3300049679	Ga0501249_001009	Ga0501249_001009_1310_2569	402
88	3300049763	Ga0501266_000039	Ga0501266_000039_6334_7593	402
89	3300053090	Ga0500646_0000495	Ga0500646_0000495_9534_10802	402
90	3300053096	Ga0500641_0000019	Ga0500641_0000019_8609_9877	402
91	3300053134	Ga0500658_0000003	Ga0500658_0000003_202870_204129	402
92	3300046522	Ga0495643_0057029	Ga0495643_0057029_564_1832	403
93	3300005434	Ga0070709_10007631	Ga0070709_100076312	404
94	3300005435	Ga0070714_100011414	Ga0070714_1000114141	404
95	3300005436	Ga0070713_100000251	Ga0070713_10000025121	404
96	3300005436	Ga0070713_100007891	Ga0070713_1000078915	404
97	3300005439	Ga0070711_100058165	Ga0070711_1000581652	404
98	3300005563	Ga0068855_100124110	Ga0068855_1001241102	404
99	3300006028	Ga0070717_10000372	Ga0070717_1000037220	404
100	3300006175	Ga0070712_100010977	Ga0070712_1000109773	404
101	3300006175	Ga0070712_100052145	Ga0070712_1000521452	404
102	3300025906	Ga0207699_10032782	Ga0207699_100327822	404
103	3300025915	Ga0207693_10034486	Ga0207693_100344862	404
104	3300025915	Ga0207693_10038724	Ga0207693_100387242	404
105	3300025928	Ga0207700_10010772	Ga0207700_100107722	404
106	3300025929	Ga0207664_10008816	Ga0207664_100088165	404
107	3300025949	Ga0207667_10151225	Ga0207667_101512252	404
108	3300035083	Ga0373926_0039099	Ga0373926_0039099_309_1562	404
109	3300035089	Ga0373944_0007642	Ga0373944_0007642_1333_2586	404
110	3300035170	Ga0373943_0007820	Ga0373943_0007820_852_2105	404
111	3300035692	Ga0373935_0004478	Ga0373935_0004478_2577_3830	404
112	3300037068	Ga0373925_0009242	Ga0373925_0009242_4375_5628	404
113	3300042876	Ga0451577_0000001	Ga0451577_0000001_1401628_1402908	404
114	3300046455	Ga0495603_0000875	Ga0495603_0000875_3260_4513	404
115	3300046459	Ga0495629_0004622	Ga0495629_0004622_8748_10001	404
116	3300046473	Ga0495582_0000646	Ga0495582_0000646_2578_3831	404
117	3300046475	Ga0495639_0000028	Ga0495639_0000028_66259_67512	404
118	3300046507	Ga0495606_0021092	Ga0495606_0021092_3442_4710	404
119	3300046517	Ga0495630_0000452	Ga0495630_0000452_28755_30008	404
120	3300046531	Ga0495665_0001779	Ga0495665_0001779_9198_10451	404
121	3300046674	Ga0495588_0000686	Ga0495588_0000686_853_2106	404
122	3300046683	Ga0495658_0000525	Ga0495658_0000525_11067_12320	404
123	3300046689	Ga0495613_0096782	Ga0495613_0096782_415_1668	404
124	3300047315	Ga0495581_0000676	Ga0495581_0000676_6487_7740	404
125	3300047673	Ga0495593_0000015	Ga0495593_0000015_12979_14232	404
126	3300048089	Ga0495614_0001287	Ga0495614_0001287_4398_5651	404
127	3300005353	Ga0070669_100028225	Ga0070669_1000282252	405
128	3300005577	Ga0068857_100005970	Ga0068857_1000059702	405
129	3300005719	Ga0068861_100009873	Ga0068861_1000098734	405
130	3300005840	Ga0068870_10044802	Ga0068870_100448022	405
131	3300005844	Ga0068862_100027839	Ga0068862_1000278394	405
132	3300013100	Ga0157373_10003582	Ga0157373_100035827	405
133	3300017792	Ga0163161_10004631	Ga0163161_100046316	405
134	3300025908	Ga0207643_10002082	Ga0207643_100020825	405
135	3300025933	Ga0207706_10032766	Ga0207706_100327663	405
136	3300025961	Ga0207712_10004795	Ga0207712_100047953	405
137	3300026075	Ga0207708_10178021	Ga0207708_101780211	405
138	3300026116	Ga0207674_10066598	Ga0207674_100665982	405
139	3300026118	Ga0207675_100021734	Ga0207675_1000217344	405
140	3300028380	Ga0268265_10012717	Ga0268265_100127172	405
141	3300013307	Ga0157372_10021372	Ga0157372_100213722	406
142	3300031240	Ga0265320_10053188	Ga0265320_100531883	406
143	3300031711	Ga0265314_10032332	Ga0265314_100323322	406
144	3300037418	Ga0395900_0032537	Ga0395900_0032537_884_2167	406
145	3300037471	Ga0395905_0003208	Ga0395905_0003208_5624_6907	406
146	3300045976	Ga0466967_0031358	Ga0466967_0031358_2748_4031	406
147	3300025912	Ga0207707_10002978	Ga0207707_100029785	407
148	3300031250	Ga0265331_10044102	Ga0265331_100441022	407
149	3300035119	Ga0373956_0001589	Ga0373956_0001589_5886_7163	407
150	3300035172	Ga0373955_0008426	Ga0373955_0008426_1458_2735	407
151	3300046454	Ga0495592_0060396	Ga0495592_0060396_602_1879	407
152	3300046459	Ga0495629_0079396	Ga0495629_0079396_105_1382	407
153	3300046463	Ga0495653_0014535	Ga0495653_0014535_4008_5285	407
154	3300046516	Ga0495628_0104270	Ga0495628_0104270_802_2079	407
155	3300046543	Ga0495645_0008059	Ga0495645_0008059_1696_2973	407
156	3300046559	Ga0495667_0012355	Ga0495667_0012355_3792_5069	407
157	3300046678	Ga0495599_0006014	Ga0495599_0006014_5381_6658	407
158	3300046679	Ga0495623_0037498	Ga0495623_0037498_551_1828	407
159	3300046809	Ga0495600_0069346	Ga0495600_0069346_882_2159	407
160	3300047317	Ga0495604_0006639	Ga0495604_0006639_2212_3489	407
161	3300047319	Ga0495674_0081033	Ga0495674_0081033_1042_2319	407
162	3300048088	Ga0495602_0044348	Ga0495602_0044348_2198_3475	407
163	3300005290	Ga0065712_10006089	Ga0065712_100060894	408
164	3300005329	Ga0070683_100055678	Ga0070683_1000556782	408
165	3300005334	Ga0068869_100005145	Ga0068869_1000051459	408
166	3300005347	Ga0070668_100008443	Ga0070668_1000084436	408
167	3300005353	Ga0070669_100008614	Ga0070669_1000086146	408
168	3300005354	Ga0070675_100190142	Ga0070675_1001901421	408
169	3300005364	Ga0070673_100021860	Ga0070673_1000218602	408
170	3300005365	Ga0070688_100026789	Ga0070688_1000267892	408
171	3300005459	Ga0068867_100033309	Ga0068867_1000333093	408
172	3300005577	Ga0068857_100035653	Ga0068857_1000356533	408
173	3300005578	Ga0068854_100098702	Ga0068854_1000987021	408
174	3300005719	Ga0068861_100080620	Ga0068861_1000806203	408
175	3300005840	Ga0068870_10062730	Ga0068870_100627302	408
176	3300005844	Ga0068862_100047367	Ga0068862_1000473672	408
177	3300009094	Ga0111539_10062482	Ga0111539_100624823	408
178	3300009553	Ga0105249_10004262	Ga0105249_1000426210	408
179	3300014326	Ga0157380_10036583	Ga0157380_100365834	408
180	3300014745	Ga0157377_10008865	Ga0157377_100088655	408
181	3300025923	Ga0207681_10003233	Ga0207681_100032334	408
182	3300025926	Ga0207659_10117012	Ga0207659_101170122	408
183	3300025942	Ga0207689_10143615	Ga0207689_101436152	408
184	3300025944	Ga0207661_10044898	Ga0207661_100448982	408
185	3300025960	Ga0207651_10041289	Ga0207651_100412891	408
186	3300025972	Ga0207668_10057030	Ga0207668_100570302	408
187	3300026075	Ga0207708_10124038	Ga0207708_101240382	408
188	3300026116	Ga0207674_10020855	Ga0207674_100208553	408
189	3300026118	Ga0207675_100000597	Ga0207675_10000059723	408
190	3300027907	Ga0207428_10034442	Ga0207428_100344422	408
191	3300028380	Ga0268265_10013596	Ga0268265_100135964	408
192	3300050511	nmdc:mga08y16_18443_c1	nmdc:mga08y16_18443_c1_4240_5523	408
193	3300005445	Ga0070708_100033733	Ga0070708_1000337333	409
194	3300006847	Ga0075431_100147249	Ga0075431_1001472492	409
195	3300006880	Ga0075429_100073353	Ga0075429_1000733533	409
196	3300031852	Ga0307410_10226129	Ga0307410_102261291	409
197	3300050508	nmdc:mga09592_11461_c1	nmdc:mga09592_11461_c1_5206_6504	409
198	3300050509	nmdc:mga0qj67_19054_c1	nmdc:mga0qj67_19054_c1_2138_3436	409
199	3300005547	Ga0070693_100024173	Ga0070693_1000241732	410
200	3300009545	Ga0105237_10000013	Ga0105237_10000013189	410
201	3300009551	Ga0105238_10070407	Ga0105238_100704073	410
202	3300025914	Ga0207671_10000024	Ga0207671_10000024221	410
203	3300026078	Ga0207702_10180479	Ga0207702_101804792	410
204	3300005327	Ga0070658_10046286	Ga0070658_100462862	411
205	iso_pu_bacteria	2818991444	2819586434	411
206	iso_pu_bacteria	2842903701	2842908459	411
207	iso_pu_bacteria	2881955468	2881955679	411
208	iso_pu_bacteria	2842903701	2842908319	412
209	iso_pu_bacteria	2929154850	2929159047	412
210	iso_pu_bacteria	2929177148	2929182517	412
211	iso_pu_bacteria	2946013367	2946015694	412
212	3300014969	Ga0157376_10020537	Ga0157376_100205376	413
213	3300025292	Ga0209676_1000740	Ga0209676_100074012	413
214	3300025917	Ga0207660_10072155	Ga0207660_100721552	413
215	3300031731	Ga0307405_10000392	Ga0307405_100003927	413
216	3300032004	Ga0307414_10236852	Ga0307414_102368521	413
217	iso_pu_bacteria	2511231000	2511231251	413
218	iso_pu_bacteria	2582581278	2585141490	413
219	iso_pu_bacteria	2582581281	2585156713	413
220	iso_pu_bacteria	2582581282	2585160984	413
221	iso_pu_bacteria	2585428045	2587677540	413
222	iso_pu_bacteria	2585428061	2587751251	413
223	iso_pu_bacteria	2585428182	2588208093	413
224	iso_pu_bacteria	2585428184	2588219946	413
225	iso_pu_bacteria	2585428187	2588233374	413
226	iso_pu_bacteria	2588254257	2590612624	413
227	iso_pu_bacteria	2739367874	2740057776	413
228	iso_pu_bacteria	2765235839	2765573399	413
229	iso_pu_bacteria	2772190705	2772606033	413
230	iso_pu_bacteria	2816332188	2816873071	413
231	iso_pu_bacteria	2842083920	2842084892	413
232	iso_pu_bacteria	2871720351	2871723884	413
233	iso_pu_bacteria	2889290771	2889291553	413
234	iso_pu_bacteria	2905999023	2906000173	413
235	iso_pu_bacteria	2945924605	2945927198	413
236	iso_pu_bacteria	2977243572	2977246123	413
237	iso_pu_bacteria	2984572630	2984576021	413
238	iso_pu_bacteria	2984606641	2984609476	413
239	iso_pu_bacteria	2993480792	2993484122	413
240	3300003322	rootL2_10367446	rootL2_103674462	414
241	iso_pu_bacteria	2751185877	2753671096	414
242	3300003322	rootL2_10060107	rootL2_100601074	415
243	3300003323	rootH1_10021842	rootH1_1002184231	415
244	3300003354	JGI25160J50197_1000376	JGI25160J50197_100037625	415
245	3300005354	Ga0070675_100002058	Ga0070675_1000020587	415
246	3300025926	Ga0207659_10005720	Ga0207659_100057203	415
247	3300030731	Ga0316177_1134237	Ga0316177_11342378	415
248	3300030732	Ga0316176_1057051	Ga0316176_105705131	415
249	3300030742	Ga0316183_1093843	Ga0316183_10938433	415
250	3300030744	Ga0316181_1082642	Ga0316181_10826426	415
251	3300030745	Ga0316182_1070171	Ga0316182_10701712	415
252	3300049573	Ga0501037_0038929	Ga0501037_0038929_1587_2849	415
253	3300053156	Ga0500622_0000986	Ga0500622_0000986_14919_16172	415
254	3300003203	JGI25406J46586_10030426	JGI25406J46586_100304262	416
255	3300003316	rootH1_10071545	rootH1_100715455	416
256	3300003323	rootH1_10307374	rootH1_103073742	416
257	3300005338	Ga0068868_100025310	Ga0068868_1000253105	416
258	3300005344	Ga0070661_100130179	Ga0070661_1001301791	416
259	3300005366	Ga0070659_100015428	Ga0070659_1000154281	416
260	3300005539	Ga0068853_100229627	Ga0068853_1002296272	416
261	3300005564	Ga0070664_100048964	Ga0070664_1000489641	416
262	3300005577	Ga0068857_100114550	Ga0068857_1001145502	416
263	3300005617	Ga0068859_100090081	Ga0068859_1000900811	416
264	3300005618	Ga0068864_100012517	Ga0068864_1000125174	416
265	3300005618	Ga0068864_100170308	Ga0068864_1001703082	416
266	3300005842	Ga0068858_100143647	Ga0068858_1001436472	416
267	3300005985	Ga0081539_10003431	Ga0081539_1000343114	416
268	3300006931	Ga0097620_100090080	Ga0097620_1000900801	416
269	3300009093	Ga0105240_10007171	Ga0105240_1000717116	416
270	3300010375	Ga0105239_10000609	Ga0105239_1000060934	416
271	3300013100	Ga0157373_10019316	Ga0157373_100193165	416
272	3300013102	Ga0157371_10056291	Ga0157371_100562912	416
273	3300013102	Ga0157371_10074445	Ga0157371_100744453	416
274	3300013102	Ga0157371_10148722	Ga0157371_101487221	416
275	3300013105	Ga0157369_10007435	Ga0157369_1000743512	416
276	3300013306	Ga0163162_10108329	Ga0163162_101083294	416
277	3300017792	Ga0163161_10006744	Ga0163161_100067448	416
278	3300025909	Ga0207705_10110631	Ga0207705_101106311	416
279	3300025932	Ga0207690_10201411	Ga0207690_102014111	416
280	3300026035	Ga0207703_10265299	Ga0207703_102652992	416
281	3300026095	Ga0207676_10008113	Ga0207676_100081133	416
282	3300026116	Ga0207674_10052505	Ga0207674_100525051	416
283	3300030732	Ga0316176_1179773	Ga0316176_11797736	416
284	3300030742	Ga0316183_1116825	Ga0316183_111682535	416
285	3300030744	Ga0316181_1214641	Ga0316181_12146412	416
286	3300047472	Ga0495686_0000086	Ga0495686_0000086_32375_33640	416
287	3300049571	Ga0501034_0059935	Ga0501034_0059935_2134_3399	416
288	3300053156	Ga0500622_0000640	Ga0500622_0000640_3689_4966	416
289	3300005288	Ga0065714_10067184	Ga0065714_100671842	417
290	3300005337	Ga0070682_100002913	Ga0070682_1000029135	417
291	3300009036	Ga0105244_10000058	Ga0105244_1000005814	417
292	3300013100	Ga0157373_10000009	Ga0157373_1000000986	417
293	3300013104	Ga0157370_10001649	Ga0157370_1000164922	417
294	3300013104	Ga0157370_10059434	Ga0157370_100594343	417
295	3300013104	Ga0157370_10123902	Ga0157370_101239022	417
296	3300013306	Ga0163162_10005346	Ga0163162_100053463	417
297	3300013308	Ga0157375_10000313	Ga0157375_1000031339	417
298	3300014497	Ga0182008_10000028	Ga0182008_10000028111	417
299	3300017792	Ga0163161_10004844	Ga0163161_100048449	417
300	3300021384	Ga0213876_10006242	Ga0213876_100062424	417
301	3300025291	Ga0209675_1000033	Ga0209675_1000033160	417
302	3300025728	Ga0207655_1000693	Ga0207655_10006932	417
303	3300026067	Ga0207678_10273004	Ga0207678_102730041	417
304	3300031911	Ga0307412_10000451	Ga0307412_1000045122	417
305	3300031911	Ga0307412_10048565	Ga0307412_100485652	417
306	3300032004	Ga0307414_10000009	Ga0307414_1000000994	417
307	3300039437	Ga0436365_0301783	Ga0436365_0301783_6554_7915	417
308	3300042004	Ga0439445_0000328	Ga0439445_0000328_2073_3341	417
309	3300046453	Ga0495627_000002	Ga0495627_000002_491695_492957	417
310	3300046507	Ga0495606_0019712	Ga0495606_0019712_2711_4000	417
311	3300046512	Ga0495610_0000009	Ga0495610_0000009_294860_296131	417
312	3300046530	Ga0495654_0000001	Ga0495654_0000001_388269_389531	417
313	3300046538	Ga0495609_0004547	Ga0495609_0004547_3432_4709	417
314	3300046558	Ga0495633_0001799	Ga0495633_0001799_11823_13100	417
315	3300046616	Ga0495668_0000639	Ga0495668_0000639_5649_6911	417
316	3300047472	Ga0495686_0001041	Ga0495686_0001041_7144_8409	417
317	3300047472	Ga0495686_0011234	Ga0495686_0011234_3613_4875	417
318	3300048905	Ga0496102_0007635	Ga0496102_0007635_2760_4028	417
319	3300048916	Ga0496113_0033785	Ga0496113_0033785_1939_3207	417
320	3300048917	Ga0496114_0000437	Ga0496114_0000437_22583_23848	417
321	3300048919	Ga0496116_0000053	Ga0496116_0000053_6302_7570	417
322	3300048920	Ga0496117_0000089	Ga0496117_0000089_149091_150359	417
323	3300048921	Ga0496118_0000221	Ga0496118_0000221_77934_79202	417
324	3300048921	Ga0496118_0109301	Ga0496118_0109301_53_1318	417
325	3300048922	Ga0496119_0000038	Ga0496119_0000038_149084_150352	417
326	3300048925	Ga0496122_0000465	Ga0496122_0000465_73796_75073	417
327	3300048925	Ga0496122_0000700	Ga0496122_0000700_34531_35799	417
328	3300048925	Ga0496122_0002035	Ga0496122_0002035_25251_26522	417
329	3300048925	Ga0496122_0020942	Ga0496122_0020942_1644_2939	417
330	3300048926	Ga0496123_0000930	Ga0496123_0000930_30215_31483	417
331	3300048926	Ga0496123_0006125	Ga0496123_0006125_5955_7226	417
332	3300048927	Ga0496124_0001049	Ga0496124_0001049_129_1397	417
333	3300048928	Ga0496125_0000547	Ga0496125_0000547_27710_28981	417
334	3300048928	Ga0496125_0017073	Ga0496125_0017073_4514_5782	417
335	3300048929	Ga0496126_0156224	Ga0496126_0156224_231_1502	417
336	3300049758	Ga0501241_000019	Ga0501241_000019_84402_85670	417
337	3300050508	nmdc:mga09592_1424_c1	nmdc:mga09592_1424_c1_12435_13739	417
338	3300053096	Ga0500641_0000554	Ga0500641_0000554_10002_11291	417
339	iso_pu_bacteria	2585428184	2588218592	417
340	iso_pu_bacteria	2728369107	2729198719	417
341	iso_pu_bacteria	2896317667	2896317669	417
342	iso_pu_bacteria	2946019816	2946021547	417
343	iso_pu_bacteria	3003233435	3003236443	417
344	3300003320	rootH2_10043772	rootH2_100437722	418
345	3300003323	rootH1_10186396	rootH1_101863963	418
346	3300003781	Ga0055536_1007819	Ga0055536_10078193	418
347	3300005262	Ga0065165_1000145	Ga0065165_1000145102	418
348	3300046616	Ga0495668_0007378	Ga0495668_0007378_5281_6582	418
349	iso_pu_bacteria	2522125168	2522551707	418
350	3300003322	rootL2_10065114	rootL2_100651144	419
351	3300005366	Ga0070659_100076996	Ga0070659_1000769962	419
352	3300005563	Ga0068855_100006274	Ga0068855_10000627416	419
353	3300013102	Ga0157371_10004025	Ga0157371_100040252	419
354	3300013104	Ga0157370_10001675	Ga0157370_1000167516	419
355	3300013306	Ga0163162_10000608	Ga0163162_100006087	419
356	3300025298	Ga0209050_1001111	Ga0209050_100111120	419
357	3300025949	Ga0207667_10024111	Ga0207667_100241116	419
358	3300037312	Ga0395899_0052558	Ga0395899_0052558_1388_2650	419
359	3300037418	Ga0395900_0132808	Ga0395900_0132808_498_1760	419
360	3300038443	Ga0395901_0011060	Ga0395901_0011060_7405_8667	419
361	3300046460	Ga0495638_0000005	Ga0495638_0000005_464268_465539	419
362	3300049570	Ga0501033_0083716	Ga0501033_0083716_924_2198	419
363	3300049571	Ga0501034_0046485	Ga0501034_0046485_1606_2880	419
364	3300049822	Ga0501035_0088175	Ga0501035_0088175_1068_2342	419
365	3300049823	Ga0501044_0227505	Ga0501044_0227505_445_1719	419
366	3300053153	Ga0500616_0000003	Ga0500616_0000003_1004395_1005666	419
367	3300003323	rootH1_10253110	rootH1_102531102	420
368	3300005327	Ga0070658_10011805	Ga0070658_100118053	420
369	3300005327	Ga0070658_10268090	Ga0070658_102680902	420
370	3300005336	Ga0070680_100048351	Ga0070680_1000483512	420
371	3300005339	Ga0070660_100006247	Ga0070660_1000062475	420
372	3300005339	Ga0070660_100062303	Ga0070660_1000623032	420
373	3300005458	Ga0070681_10087036	Ga0070681_100870363	420
374	3300005530	Ga0070679_100003446	Ga0070679_10000344612	420
375	3300005535	Ga0070684_100127625	Ga0070684_1001276252	420
376	3300005563	Ga0068855_100023805	Ga0068855_1000238052	420
377	3300005563	Ga0068855_100374684	Ga0068855_1003746841	420
378	3300013100	Ga0157373_10004753	Ga0157373_100047532	420
379	3300013102	Ga0157371_10001101	Ga0157371_1000110115	420
380	3300013102	Ga0157371_10001777	Ga0157371_1000177718	420
381	3300013102	Ga0157371_10003314	Ga0157371_100033145	420
382	3300013102	Ga0157371_10006532	Ga0157371_100065329	420
383	3300013104	Ga0157370_10006311	Ga0157370_100063113	420
384	3300013104	Ga0157370_10056755	Ga0157370_100567552	420
385	3300013105	Ga0157369_10042118	Ga0157369_100421185	420
386	3300013105	Ga0157369_10131945	Ga0157369_101319452	420
387	3300013307	Ga0157372_10140291	Ga0157372_101402912	420
388	3300013307	Ga0157372_10181653	Ga0157372_101816532	420
389	3300025904	Ga0207647_10109973	Ga0207647_101099732	420
390	3300025909	Ga0207705_10072796	Ga0207705_100727962	420
391	3300025917	Ga0207660_10038298	Ga0207660_100382983	420
392	3300025919	Ga0207657_10034674	Ga0207657_100346742	420
393	3300025921	Ga0207652_10000159	Ga0207652_1000015940	420
394	3300025921	Ga0207652_10000166	Ga0207652_1000016668	420
395	3300025949	Ga0207667_10043720	Ga0207667_100437206	420
396	3300026067	Ga0207678_10022022	Ga0207678_100220223	420
397	3300026067	Ga0207678_10269642	Ga0207678_102696422	420
398	3300026078	Ga0207702_10064532	Ga0207702_100645323	420
399	3300031901	Ga0307406_10079708	Ga0307406_100797081	420
400	3300032002	Ga0307416_100019284	Ga0307416_1000192845	420
401	3300032004	Ga0307414_10160240	Ga0307414_101602402	420
402	3300032126	Ga0307415_100051098	Ga0307415_1000510982	420
403	3300037312	Ga0395899_0049940	Ga0395899_0049940_1520_2797	420
404	3300037418	Ga0395900_0006015	Ga0395900_0006015_8818_10095	420
405	3300037418	Ga0395900_0051603	Ga0395900_0051603_1792_3069	420
406	3300037418	Ga0395900_0100672	Ga0395900_0100672_1519_2796	420
407	3300037418	Ga0395900_0232798	Ga0395900_0232798_284_1561	420
408	3300037466	Ga0395898_0002406	Ga0395898_0002406_20618_21895	420
409	3300037466	Ga0395898_0114401	Ga0395898_0114401_1109_2386	420
410	3300037471	Ga0395905_0014981	Ga0395905_0014981_5658_6935	420
411	3300037471	Ga0395905_0087706	Ga0395905_0087706_1255_2532	420
412	3300038443	Ga0395901_0020996	Ga0395901_0020996_2781_4058	420
413	3300038443	Ga0395901_0161484	Ga0395901_0161484_101_1378	420
414	3300038443	Ga0395901_0334346	Ga0395901_0334346_87_1364	420
415	3300049661	Ga0501217_008812	Ga0501217_008812_40_1368	420
416	3300049703	Ga0501219_000364	Ga0501219_000364_4399_5667	420
417	3300049705	Ga0501225_0025872	Ga0501225_0025872_274_1557	420
418	3300049761	Ga0501264_000151	Ga0501264_000151_8959_10290	420
419	3300050005	Ga0501284_00013	Ga0501284_00013_80298_81566	420
420	3300005577	Ga0068857_100026557	Ga0068857_1000265573	421
421	3300005614	Ga0068856_100049618	Ga0068856_1000496183	421
422	3300009174	Ga0105241_10009442	Ga0105241_100094424	421
423	3300009545	Ga0105237_10013166	Ga0105237_100131665	421
424	3300010375	Ga0105239_10004531	Ga0105239_1000453112	421
425	3300025911	Ga0207654_10115405	Ga0207654_101154051	421
426	3300025932	Ga0207690_10012516	Ga0207690_100125163	421
427	3300026078	Ga0207702_10087810	Ga0207702_100878102	421
428	3300026116	Ga0207674_10040160	Ga0207674_100401603	421
429	3300037312	Ga0395899_0001157	Ga0395899_0001157_12123_13397	421
430	3300037418	Ga0395900_0001840	Ga0395900_0001840_20964_22238	421
431	3300037466	Ga0395898_0000480	Ga0395898_0000480_12472_13746	421
432	3300038443	Ga0395901_0005715	Ga0395901_0005715_10228_11502	421
433	3300044656	Ga0466969_0000629	Ga0466969_0000629_1920_3197	421
434	3300045049	Ga0466959_0000236	Ga0466959_0000236_26938_28215	421
435	3300003320	rootH2_10001891	rootH2_10001891350	423
436	3300003322	rootL2_10284751	rootL2_102847511	423
437	3300003323	rootH1_10108082	rootH1_101080823	423
438	3300013104	Ga0157370_10132413	Ga0157370_101324132	423
439	3300030521	Ga0307511_10001867	Ga0307511_1000186716	423
440	3300049581	Ga0501047_0121072	Ga0501047_0121072_1132_2454	423
441	3300049586	Ga0501070_0117991	Ga0501070_0117991_468_1802	423
442	3300049587	Ga0501071_0204287	Ga0501071_0204287_83_1417	423
443	3300049589	Ga0501073_0039574	Ga0501073_0039574_395_1729	423
444	3300049742	Ga0501080_0083336	Ga0501080_0083336_1277_2611	423
445	3300049744	Ga0501083_0006687	Ga0501083_0006687_3516_4850	423
446	3300049823	Ga0501044_0051861	Ga0501044_0051861_830_2152	423
447	3300060353	Ga0501082_0280538	Ga0501082_0280538_17_1363	423
448	3300013296	Ga0157374_10000455	Ga0157374_100004554	424
449	3300013306	Ga0163162_10245132	Ga0163162_102451321	424
450	3300013308	Ga0157375_10000695	Ga0157375_100006952	424
451	3300014325	Ga0163163_10000075	Ga0163163_100000755	424
452	3300045049	Ga0466959_0012697	Ga0466959_0012697_755_2065	424
453	3300048927	Ga0496124_0079014	Ga0496124_0079014_1026_2507	424
454	3300053139	Ga0500568_0002111	Ga0500568_0002111_9338_10642	424
455	3300002737	JGI25162J39368_1000005	JGI25162J39368_1000005111	427
456	3300025233	Ga0209437_100043	Ga0209437_100043286	427
457	3300028794	Ga0307515_10000174	Ga0307515_1000017487	427

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22366

NDH2_C

NDH2 C-terminal domain

413

471

0.96 PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

67

389

0.93 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
5kmq-assembly1.cif.gz_B	the structure of i379e variant of type ii nadh dehydrogenase from caldalkalibacillus thermarum	0.9038	9	403
3ax6-assembly1.cif.gz_B	crystal structure of n5-carboxyaminoimidazole ribonucleotide synthetase from thermotoga maritima	0.9037	10	42
5kmq-assembly2.cif.gz_C	the structure of i379e variant of type ii nadh dehydrogenase from caldalkalibacillus thermarum	0.9019	9	403
5kmp-assembly1.cif.gz_A	the structure of g164e variant of type ii nadh dehydrogenase from caldalkalibacillus thermarum	0.9001	9	403
5kmq-assembly1.cif.gz_B	the structure of i379e variant of type ii nadh dehydrogenase from caldalkalibacillus thermarum	0.8994	9	403

ID	Description	Score	Start	End	Superfamily
af_Q6YZ09_48_354_3.50.50.100	Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;	0.9412	8	270	3.50.50.100
af_I1KLC9_45_406_3.50.50.100	Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;	0.9274	7	309	3.50.50.100
af_P95200_9_428_3.50.50.100	Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;	0.9257	7	413	3.50.50.100
af_I1KF65_1_317_3.50.50.100	Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;	0.9229	35	314	3.50.50.100
af_Q54GF3_119_512_3.50.50.100	Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;	0.914	7	314	3.50.50.100

ID	Description	Score	Start	End	GO Terms
AF-A0A519NLH7-F1-model_v4	NADH:ubiquinone reductase (non-electrogenic) (EC 1.6.5.9)	0.9893	10	387	GO:0003954 GO:0006116
AF-A0A519NLH7-F1-model_v4	NADH:ubiquinone reductase (non-electrogenic) (EC 1.6.5.9)	0.9816	10	387	GO:0003954 GO:0006116
AF-A0A7C4Y5C3-F1-model_v4	NADH:ubiquinone reductase (non-electrogenic) (EC 1.6.5.9)	0.9812	10	274	GO:0003954 GO:0006116
AF-A0A352MBF9-F1-model_v4	NADH:ubiquinone reductase (non-electrogenic) (EC 1.6.5.9)	0.9804	9	305	GO:0003954 GO:0006116
AF-A0A4Q5WU76-F1-model_v4	NADH:ubiquinone reductase (non-electrogenic) (EC 1.6.5.9)	0.978	10	222	GO:0003954 GO:0006116

Feature Viewer

pLDDT	pTM	Quality
87.97	0.87	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F448068

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF22366

NDH2_C

NDH2 C-terminal domain

413

471

0.96

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

67

389

0.93

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map