F448018

General Info

Members Datasets Scaffolds Average Seq Length
457 285 914 395

Family's Representative Sequence

Representative Sequence 3300035241|Ga0373961_0000047|Ga0373961_0000047_65378_66565
Length 395
Sequence MHMPRKVNVIGVGMVPFAKPGKSEEYHVMAKKAGEAALADAKVPFHQVQQAYAGYVFGDSTCGQRAIYQLGLTGIPVWNVNNNCSTGSSALMLGAQAIAGGLAECVIVVGFEQMEAGALSAKWTDRANPLDKFVNVMNEEQGFNQAPPAAQMFGGAGREYRWKYGTKKETFAKISAKARQHAAKNPYALFKEVLSVEEILASPEVFDPLTRYQCCPPTCGAAAAVLASDEFARKHGIDRPVYIAAQTMTTDFPSSFEEHSMIKMVGYDMARSAAAKVYEQAGIGPDDVDVVELHDCFTANELLTYEALGLCKEGEAEKFIWDGDNTYGGKFVTNPSGGLLSKGHPLGATGLAQCTELVWHLRGQAEARQVEGAKIALQHNLGLGGACVVTMYRRD

Samples

Sample ID Description Type Environment
1 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
62 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
64 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
66 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
67 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
68 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
116 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
117 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
118 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
119 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
120 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
121 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
122 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
123 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
124 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
127 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
136 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
142 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
143 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
144 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
145 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
146 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
147 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
148 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
149 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
150 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
151 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
152 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
153 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
154 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
155 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
156 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
157 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
160 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
163 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
164 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
165 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
166 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
167 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
168 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
169 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
170 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
171 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
172 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
173 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
174 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
175 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
176 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
177 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
178 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
179 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
180 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
181 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
182 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
183 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
184 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
185 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
186 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
187 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
188 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
189 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
190 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
191 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
192 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
193 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
194 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
195 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
196 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
197 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
198 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
199 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
200 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
201 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
202 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
203 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
204 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
205 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
206 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
207 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
208 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
209 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
210 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
211 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
212 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
217 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
218 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
219 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
220 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
221 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
222 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
223 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
224 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
225 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
229 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
230 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
231 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
232 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
233 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
236 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
237 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
238 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
239 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
240 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
241 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
242 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
243 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
244 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
245 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
246 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
247 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
248 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
249 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
250 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
251 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
252 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
253 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
254 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
255 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
256 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
257 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
258 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
259 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
260 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
261 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
262 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
263 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
264 2643221658 Variovorax sp. Root411 Isolate Unclassified
265 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
266 2643221672 Variovorax sp. Root434 Isolate Unclassified
267 2643221683 Variovorax sp. Root473 Isolate Unclassified
268 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
269 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
270 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
271 2842677519 Variovorax sp. R-72495 Isolate Unclassified
272 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
273 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
274 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
275 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
276 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
277 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
278 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
279 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
280 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
281 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
282 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
283 2929520902 Variovorax beijingensis 502 Isolate Unclassified
284 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
285 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.22
Metatranscriptomes 0
Isolates 6.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.29
Nodule 0.66
Rhizoplane 0.88
Rhizosphere 65.21
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373961_0000047 3300035241 Bacteria 72003
2 JGI25155J39150_1000192 3300002704 Bacteria 25932
3 JGI25156J39149_1000077 3300002705 Bacteria 74919
4 JGI25154J39366_1000103 3300002738 Bacteria 74908
5 JGI25151J46595_10001003 3300003187 Bacteria 21345
6 JGI25151J46595_10002372 3300003187 Bacteria 11426
7 Ga0055532_1000034 3300003758 Bacteria 210984
8 Ga0055526_1000810 3300003771 Bacteria 23315
9 Ga0055526_1001786 3300003771 Bacteria 14939
10 Ga0055537_1000064 3300003773 Bacteria 77134
11 Ga0055537_1001313 3300003773 Bacteria 10199
12 Ga0055524_1003189 3300003775 Bacteria 8053
13 Ga0055536_1000054 3300003781 Bacteria 108849
14 Ga0055536_1010170 3300003781 Bacteria 3774
15 Ga0055534_1000094 3300003784 Bacteria 70029
16 Ga0055534_1000338 3300003784 Bacteria 30485
17 Ga0055534_1001618 3300003784 Bacteria 8726
18 Ga0055534_1004077 3300003784 Bacteria 4361
19 Ga0055530_10003198 3300003791 Bacteria 9599
20 Ga0055530_10007178 3300003791 Bacteria 4758
21 Ga0055540_1002876 3300003792 Bacteria 8740
22 Ga0055540_1002905 3300003792 Bacteria 8673
23 Ga0055531_10000084 3300003794 Bacteria 102550
24 Ga0065714_10003682 3300005288 Bacteria 7115
25 Ga0065714_10023345 3300005288 Bacteria 1890
26 Ga0070683_100139599 3300005329 Bacteria 2296
27 Ga0068868_100013338 3300005338 Bacteria 6025
28 Ga0070689_100031447 3300005340 Bacteria 4033
29 Ga0070689_100040559 3300005340 Bacteria 3570
30 Ga0070671_100103915 3300005355 Bacteria 2384
31 Ga0070673_100093408 3300005364 Bacteria 2463
32 Ga0070678_100001450 3300005456 Bacteria 12626
33 Ga0070678_100024350 3300005456 Bacteria 4052
34 Ga0070678_100209749 3300005456 Bacteria 1613
35 Ga0068867_100001112 3300005459 Bacteria 18392
36 Ga0070706_100000246 3300005467 Bacteria 66106
37 Ga0070706_100098227 3300005467 Bacteria 2721
38 Ga0070707_100354132 3300005468 Bacteria 1426
39 Ga0070698_100008093 3300005471 Bacteria 11369
40 Ga0070698_100082117 3300005471 Bacteria 3216
41 Ga0070684_100392103 3300005535 Bacteria 1280
42 Ga0070697_100261782 3300005536 Bacteria 1481
43 Ga0068853_100045858 3300005539 Bacteria 3746
44 Ga0068853_100133514 3300005539 Bacteria 2224
45 Ga0070665_100007047 3300005548 Bacteria 11421
46 Ga0070665_100055728 3300005548 Bacteria 3964
47 Ga0070665_100142092 3300005548 Bacteria 2403
48 Ga0068855_100004730 3300005563 Bacteria 16627
49 Ga0068854_100027170 3300005578 Bacteria 3941
50 Ga0068856_100021939 3300005614 Bacteria 6207
51 Ga0068856_100096621 3300005614 Bacteria 2943
52 Ga0068859_100372441 3300005617 Bacteria 1524
53 Ga0068863_100072557 3300005841 Bacteria 3257
54 Ga0070717_10159422 3300006028 Bacteria 1957
55 Ga0075364_10003257 3300006051 Bacteria 9192
56 Ga0075362_10006366 3300006177 Bacteria 4400
57 Ga0075367_10039237 3300006178 Bacteria 2760
58 Ga0075366_10003203 3300006195 Bacteria 8590
59 Ga0075366_10013932 3300006195 Bacteria 4584
60 Ga0075366_10029966 3300006195 Bacteria 3197
61 Ga0075366_10080409 3300006195 Bacteria 1946
62 Ga0075370_10100454 3300006353 Bacteria 1674
63 Ga0068871_100028628 3300006358 Bacteria 4370
64 Ga0075430_100187826 3300006846 Bacteria 1718
65 Ga0068865_100119674 3300006881 Bacteria 1956
66 Ga0097620_100372480 3300006931 Bacteria 1524
67 Ga0075435_100255077 3300007076 Bacteria 1493
68 Ga0105244_10002080 3300009036 Bacteria 15407
69 Ga0105240_10002014 3300009093 Bacteria 33505
70 Ga0105240_10053852 3300009093 Bacteria 5047
71 Ga0111539_10001027 3300009094 Bacteria 36586
72 Ga0105245_10000560 3300009098 Bacteria 33770
73 Ga0105245_10028203 3300009098 Bacteria 4949
74 Ga0105245_10037010 3300009098 Bacteria 4337
75 Ga0105247_10001032 3300009101 Bacteria 20951
76 Ga0105243_10028166 3300009148 Bacteria 4311
77 Ga0105243_10043274 3300009148 Bacteria 3529
78 Ga0105241_10019464 3300009174 Bacteria 5006
79 Ga0105237_10028537 3300009545 Bacteria 5683
80 Ga0105237_10037273 3300009545 Bacteria 4916
81 Ga0105238_10008142 3300009551 Bacteria 10484
82 Ga0105238_10030250 3300009551 Bacteria 5511
83 Ga0105239_10003920 3300010375 Bacteria 18029
84 Ga0105246_10037290 3300011119 Bacteria 3262
85 Ga0105246_10081477 3300011119 Bacteria 2307
86 Ga0157374_10028483 3300013296 Bacteria 5047
87 Ga0163163_10077091 3300014325 Bacteria 3329
88 Ga0182008_10007203 3300014497 Bacteria 6157
89 Ga0182008_10048653 3300014497 Bacteria 2106
90 Ga0163161_10001260 3300017792 Bacteria 18914
91 Ga0209435_100007 3300025206 Bacteria 516857
92 Ga0209147_100017 3300025229 Bacteria 516857
93 Ga0209437_100346 3300025233 Bacteria 54525
94 Ga0209258_100115 3300025242 Bacteria 190367
95 Ga0209646_1000044 3300025246 Bacteria 334596
96 Ga0209026_1000063 3300025250 Bacteria 211324
97 Ga0209759_1000048 3300025256 Bacteria 224817
98 Ga0209565_1000025 3300025263 Bacteria 377969
99 Ga0209565_1000079 3300025263 Bacteria 159565
100 Ga0209673_1000149 3300025273 Bacteria 148659
101 Ga0209130_1002481 3300025284 Bacteria 9181
102 Ga0209130_1015430 3300025284 Bacteria 1883
103 Ga0209675_1000017 3300025291 Bacteria 378002
104 Ga0209675_1000063 3300025291 Bacteria 177603
105 Ga0209675_1002431 3300025291 Bacteria 9588
106 Ga0209675_1004505 3300025291 Bacteria 6171
107 Ga0209676_1000044 3300025292 Bacteria 416215
108 Ga0209676_1000123 3300025292 Bacteria 195351
109 Ga0209025_1000210 3300025294 Bacteria 139745
110 Ga0209025_1001061 3300025294 Bacteria 39993
111 Ga0209025_1001497 3300025294 Bacteria 30199
112 Ga0209025_1015608 3300025294 Bacteria 4560
113 Ga0209564_1000216 3300025295 Bacteria 132523
114 Ga0209564_1000312 3300025295 Bacteria 95547
115 Ga0209564_1009067 3300025295 Bacteria 4792
116 Ga0209050_1000188 3300025298 Bacteria 138865
117 Ga0209256_1000525 3300025299 Bacteria 55646
118 Ga0209256_1006422 3300025299 Bacteria 6238
119 Ga0209051_1000091 3300025303 Bacteria 173683
120 Ga0209051_1000128 3300025303 Bacteria 142159
121 Ga0209051_1006582 3300025303 Bacteria 6518
122 Ga0209257_1000057 3300025304 Bacteria 396985
123 Ga0207653_10036558 3300025885 Bacteria 1600
124 Ga0207710_10000603 3300025900 Bacteria 21020
125 Ga0207699_10209515 3300025906 Bacteria 1325
126 Ga0207643_10078764 3300025908 Bacteria 1907
127 Ga0207684_10107837 3300025910 Bacteria 2383
128 Ga0207695_10001014 3300025913 Bacteria 49482
129 Ga0207695_10013969 3300025913 Bacteria 9540
130 Ga0207695_10055354 3300025913 Bacteria 4134
131 Ga0207671_10027860 3300025914 Bacteria 4223
132 Ga0207671_10054129 3300025914 Bacteria 2974
133 Ga0207657_10144277 3300025919 Bacteria 1943
134 Ga0207649_10080353 3300025920 Bacteria 2108
135 Ga0207694_10004948 3300025924 Bacteria 10327
136 Ga0207650_10135151 3300025925 Bacteria 1934
137 Ga0207650_10235556 3300025925 Bacteria 1478
138 Ga0207659_10054780 3300025926 Bacteria 2849
139 Ga0207687_10006564 3300025927 Bacteria 7677
140 Ga0207687_10031688 3300025927 Bacteria 3575
141 Ga0207687_10128455 3300025927 Bacteria 1906
142 Ga0207664_10037466 3300025929 Bacteria 3754
143 Ga0207644_10030730 3300025931 Bacteria 3738
144 Ga0207644_10036217 3300025931 Bacteria 3463
145 Ga0207690_10243852 3300025932 Bacteria 1385
146 Ga0207706_10040604 3300025933 Bacteria 4124
147 Ga0207706_10269541 3300025933 Bacteria 1486
148 Ga0207709_10002095 3300025935 Bacteria 12847
149 Ga0207670_10020554 3300025936 Bacteria 4059
150 Ga0207670_10020591 3300025936 Bacteria 4056
151 Ga0207669_10155301 3300025937 Bacteria 1609
152 Ga0207711_10350958 3300025941 Bacteria 1366
153 Ga0207689_10078419 3300025942 Bacteria 2715
154 Ga0207689_10150566 3300025942 Bacteria 1918
155 Ga0207661_10100417 3300025944 Bacteria 2429
156 Ga0207667_10004674 3300025949 Bacteria 16769
157 Ga0207640_10098851 3300025981 Bacteria 2041
158 Ga0207658_10285368 3300025986 Bacteria 1417
159 Ga0207677_10144792 3300026023 Bacteria 1825
160 Ga0207678_10220803 3300026067 Bacteria 1622
161 Ga0207702_10113507 3300026078 Bacteria 2413
162 Ga0207641_10017628 3300026088 Bacteria 5847
163 Ga0207641_10033996 3300026088 Bacteria 4238
164 Ga0207641_10058252 3300026088 Bacteria 3287
165 Ga0207648_10010103 3300026089 Bacteria 8975
166 Ga0207648_10029315 3300026089 Bacteria 4880
167 Ga0207648_10185470 3300026089 Bacteria 1842
168 Ga0207676_10068074 3300026095 Bacteria 2846
169 Ga0207675_100100522 3300026118 Bacteria 2724
170 Ga0207683_10004383 3300026121 Bacteria 12194
171 Ga0209282_1005174 3300027666 Bacteria 7977
172 Ga0268266_10012838 3300028379 Bacteria 7232
173 Ga0268266_10022602 3300028379 Bacteria 5355
174 Ga0268266_10037457 3300028379 Bacteria 4132
175 Ga0268266_10103215 3300028379 Bacteria 2516
176 Ga0307517_10000463 3300028786 Bacteria 69565
177 Ga0307515_10000014 3300028794 Bacteria 562358
178 Ga0307515_10000041 3300028794 Bacteria 319110
179 Ga0307515_10000821 3300028794 Bacteria 71579
180 Ga0307515_10001078 3300028794 Bacteria 62511
181 Ga0307515_10002900 3300028794 Bacteria 36440
182 Ga0307515_10008788 3300028794 Bacteria 19624
183 Ga0307515_10009845 3300028794 Bacteria 18415
184 Ga0307515_10016846 3300028794 Bacteria 13359
185 Ga0307515_10085749 3300028794 Bacteria 4025
186 Ga0265338_10019254 3300028800 Bacteria 7259
187 Ga0307512_10066963 3300030522 Bacteria 2708
188 Ga0314311_1262448 3300030733 Bacteria 4221
189 Ga0316180_1083590 3300030736 Bacteria 3359
190 Ga0316181_1063450 3300030744 Bacteria 2113
191 Ga0265332_10014068 3300031238 Bacteria 3540
192 Ga0307513_10000012 3300031456 Bacteria 328865
193 Ga0307513_10010708 3300031456 Bacteria 11471
194 Ga0307513_10016015 3300031456 Bacteria 9062
195 Ga0307513_10087600 3300031456 Bacteria 3186
196 Ga0307513_10139548 3300031456 Bacteria 2353
197 Ga0307513_10303737 3300031456 Bacteria 1361
198 Ga0307509_10001165 3300031507 Bacteria 44960
199 Ga0307509_10007581 3300031507 Bacteria 14125
200 Ga0307509_10097413 3300031507 Bacteria 2989
201 Ga0307408_100001756 3300031548 Bacteria 15810
202 Ga0307408_100029934 3300031548 Bacteria 3777
203 Ga0307408_100067625 3300031548 Bacteria 2628
204 Ga0307508_10016865 3300031616 Bacteria 6645
205 Ga0307508_10028459 3300031616 Bacteria 5050
206 Ga0307516_10001306 3300031730 Bacteria 34605
207 Ga0307516_10015521 3300031730 Bacteria 8011
208 Ga0307516_10039074 3300031730 Bacteria 4732
209 Ga0307516_10195767 3300031730 Bacteria 1744
210 Ga0307516_10202919 3300031730 Bacteria 1701
211 Ga0307516_10205213 3300031730 Bacteria 1688
212 Ga0307405_10088798 3300031731 Bacteria 2040
213 Ga0307518_10075518 3300031838 Bacteria 2437
214 Ga0307406_10090222 3300031901 Bacteria 2061
215 Ga0307407_10087763 3300031903 Bacteria 1899
216 Ga0307412_10006505 3300031911 Bacteria 6610
217 Ga0307412_10008233 3300031911 Bacteria 5944
218 Ga0307412_10017782 3300031911 Bacteria 4260
219 Ga0307412_10056075 3300031911 Bacteria 2624
220 Ga0307412_10096103 3300031911 Bacteria 2084
221 Ga0307414_10027598 3300032004 Bacteria 3671
222 Ga0307411_10076094 3300032005 Bacteria 2293
223 Ga0307507_10152048 3300033179 Bacteria 1738
224 Ga0373949_0000061 3300035090 Bacteria 40049
225 Ga0395900_0230694 3300037418 Bacteria 1862
226 Ga0395900_0541903 3300037418 Bacteria 1109
227 Ga0395905_0000042 3300037471 Bacteria 247894
228 Ga0395901_0026249 3300038443 Bacteria 5980
229 Ga0395901_0375266 3300038443 Bacteria 1464
230 Ga0395901_0458779 3300038443 Bacteria 1302
231 Ga0436365_0249397 3300039437 Bacteria 2017
232 Ga0436362_0796005 3300039453 Bacteria 1604
233 Ga0439436_0002391 3300041404 Bacteria 5626
234 Ga0439436_0005436 3300041404 Bacteria 3903
235 Ga0439465_0007075 3300041413 Bacteria 3565
236 Ga0451793_1014845 3300041452 Bacteria 1826
237 Ga0451853_1116226 3300041512 Bacteria 5040
238 Ga0439445_0009081 3300042004 Bacteria 2338
239 Ga0439432_016232 3300042006 Bacteria 2508
240 Ga0439449_0005179 3300042007 Bacteria 5003
241 Ga0439449_0022542 3300042007 Bacteria 2359
242 Ga0439449_0040898 3300042007 Bacteria 1723
243 Ga0439462_0002605 3300042015 Bacteria 4214
244 Ga0439462_0002770 3300042015 Bacteria 4120
245 Ga0450911_001422 3300042115 Bacteria 5515
246 Ga0439446_0001676 3300042156 Bacteria 5135
247 Ga0439434_0001249 3300042435 Bacteria 7313
248 Ga0451577_0029080 3300042876 Bacteria 4996
249 Ga0453683_0003540 3300044673 Bacteria 11479
250 Ga0466966_0052959 3300044684 Bacteria 2576
251 Ga0466966_0087081 3300044684 Bacteria 1941
252 Ga0466971_0073182 3300044719 Bacteria 1557
253 Ga0466957_0001605 3300044842 Bacteria 11870
254 Ga0451576_0031686 3300045051 Bacteria 5635
255 Ga0451576_0297937 3300045051 Bacteria 1686
256 Ga0495592_0000085 3300046454 Bacteria 82502
257 Ga0495591_000039 3300046458 Bacteria 156460
258 Ga0495629_0014496 3300046459 Bacteria 5672
259 Ga0495638_0003255 3300046460 Bacteria 12816
260 Ga0495582_0022199 3300046473 Bacteria 3473
261 Ga0495605_0003739 3300046474 Bacteria 9033
262 Ga0495605_0007201 3300046474 Bacteria 6328
263 Ga0495605_0012853 3300046474 Bacteria 4632
264 Ga0495584_0000247 3300046491 Bacteria 38995
265 Ga0495584_0019392 3300046491 Bacteria 3454
266 Ga0495585_0002850 3300046492 Bacteria 12036
267 Ga0495585_0017664 3300046492 Bacteria 4119
268 Ga0495585_0019987 3300046492 Bacteria 3852
269 Ga0495585_0049817 3300046492 Bacteria 2325
270 Ga0495596_0000186 3300046500 Bacteria 43253
271 Ga0495596_0014765 3300046500 Bacteria 3286
272 Ga0495607_0009832 3300046501 Bacteria 6455
273 Ga0495583_0000442 3300046506 Bacteria 62158
274 Ga0495583_0002083 3300046506 Bacteria 18045
275 Ga0495583_0023142 3300046506 Bacteria 3150
276 Ga0495583_0030921 3300046506 Bacteria 2601
277 Ga0495606_0013467 3300046507 Bacteria 6456
278 Ga0495610_0003618 3300046512 Bacteria 11926
279 Ga0495616_0022031 3300046513 Bacteria 3444
280 Ga0495630_0228010 3300046517 Bacteria 1423
281 Ga0495631_0000999 3300046518 Bacteria 17561
282 Ga0495631_0036144 3300046518 Bacteria 2206
283 Ga0495632_0000669 3300046519 Bacteria 31343
284 Ga0495632_0002550 3300046519 Bacteria 13804
285 Ga0495632_0004184 3300046519 Bacteria 9873
286 Ga0495632_0015953 3300046519 Bacteria 4193
287 Ga0495637_0000006 3300046520 Bacteria 435763
288 Ga0495637_0010782 3300046520 Bacteria 4407
289 Ga0495643_0000528 3300046522 Bacteria 47618
290 Ga0495643_0001017 3300046522 Bacteria 28632
291 Ga0495643_0009313 3300046522 Bacteria 6113
292 Ga0495643_0011336 3300046522 Bacteria 5433
293 Ga0495643_0106981 3300046522 Bacteria 1427
294 Ga0495644_0005324 3300046523 Bacteria 5023
295 Ga0495644_0006591 3300046523 Bacteria 4499
296 Ga0495648_0017837 3300046524 Bacteria 5058
297 Ga0495648_0060415 3300046524 Bacteria 2255
298 Ga0495666_0038484 3300046526 Bacteria 2325
299 Ga0495642_0001594 3300046528 Bacteria 9923
300 Ga0495642_0041641 3300046528 Bacteria 1868
301 Ga0495587_0108549 3300046536 Bacteria 1595
302 Ga0495609_0006609 3300046538 Bacteria 5897
303 Ga0495609_0013676 3300046538 Bacteria 3829
304 Ga0495609_0084205 3300046538 Bacteria 1388
305 Ga0495597_0011533 3300046542 Bacteria 4282
306 Ga0495597_0013765 3300046542 Bacteria 3868
307 Ga0495597_0017149 3300046542 Bacteria 3413
308 Ga0495597_0023485 3300046542 Bacteria 2851
309 Ga0495645_0013435 3300046543 Bacteria 5788
310 Ga0495633_0002302 3300046558 Bacteria 13615
311 Ga0495633_0003980 3300046558 Bacteria 9581
312 Ga0495668_0002635 3300046616 Bacteria 14419
313 Ga0495668_0005258 3300046616 Bacteria 8862
314 Ga0495668_0018645 3300046616 Bacteria 4010
315 Ga0495668_0024602 3300046616 Bacteria 3424
316 Ga0495668_0034534 3300046616 Bacteria 2836
317 Ga0495611_0000116 3300046648 Bacteria 56573
318 Ga0495611_0099822 3300046648 Bacteria 1347
319 Ga0495625_0000056 3300046660 Bacteria 186024
320 Ga0495625_0000428 3300046660 Bacteria 63353
321 Ga0495625_0016877 3300046660 Bacteria 5731
322 Ga0495659_0011695 3300046664 Bacteria 2829
323 Ga0495661_0000348 3300046665 Bacteria 50388
324 Ga0495661_0002439 3300046665 Bacteria 14321
325 Ga0495661_0036675 3300046665 Bacteria 3067
326 Ga0495623_0015847 3300046679 Bacteria 4872
327 Ga0495669_0021333 3300046684 Bacteria 2810
328 Ga0495670_0000327 3300046691 Bacteria 22730
329 Ga0495670_0028246 3300046691 Bacteria 2781
330 Ga0495649_0000183 3300046694 Bacteria 54730
331 Ga0495649_0000935 3300046694 Bacteria 23072
332 Ga0495649_0141004 3300046694 Bacteria 1269
333 Ga0495589_0000700 3300046794 Bacteria 21833
334 Ga0495660_0046121 3300046810 Bacteria 2390
335 Ga0495581_0087955 3300047315 Bacteria 1801
336 Ga0495674_0001746 3300047319 Bacteria 21389
337 Ga0495674_0015445 3300047319 Bacteria 7136
338 Ga0495672_0000118 3300047320 Bacteria 124396
339 Ga0495676_0010853 3300047321 Bacteria 8240
340 Ga0495676_0107877 3300047321 Bacteria 2049
341 Ga0495676_0217375 3300047321 Bacteria 1319
342 Ga0495683_0000492 3300047323 Bacteria 30566
343 Ga0495683_0006005 3300047323 Bacteria 6668
344 Ga0495687_000166 3300047443 Bacteria 98891
345 Ga0495687_001323 3300047443 Bacteria 23117
346 Ga0495675_0014172 3300047444 Bacteria 5042
347 Ga0495675_0024662 3300047444 Bacteria 3835
348 Ga0495677_0000291 3300047445 Bacteria 21878
349 Ga0495677_0000420 3300047445 Bacteria 18233
350 Ga0495677_0005744 3300047445 Bacteria 4702
351 Ga0495679_003122 3300047446 Bacteria 8104
352 Ga0495679_040471 3300047446 Bacteria 1448
353 Ga0495685_015900 3300047447 Bacteria 2570
354 Ga0495681_0028220 3300047470 Bacteria 2891
355 Ga0495686_0000140 3300047472 Bacteria 144956
356 Ga0495593_0097685 3300047673 Bacteria 1508
357 Ga0495602_0101058 3300048088 Bacteria 2366
358 Ga0495626_0000140 3300048091 Bacteria 91723
359 Ga0495626_0006568 3300048091 Bacteria 6599
360 Ga0495626_0010165 3300048091 Bacteria 5046
361 Ga0495626_0013998 3300048091 Bacteria 4152
362 Ga0495626_0022444 3300048091 Bacteria 3117
363 Ga0495626_0027757 3300048091 Bacteria 2749
364 Ga0495626_0051063 3300048091 Bacteria 1908
365 Ga0496108_0064572 3300048911 Bacteria 3084
366 Ga0496109_0011413 3300048912 Bacteria 7637
367 Ga0496114_0238971 3300048917 Bacteria 1597
368 Ga0496116_0001908 3300048919 Bacteria 22468
369 Ga0496117_0007953 3300048920 Bacteria 10185
370 Ga0496121_0024289 3300048924 Bacteria 5803
371 Ga0496122_0000570 3300048925 Bacteria 75506
372 Ga0496122_0001311 3300048925 Bacteria 40819
373 Ga0496123_0000438 3300048926 Bacteria 74878
374 Ga0496123_0002525 3300048926 Bacteria 22460
375 Ga0496125_0000701 3300048928 Bacteria 55423
376 Ga0496125_0001129 3300048928 Bacteria 40763
377 Ga0496125_0010468 3300048928 Bacteria 9381
378 Ga0496125_0011568 3300048928 Bacteria 8816
379 Ga0496125_0057435 3300048928 Bacteria 3151
380 Ga0496126_0064470 3300048929 Bacteria 3282
381 Ga0495678_000113 3300049459 Bacteria 96866
382 Ga0495678_011861 3300049459 Bacteria 4155
383 Ga0495682_0004641 3300049460 Bacteria 5828
384 Ga0495682_0024658 3300049460 Bacteria 2241
385 Ga0501034_0022888 3300049571 Bacteria 6366
386 Ga0501034_0121495 3300049571 Bacteria 2598
387 Ga0501046_0081053 3300049580 Bacteria 2507
388 Ga0501047_0044567 3300049581 Bacteria 4286
389 Ga0501070_0023779 3300049586 Bacteria 5135
390 Ga0501070_0071960 3300049586 Bacteria 2862
391 Ga0501070_0141763 3300049586 Bacteria 1984
392 Ga0501070_0146823 3300049586 Bacteria 1946
393 Ga0501227_003208 3300049665 Bacteria 3550
394 Ga0501233_006280 3300049668 Bacteria 2229
395 Ga0501257_007289 3300049686 Bacteria 2471
396 Ga0501080_0097005 3300049742 Bacteria 2737
397 Ga0501083_0109674 3300049744 Bacteria 1815
398 Ga0501044_0106537 3300049823 Bacteria 2815
399 Ga0501044_0316403 3300049823 Bacteria 1486
400 nmdc:mga03683_11885_c1 3300050489 Bacteria 3165
401 nmdc:mga03n38_3005_c1 3300050490 Bacteria 5337
402 nmdc:mga00v17_13655_c1 3300050491 Bacteria 4514
403 nmdc:mga0yw44_61022_c1 3300050492 Bacteria 2312
404 nmdc:mga0yw44_89677_c1 3300050492 Bacteria 1941
405 nmdc:mga0k408_17624_c1 3300050493 Bacteria 3980
406 nmdc:mga0k408_8980_c1 3300050493 Bacteria 4973
407 nmdc:mga07m45_145539_c1 3300050496 Bacteria 1374
408 nmdc:mga07m45_16357_c1 3300050496 Bacteria 3972
409 nmdc:mga07m45_23387_c2 3300050496 Bacteria 2535
410 nmdc:mga07m45_27080_c1 3300050496 Bacteria 3155
411 nmdc:mga07m45_46359_c1 3300050496 Bacteria 2442
412 nmdc:mga09592_273725_c1 3300050508 Bacteria 1464
413 nmdc:mga06r32_153503_c1 3300050510 Bacteria 2282
414 nmdc:mga08y16_11179_c1 3300050511 Bacteria 9428
415 Ga0500635_0000835 3300053080 Bacteria 7594
416 Ga0500651_0000066 3300053093 Bacteria 69313
417 Ga0500640_001927 3300053095 Bacteria 6630
418 Ga0500554_000859 3300053102 Bacteria 5975
419 Ga0500595_001688 3300053119 Bacteria 11593
420 Ga0500597_019401 3300053120 Bacteria 2654
421 Ga0500614_001209 3300053123 Bacteria 6289
422 Ga0500658_0003318 3300053134 Bacteria 6106
423 Ga0500568_0007642 3300053139 Bacteria 5281
424 Ga0500603_004495 3300053150 Bacteria 2987
425 Ga0500616_0036175 3300053153 Bacteria 2680
426 Ga0500622_0059003 3300053156 Bacteria 1960
427 2501080450 2501025502 Bacteria 9641094
428 2511088282 2510917013 Bacteria 9951648
429 2516018862 2515154189 Bacteria 9629850
430 2587756957 2585428062 Bacteria 6842168
431 2643731954 2643221541 Bacteria 5498788
432 2644041719 2643221606 Bacteria 5588032
433 2644159878 2643221628 Bacteria 5745828
434 2644302060 2643221654 Bacteria 5273570
435 2644325885 2643221658 Bacteria 6064537
436 2644394638 2643221671 Bacteria 5496681
437 2644397242 2643221672 Bacteria 6322190
438 2644464271 2643221683 Bacteria 5749203
439 2819593985 2818991445 Bacteria 4955017
440 2834642519 2834641062 Bacteria 5559922
441 2842138824 2842134933 Bacteria 5847019
442 2842680414 2842677519 Bacteria 5615038
443 2858690319 2858688981 Bacteria 8184122
444 2883092176 2883087390 Bacteria 9532701
445 2884811821 2884811622 Bacteria 5552861
446 2884839812 2884836552 Bacteria 5219991
447 2884856377 2884852848 Bacteria 5221161
448 2885197109 2885192300 Bacteria 5882526
449 2896158742 2896154374 Bacteria 5221518
450 2915359906 2915358134 Bacteria 6050864
451 2919708766 2919704043 Bacteria 5560311
452 2919720261 2919713450 Bacteria 7431245
453 2928118963 2928115317 Bacteria 6477646
454 2929522109 2929520902 Bacteria 6765052
455 2929524170 2929520902 Bacteria 6765052
456 2945947907 2945945610 Bacteria 5951079
457 8003402247 8003400568 Bacteria 5535898
458 Ga0373961_0000047
459 JGI25155J39150_1000192
460 JGI25156J39149_1000077
461 JGI25154J39366_1000103
462 JGI25151J46595_10001003
463 JGI25151J46595_10002372
464 Ga0055532_1000034
465 Ga0055526_1000810
466 Ga0055526_1001786
467 Ga0055537_1000064
468 Ga0055537_1001313
469 Ga0055524_1003189
470 Ga0055536_1000054
471 Ga0055536_1010170
472 Ga0055534_1000094
473 Ga0055534_1000338
474 Ga0055534_1001618
475 Ga0055534_1004077
476 Ga0055530_10003198
477 Ga0055530_10007178
478 Ga0055540_1002876
479 Ga0055540_1002905
480 Ga0055531_10000084
481 Ga0065714_10003682
482 Ga0065714_10023345
483 Ga0070683_100139599
484 Ga0068868_100013338
485 Ga0070689_100031447
486 Ga0070689_100040559
487 Ga0070671_100103915
488 Ga0070673_100093408
489 Ga0070678_100001450
490 Ga0070678_100024350
491 Ga0070678_100209749
492 Ga0068867_100001112
493 Ga0070706_100000246
494 Ga0070706_100098227
495 Ga0070707_100354132
496 Ga0070698_100008093
497 Ga0070698_100082117
498 Ga0070684_100392103
499 Ga0070697_100261782
500 Ga0068853_100045858
501 Ga0068853_100133514
502 Ga0070665_100007047
503 Ga0070665_100055728
504 Ga0070665_100142092
505 Ga0068855_100004730
506 Ga0068854_100027170
507 Ga0068856_100021939
508 Ga0068856_100096621
509 Ga0068859_100372441
510 Ga0068863_100072557
511 Ga0070717_10159422
512 Ga0075364_10003257
513 Ga0075362_10006366
514 Ga0075367_10039237
515 Ga0075366_10003203
516 Ga0075366_10013932
517 Ga0075366_10029966
518 Ga0075366_10080409
519 Ga0075370_10100454
520 Ga0068871_100028628
521 Ga0075430_100187826
522 Ga0068865_100119674
523 Ga0097620_100372480
524 Ga0075435_100255077
525 Ga0105244_10002080
526 Ga0105240_10002014
527 Ga0105240_10053852
528 Ga0111539_10001027
529 Ga0105245_10000560
530 Ga0105245_10028203
531 Ga0105245_10037010
532 Ga0105247_10001032
533 Ga0105243_10028166
534 Ga0105243_10043274
535 Ga0105241_10019464
536 Ga0105237_10028537
537 Ga0105237_10037273
538 Ga0105238_10008142
539 Ga0105238_10030250
540 Ga0105239_10003920
541 Ga0105246_10037290
542 Ga0105246_10081477
543 Ga0157374_10028483
544 Ga0163163_10077091
545 Ga0182008_10007203
546 Ga0182008_10048653
547 Ga0163161_10001260
548 Ga0209435_100007
549 Ga0209147_100017
550 Ga0209437_100346
551 Ga0209258_100115
552 Ga0209646_1000044
553 Ga0209026_1000063
554 Ga0209759_1000048
555 Ga0209565_1000025
556 Ga0209565_1000079
557 Ga0209673_1000149
558 Ga0209130_1002481
559 Ga0209130_1015430
560 Ga0209675_1000017
561 Ga0209675_1000063
562 Ga0209675_1002431
563 Ga0209675_1004505
564 Ga0209676_1000044
565 Ga0209676_1000123
566 Ga0209025_1000210
567 Ga0209025_1001061
568 Ga0209025_1001497
569 Ga0209025_1015608
570 Ga0209564_1000216
571 Ga0209564_1000312
572 Ga0209564_1009067
573 Ga0209050_1000188
574 Ga0209256_1000525
575 Ga0209256_1006422
576 Ga0209051_1000091
577 Ga0209051_1000128
578 Ga0209051_1006582
579 Ga0209257_1000057
580 Ga0207653_10036558
581 Ga0207710_10000603
582 Ga0207699_10209515
583 Ga0207643_10078764
584 Ga0207684_10107837
585 Ga0207695_10001014
586 Ga0207695_10013969
587 Ga0207695_10055354
588 Ga0207671_10027860
589 Ga0207671_10054129
590 Ga0207657_10144277
591 Ga0207649_10080353
592 Ga0207694_10004948
593 Ga0207650_10135151
594 Ga0207650_10235556
595 Ga0207659_10054780
596 Ga0207687_10006564
597 Ga0207687_10031688
598 Ga0207687_10128455
599 Ga0207664_10037466
600 Ga0207644_10030730
601 Ga0207644_10036217
602 Ga0207690_10243852
603 Ga0207706_10040604
604 Ga0207706_10269541
605 Ga0207709_10002095
606 Ga0207670_10020554
607 Ga0207670_10020591
608 Ga0207669_10155301
609 Ga0207711_10350958
610 Ga0207689_10078419
611 Ga0207689_10150566
612 Ga0207661_10100417
613 Ga0207667_10004674
614 Ga0207640_10098851
615 Ga0207658_10285368
616 Ga0207677_10144792
617 Ga0207678_10220803
618 Ga0207702_10113507
619 Ga0207641_10017628
620 Ga0207641_10033996
621 Ga0207641_10058252
622 Ga0207648_10010103
623 Ga0207648_10029315
624 Ga0207648_10185470
625 Ga0207676_10068074
626 Ga0207675_100100522
627 Ga0207683_10004383
628 Ga0209282_1005174
629 Ga0268266_10012838
630 Ga0268266_10022602
631 Ga0268266_10037457
632 Ga0268266_10103215
633 Ga0307517_10000463
634 Ga0307515_10000014
635 Ga0307515_10000041
636 Ga0307515_10000821
637 Ga0307515_10001078
638 Ga0307515_10002900
639 Ga0307515_10008788
640 Ga0307515_10009845
641 Ga0307515_10016846
642 Ga0307515_10085749
643 Ga0265338_10019254
644 Ga0307512_10066963
645 Ga0314311_1262448
646 Ga0316180_1083590
647 Ga0316181_1063450
648 Ga0265332_10014068
649 Ga0307513_10000012
650 Ga0307513_10010708
651 Ga0307513_10016015
652 Ga0307513_10087600
653 Ga0307513_10139548
654 Ga0307513_10303737
655 Ga0307509_10001165
656 Ga0307509_10007581
657 Ga0307509_10097413
658 Ga0307408_100001756
659 Ga0307408_100029934
660 Ga0307408_100067625
661 Ga0307508_10016865
662 Ga0307508_10028459
663 Ga0307516_10001306
664 Ga0307516_10015521
665 Ga0307516_10039074
666 Ga0307516_10195767
667 Ga0307516_10202919
668 Ga0307516_10205213
669 Ga0307405_10088798
670 Ga0307518_10075518
671 Ga0307406_10090222
672 Ga0307407_10087763
673 Ga0307412_10006505
674 Ga0307412_10008233
675 Ga0307412_10017782
676 Ga0307412_10056075
677 Ga0307412_10096103
678 Ga0307414_10027598
679 Ga0307411_10076094
680 Ga0307507_10152048
681 Ga0373949_0000061
682 Ga0395900_0230694
683 Ga0395900_0541903
684 Ga0395905_0000042
685 Ga0395901_0026249
686 Ga0395901_0375266
687 Ga0395901_0458779
688 Ga0436365_0249397
689 Ga0436362_0796005
690 Ga0439436_0002391
691 Ga0439436_0005436
692 Ga0439465_0007075
693 Ga0451793_1014845
694 Ga0451853_1116226
695 Ga0439445_0009081
696 Ga0439432_016232
697 Ga0439449_0005179
698 Ga0439449_0022542
699 Ga0439449_0040898
700 Ga0439462_0002605
701 Ga0439462_0002770
702 Ga0450911_001422
703 Ga0439446_0001676
704 Ga0439434_0001249
705 Ga0451577_0029080
706 Ga0453683_0003540
707 Ga0466966_0052959
708 Ga0466966_0087081
709 Ga0466971_0073182
710 Ga0466957_0001605
711 Ga0451576_0031686
712 Ga0451576_0297937
713 Ga0495592_0000085
714 Ga0495591_000039
715 Ga0495629_0014496
716 Ga0495638_0003255
717 Ga0495582_0022199
718 Ga0495605_0003739
719 Ga0495605_0007201
720 Ga0495605_0012853
721 Ga0495584_0000247
722 Ga0495584_0019392
723 Ga0495585_0002850
724 Ga0495585_0017664
725 Ga0495585_0019987
726 Ga0495585_0049817
727 Ga0495596_0000186
728 Ga0495596_0014765
729 Ga0495607_0009832
730 Ga0495583_0000442
731 Ga0495583_0002083
732 Ga0495583_0023142
733 Ga0495583_0030921
734 Ga0495606_0013467
735 Ga0495610_0003618
736 Ga0495616_0022031
737 Ga0495630_0228010
738 Ga0495631_0000999
739 Ga0495631_0036144
740 Ga0495632_0000669
741 Ga0495632_0002550
742 Ga0495632_0004184
743 Ga0495632_0015953
744 Ga0495637_0000006
745 Ga0495637_0010782
746 Ga0495643_0000528
747 Ga0495643_0001017
748 Ga0495643_0009313
749 Ga0495643_0011336
750 Ga0495643_0106981
751 Ga0495644_0005324
752 Ga0495644_0006591
753 Ga0495648_0017837
754 Ga0495648_0060415
755 Ga0495666_0038484
756 Ga0495642_0001594
757 Ga0495642_0041641
758 Ga0495587_0108549
759 Ga0495609_0006609
760 Ga0495609_0013676
761 Ga0495609_0084205
762 Ga0495597_0011533
763 Ga0495597_0013765
764 Ga0495597_0017149
765 Ga0495597_0023485
766 Ga0495645_0013435
767 Ga0495633_0002302
768 Ga0495633_0003980
769 Ga0495668_0002635
770 Ga0495668_0005258
771 Ga0495668_0018645
772 Ga0495668_0024602
773 Ga0495668_0034534
774 Ga0495611_0000116
775 Ga0495611_0099822
776 Ga0495625_0000056
777 Ga0495625_0000428
778 Ga0495625_0016877
779 Ga0495659_0011695
780 Ga0495661_0000348
781 Ga0495661_0002439
782 Ga0495661_0036675
783 Ga0495623_0015847
784 Ga0495669_0021333
785 Ga0495670_0000327
786 Ga0495670_0028246
787 Ga0495649_0000183
788 Ga0495649_0000935
789 Ga0495649_0141004
790 Ga0495589_0000700
791 Ga0495660_0046121
792 Ga0495581_0087955
793 Ga0495674_0001746
794 Ga0495674_0015445
795 Ga0495672_0000118
796 Ga0495676_0010853
797 Ga0495676_0107877
798 Ga0495676_0217375
799 Ga0495683_0000492
800 Ga0495683_0006005
801 Ga0495687_000166
802 Ga0495687_001323
803 Ga0495675_0014172
804 Ga0495675_0024662
805 Ga0495677_0000291
806 Ga0495677_0000420
807 Ga0495677_0005744
808 Ga0495679_003122
809 Ga0495679_040471
810 Ga0495685_015900
811 Ga0495681_0028220
812 Ga0495686_0000140
813 Ga0495593_0097685
814 Ga0495602_0101058
815 Ga0495626_0000140
816 Ga0495626_0006568
817 Ga0495626_0010165
818 Ga0495626_0013998
819 Ga0495626_0022444
820 Ga0495626_0027757
821 Ga0495626_0051063
822 Ga0496108_0064572
823 Ga0496109_0011413
824 Ga0496114_0238971
825 Ga0496116_0001908
826 Ga0496117_0007953
827 Ga0496121_0024289
828 Ga0496122_0000570
829 Ga0496122_0001311
830 Ga0496123_0000438
831 Ga0496123_0002525
832 Ga0496125_0000701
833 Ga0496125_0001129
834 Ga0496125_0010468
835 Ga0496125_0011568
836 Ga0496125_0057435
837 Ga0496126_0064470
838 Ga0495678_000113
839 Ga0495678_011861
840 Ga0495682_0004641
841 Ga0495682_0024658
842 Ga0501034_0022888
843 Ga0501034_0121495
844 Ga0501046_0081053
845 Ga0501047_0044567
846 Ga0501070_0023779
847 Ga0501070_0071960
848 Ga0501070_0141763
849 Ga0501070_0146823
850 Ga0501227_003208
851 Ga0501233_006280
852 Ga0501257_007289
853 Ga0501080_0097005
854 Ga0501083_0109674
855 Ga0501044_0106537
856 Ga0501044_0316403
857 nmdc:mga03683_11885_c1
858 nmdc:mga03n38_3005_c1
859 nmdc:mga00v17_13655_c1
860 nmdc:mga0yw44_61022_c1
861 nmdc:mga0yw44_89677_c1
862 nmdc:mga0k408_17624_c1
863 nmdc:mga0k408_8980_c1
864 nmdc:mga07m45_145539_c1
865 nmdc:mga07m45_16357_c1
866 nmdc:mga07m45_23387_c2
867 nmdc:mga07m45_27080_c1
868 nmdc:mga07m45_46359_c1
869 nmdc:mga09592_273725_c1
870 nmdc:mga06r32_153503_c1
871 nmdc:mga08y16_11179_c1
872 Ga0500635_0000835
873 Ga0500651_0000066
874 Ga0500640_001927
875 Ga0500554_000859
876 Ga0500595_001688
877 Ga0500597_019401
878 Ga0500614_001209
879 Ga0500658_0003318
880 Ga0500568_0007642
881 Ga0500603_004495
882 Ga0500616_0036175
883 Ga0500622_0059003
884 2501080450
885 2511088282
886 2516018862
887 2587756957
888 2643731954
889 2644041719
890 2644159878
891 2644302060
892 2644325885
893 2644394638
894 2644397242
895 2644464271
896 2819593985
897 2834642519
898 2842138824
899 2842680414
900 2858690319
901 2883092176
902 2884811821
903 2884839812
904 2884856377
905 2885197109
906 2896158742
907 2915359906
908 2919708766
909 2919720261
910 2928118963
911 2929522109
912 2929524170
913 2945947907
914 8003402247

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02803

Thiolase_C

Thiolase, C-terminal domain

263

369

0.93

PF22691

Thiolase_C_1

Thiolase C-terminal domain-like

254

392

0.92

PF00108

Thiolase_N

Thiolase, N-terminal domain

7

230

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hsp-assembly2.cif.gz_B-2 crystal structure of the zebrafish peroxisomal scp2-thiolase (type-1) in complex with coa and octanoyl-coa 0.9803 4 394
6hrv-assembly2.cif.gz_B crystal structure of the zebrafish peroxisomal scp2-thiolase (type-1) 0.9786 4 393
6hsp-assembly2.cif.gz_B-2 crystal structure of the zebrafish peroxisomal scp2-thiolase (type-1) in complex with coa and octanoyl-coa 0.9703 4 394
6hrv-assembly2.cif.gz_B crystal structure of the zebrafish peroxisomal scp2-thiolase (type-1) 0.9662 4 393
7yvy-assembly3.cif.gz_C crystal structure of thiolase pfc_04095 from pyrococcus furiosus 0.9365 4 392
ID Description Score Start End Superfamily
af_Q6P4V5_7_398_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9868 4 392 3.40.47.10
af_Q6P4V5_7_398_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9768 4 392 3.40.47.10
af_Q69UB7_33_233_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9064 25 109 3.40.47.10
4yzoB00 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9013 6 395 3.40.47.10
4yzoB00 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.8963 6 395 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A2N1YJW7-F1-model_v4 propanoyl-CoA C-acyltransferase (EC 2.3.1.176) (Propanoyl-CoA C-acyltransferase) 0.9984 277 394 GO:0005777
GO:0006869
GO:0008289
GO:0016747
AF-A0A840P4P9-F1-model_v4 propanoyl-CoA C-acyltransferase (EC 2.3.1.176) (Propanoyl-CoA C-acyltransferase) 0.9974 261 395 GO:0005777
GO:0006869
GO:0008289
GO:0016747
AF-A0A821Z9E5-F1-model_v4 propanoyl-CoA C-acyltransferase (EC 2.3.1.176) (Propanoyl-CoA C-acyltransferase) 0.9971 268 395 GO:0005777
GO:0006869
GO:0008289
GO:0016747
AF-A0A6G9CZY5-F1-model_v4 propanoyl-CoA C-acyltransferase (EC 2.3.1.176) (Propanoyl-CoA C-acyltransferase) 0.9952 13 395 GO:0005777
GO:0006869
GO:0008289
GO:0016747
AF-A0A1Z9TP41-F1-model_v4 propanoyl-CoA C-acyltransferase (EC 2.3.1.176) (Propanoyl-CoA C-acyltransferase) 0.9951 161 394 GO:0005777
GO:0006869
GO:0008289
GO:0016747

Map