F447975

General Info

Members Datasets Scaffolds Average Seq Length
457 232 914 180

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10008843|Ga0105240_100088435
Length 198
Sequence MNTEEHTVLVDFPSEVPTAAEERALYGLMAEFEEHEQLVEAAKRAHAAGYREMDAFSPFPVEGLAEALGHEGSSVPLFTLLGGMAGGLGGYFMEWYSMARLYPFNVGGRPHNSWPNFIPVTFELTVLIASLSAFVSMLILNRLPQPHHPVFNVPEFRRASIDRFFLCIETEDPQFNQAATWRFLERLKPVRISEVWDE

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
56 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
118 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
121 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
122 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
123 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
125 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
135 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
136 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
137 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
138 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
139 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
140 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
141 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
148 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
149 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
150 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
153 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
154 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
155 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
156 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
159 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
160 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
161 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
164 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
167 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
170 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
171 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
187 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
199 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
200 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
201 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
204 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
205 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
206 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
207 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
212 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
218 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
219 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
220 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
221 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
222 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
223 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
224 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
232 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.5
Metatranscriptomes 3.5
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.31
Nodule 0
Rhizoplane 5.03
Rhizosphere 92.56
Stem 0
Stem Tuber 0
Unclassified 23.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10008843 3300009093 Bacteria 14341
2 rootH1_10112701 3300003323 Bacteria 1619
3 Ga0055540_1043463 3300003792 Bacteria 958
4 Ga0058863_10053560 3300004799 Bacteria 5869
5 Ga0058861_10010186 3300004800 Bacteria 4180
6 Ga0058861_12063059 3300004800 Bacteria 4115
7 Ga0058862_10061456 3300004803 Bacteria 7933
8 Ga0058862_12281400 3300004803 Unclassified 725
9 Ga0070658_10306663 3300005327 Bacteria 1354
10 Ga0070658_10485874 3300005327 Bacteria 1066
11 Ga0070683_100113834 3300005329 Bacteria 2553
12 Ga0070683_100442654 3300005329 Bacteria 1240
13 Ga0070683_101468358 3300005329 Bacteria 655
14 Ga0070670_100704141 3300005331 Unclassified 908
15 Ga0070680_100008830 3300005336 Bacteria 7728
16 Ga0070680_100111214 3300005336 Unclassified 2280
17 Ga0070680_100389484 3300005336 Bacteria 1187
18 Ga0070680_100436678 3300005336 Bacteria 1118
19 Ga0070682_100159247 3300005337 Bacteria 1557
20 Ga0068868_100006831 3300005338 Bacteria 8101
21 Ga0070660_100341052 3300005339 Unclassified 1233
22 Ga0070691_10001067 3300005341 Bacteria 11332
23 Ga0070691_10050839 3300005341 Bacteria 1978
24 Ga0070691_10070516 3300005341 Bacteria 1695
25 Ga0070669_100097138 3300005353 Unclassified 2217
26 Ga0070671_100200917 3300005355 Bacteria 1690
27 Ga0070709_10503242 3300005434 Unclassified 920
28 Ga0070714_100014998 3300005435 Bacteria 6229
29 Ga0070714_100143780 3300005435 Bacteria 2143
30 Ga0070714_100425285 3300005435 Unclassified 1259
31 Ga0070714_100631250 3300005435 Unclassified 1030
32 Ga0070714_101395746 3300005435 Bacteria 684
33 Ga0070713_100222013 3300005436 Bacteria 1714
34 Ga0070711_100003054 3300005439 Bacteria 9671
35 Ga0070711_100929974 3300005439 Unclassified 743
36 Ga0070708_100016014 3300005445 Bacteria 6210
37 Ga0070708_100894453 3300005445 Unclassified 834
38 Ga0070681_10000261 3300005458 Bacteria 42065
39 Ga0070681_10007715 3300005458 Bacteria 10517
40 Ga0070681_10042596 3300005458 Bacteria 4549
41 Ga0070681_10201787 3300005458 Bacteria 1907
42 Ga0070681_10342983 3300005458 Bacteria 1404
43 Ga0070681_10405857 3300005458 Unclassified 1274
44 Ga0070707_100062438 3300005468 Bacteria 3574
45 Ga0070707_100337633 3300005468 Bacteria 1464
46 Ga0070699_100015103 3300005518 Bacteria 6635
47 Ga0070679_100001058 3300005530 Bacteria 24000
48 Ga0070679_100012566 3300005530 Bacteria 8097
49 Ga0070679_100013086 3300005530 Bacteria 7946
50 Ga0070679_100118111 3300005530 Bacteria 2637
51 Ga0070679_100174864 3300005530 Unclassified 2119
52 Ga0070679_100209791 3300005530 Bacteria 1912
53 Ga0070679_100982182 3300005530 Bacteria 788
54 Ga0070684_100852823 3300005535 Bacteria 853
55 Ga0070697_100530951 3300005536 Bacteria 1031
56 Ga0068853_100167714 3300005539 Unclassified 1985
57 Ga0070686_100205083 3300005544 Bacteria 1416
58 Ga0070695_100770637 3300005545 Unclassified 769
59 Ga0070696_101371774 3300005546 Unclassified 602
60 Ga0070693_100026287 3300005547 Bacteria 3141
61 Ga0068855_100018336 3300005563 Bacteria 8408
62 Ga0068855_100061338 3300005563 Bacteria 4394
63 Ga0068855_100164276 3300005563 Unclassified 2518
64 Ga0068855_100361773 3300005563 Bacteria 1596
65 Ga0068855_100363930 3300005563 Unclassified 1591
66 Ga0068855_101671596 3300005563 Bacteria 650
67 Ga0068857_100004033 3300005577 Bacteria 12363
68 Ga0068857_100117720 3300005577 Bacteria 2391
69 Ga0068854_100026058 3300005578 Bacteria 4015
70 Ga0068854_100836810 3300005578 Bacteria 805
71 Ga0068856_100052969 3300005614 Bacteria 4002
72 Ga0068856_100146178 3300005614 Bacteria 2372
73 Ga0068856_100153288 3300005614 Bacteria 2314
74 Ga0068856_100921797 3300005614 Unclassified 892
75 Ga0068852_100007405 3300005616 Bacteria 8011
76 Ga0068852_100103108 3300005616 Bacteria 2579
77 Ga0068866_10193032 3300005718 Unclassified 1211
78 Ga0068863_100018171 3300005841 Bacteria 6733
79 Ga0068863_100983120 3300005841 Bacteria 846
80 Ga0068862_101641244 3300005844 Bacteria 650
81 Ga0081539_10001712 3300005985 Bacteria 35198
82 Ga0081539_10171674 3300005985 Bacteria 1025
83 Ga0070717_10074910 3300006028 Bacteria 2830
84 Ga0070717_10142151 3300006028 Bacteria 2071
85 Ga0070717_10221819 3300006028 Bacteria 1662
86 Ga0070717_10222719 3300006028 Unclassified 1658
87 Ga0070717_10361954 3300006028 Bacteria 1298
88 Ga0070717_11532725 3300006028 Unclassified 605
89 Ga0075363_100243467 3300006048 Unclassified 1034
90 Ga0070715_10005978 3300006163 Bacteria 4103
91 Ga0070715_10047276 3300006163 Bacteria 1833
92 Ga0070715_10333439 3300006163 Unclassified 823
93 Ga0070716_100000297 3300006173 Bacteria 20076
94 Ga0070716_100003953 3300006173 Bacteria 7032
95 Ga0070712_100010506 3300006175 Bacteria 5844
96 Ga0070712_100063227 3300006175 Bacteria 2620
97 Ga0070712_100295570 3300006175 Unclassified 1309
98 Ga0097621_100058644 3300006237 Unclassified 3149
99 Ga0097621_100335633 3300006237 Unclassified 1341
100 Ga0097621_100345187 3300006237 Bacteria 1322
101 Ga0097621_101298961 3300006237 Unclassified 687
102 Ga0068871_100062095 3300006358 Bacteria 3053
103 Ga0068871_100284846 3300006358 Bacteria 1446
104 Ga0068871_100405145 3300006358 Unclassified 1215
105 Ga0075431_100260779 3300006847 Bacteria 1759
106 Ga0075433_10465983 3300006852 Unclassified 1113
107 Ga0075434_100018450 3300006871 Bacteria 6742
108 Ga0075434_100313055 3300006871 Bacteria 1590
109 Ga0075429_100575608 3300006880 Bacteria 987
110 Ga0075436_100216390 3300006914 Bacteria 1359
111 Ga0075435_100023610 3300007076 Unclassified 4759
112 Ga0075435_100056835 3300007076 Bacteria 3164
113 Ga0075435_101071427 3300007076 Bacteria 704
114 Ga0099794_10010558 3300007265 Bacteria 3927
115 Ga0099794_10012806 3300007265 Unclassified 3633
116 Ga0099794_10023137 3300007265 Bacteria 2839
117 Ga0099794_10042316 3300007265 Bacteria 2171
118 Ga0099794_10163697 3300007265 Bacteria 1132
119 Ga0099794_10436467 3300007265 Unclassified 686
120 Ga0099795_10066244 3300007788 Unclassified 1352
121 Ga0099795_10129612 3300007788 Bacteria 1016
122 Ga0105240_10021605 3300009093 Bacteria 8559
123 Ga0105240_10061206 3300009093 Bacteria 4692
124 Ga0105240_10267467 3300009093 Bacteria 1970
125 Ga0105240_10862042 3300009093 Bacteria 977
126 Ga0105245_11025371 3300009098 Bacteria 870
127 Ga0105237_11201270 3300009545 Bacteria 765
128 Ga0105238_10011868 3300009551 Bacteria 8775
129 Ga0105238_10012970 3300009551 Bacteria 8414
130 Ga0105238_10070272 3300009551 Bacteria 3500
131 Ga0105238_10320944 3300009551 Unclassified 1535
132 Ga0099796_10012411 3300010159 Bacteria 2406
133 Ga0105239_10165178 3300010375 Bacteria 2475
134 Ga0105239_10218133 3300010375 Bacteria 2139
135 Ga0105239_11046263 3300010375 Unclassified 939
136 Ga0157371_10412777 3300013102 Archaea 989
137 Ga0157370_10018981 3300013104 Bacteria 6913
138 Ga0157370_10069113 3300013104 Unclassified 3336
139 Ga0157370_10078677 3300013104 Unclassified 3105
140 Ga0157370_10105807 3300013104 Bacteria 2633
141 Ga0157370_10244769 3300013104 Bacteria 1659
142 Ga0157369_10033616 3300013105 Bacteria 5635
143 Ga0157369_10066338 3300013105 Bacteria 3883
144 Ga0157369_10071326 3300013105 Bacteria 3729
145 Ga0157369_10213695 3300013105 Bacteria 2021
146 Ga0157369_10723843 3300013105 Unclassified 1024
147 Ga0157374_10010978 3300013296 Bacteria 7821
148 Ga0157378_10213118 3300013297 Bacteria 1832
149 Ga0157378_10249391 3300013297 Bacteria 1699
150 Ga0157372_10361759 3300013307 Bacteria 1691
151 Ga0157372_10838573 3300013307 Bacteria 1067
152 Ga0182008_10011658 3300014497 Bacteria 4666
153 Ga0157379_10348427 3300014968 Bacteria 1355
154 Ga0157376_10000005 3300014969 Bacteria 443695
155 Ga0157376_10004386 3300014969 Bacteria 9822
156 Ga0182006_1066511 3300015261 Bacteria 1347
157 Ga0163161_10362216 3300017792 Unclassified 1155
158 Ga0206352_10157314 3300020078 Unclassified 1188
159 Ga0206350_10074510 3300020080 Unclassified 1295
160 Ga0154015_1170078 3300020610 Unclassified 1130
161 Ga0213875_10000164 3300021388 Bacteria 69199
162 Ga0224712_10000802 3300022467 Bacteria 6629
163 Ga0209051_1011418 3300025303 Bacteria 4386
164 Ga0209051_1037834 3300025303 Bacteria 1764
165 Ga0207697_10121625 3300025315 Unclassified 1124
166 Ga0207692_10262107 3300025898 Unclassified 1039
167 Ga0207685_10284140 3300025905 Unclassified 813
168 Ga0207699_10153886 3300025906 Bacteria 1524
169 Ga0207699_10406743 3300025906 Bacteria 970
170 Ga0207705_10180832 3300025909 Bacteria 1591
171 Ga0207707_10000003 3300025912 Bacteria 642592
172 Ga0207707_10002748 3300025912 Bacteria 15700
173 Ga0207707_10127653 3300025912 Bacteria 2224
174 Ga0207707_10182817 3300025912 Bacteria 1830
175 Ga0207695_10024625 3300025913 Bacteria 6763
176 Ga0207695_10093386 3300025913 Bacteria 3018
177 Ga0207695_10160332 3300025913 Bacteria 2181
178 Ga0207695_10264811 3300025913 Bacteria 1616
179 Ga0207695_10414233 3300025913 Bacteria 1232
180 Ga0207695_10479246 3300025913 Unclassified 1126
181 Ga0207671_10271667 3300025914 Unclassified 1336
182 Ga0207693_10040199 3300025915 Bacteria 3683
183 Ga0207693_10062880 3300025915 Unclassified 2908
184 Ga0207693_10220140 3300025915 Bacteria 1491
185 Ga0207663_10003858 3300025916 Bacteria 7397
186 Ga0207663_10169672 3300025916 Unclassified 1549
187 Ga0207660_10002758 3300025917 Bacteria 11510
188 Ga0207660_10004566 3300025917 Bacteria 9017
189 Ga0207660_10075221 3300025917 Bacteria 2466
190 Ga0207660_10109358 3300025917 Bacteria 2077
191 Ga0207660_10588203 3300025917 Bacteria 906
192 Ga0207660_10791910 3300025917 Bacteria 774
193 Ga0207657_10128757 3300025919 Bacteria 2077
194 Ga0207652_10000024 3300025921 Bacteria 157748
195 Ga0207652_10016335 3300025921 Bacteria 6059
196 Ga0207652_10394142 3300025921 Unclassified 1249
197 Ga0207652_10439559 3300025921 Unclassified 1176
198 Ga0207652_10561484 3300025921 Bacteria 1025
199 Ga0207646_10292503 3300025922 Bacteria 1472
200 Ga0207681_10020064 3300025923 Bacteria 4232
201 Ga0207694_10007201 3300025924 Bacteria 8449
202 Ga0207694_10027533 3300025924 Bacteria 4329
203 Ga0207694_10089838 3300025924 Bacteria 2423
204 Ga0207694_10228538 3300025924 Bacteria 1519
205 Ga0207650_10599779 3300025925 Bacteria 926
206 Ga0207687_10008058 3300025927 Bacteria 6894
207 Ga0207687_10089542 3300025927 Bacteria 2241
208 Ga0207700_10039227 3300025928 Bacteria 3445
209 Ga0207700_10156072 3300025928 Bacteria 1891
210 Ga0207700_10252062 3300025928 Bacteria 1508
211 Ga0207700_10532214 3300025928 Bacteria 1042
212 Ga0207700_10739128 3300025928 Unclassified 879
213 Ga0207700_10980427 3300025928 Unclassified 756
214 Ga0207664_10021222 3300025929 Bacteria 4825
215 Ga0207664_10257906 3300025929 Bacteria 1524
216 Ga0207664_10418097 3300025929 Unclassified 1194
217 Ga0207664_10647257 3300025929 Bacteria 950
218 Ga0207664_11022895 3300025929 Unclassified 740
219 Ga0207644_10142881 3300025931 Unclassified 1845
220 Ga0207704_11278496 3300025938 Unclassified 627
221 Ga0207665_10000020 3300025939 Bacteria 117316
222 Ga0207665_10018216 3300025939 Bacteria 4614
223 Ga0207665_10211448 3300025939 Bacteria 1417
224 Ga0207661_10016372 3300025944 Bacteria 5468
225 Ga0207661_10117024 3300025944 Bacteria 2263
226 Ga0207661_10251540 3300025944 Unclassified 1571
227 Ga0207661_10314373 3300025944 Bacteria 1407
228 Ga0207661_10787017 3300025944 Unclassified 876
229 Ga0207679_10813680 3300025945 Bacteria 852
230 Ga0207667_10023516 3300025949 Bacteria 6784
231 Ga0207667_10033862 3300025949 Bacteria 5489
232 Ga0207667_10035437 3300025949 Bacteria 5353
233 Ga0207667_10222263 3300025949 Unclassified 1935
234 Ga0207668_10809641 3300025972 Unclassified 830
235 Ga0207640_10039965 3300025981 Bacteria 2973
236 Ga0207640_10079817 3300025981 Bacteria 2231
237 Ga0207677_10333865 3300026023 Bacteria 1264
238 Ga0207677_10527932 3300026023 Unclassified 1025
239 Ga0207639_10010633 3300026041 Bacteria 6372
240 Ga0207702_10115686 3300026078 Bacteria 2392
241 Ga0207702_10252578 3300026078 Unclassified 1656
242 Ga0207702_10402796 3300026078 Unclassified 1320
243 Ga0207702_11090187 3300026078 Bacteria 792
244 Ga0207641_10237426 3300026088 Bacteria 1697
245 Ga0207674_10007451 3300026116 Bacteria 12754
246 Ga0207674_10135714 3300026116 Bacteria 2422
247 Ga0207674_10284026 3300026116 Bacteria 1603
248 Ga0207675_101083061 3300026118 Bacteria 821
249 Ga0207698_10036750 3300026142 Bacteria 3599
250 Ga0207698_10162587 3300026142 Bacteria 1955
251 Ga0207698_10955953 3300026142 Unclassified 866
252 Ga0209588_1011402 3300027671 Unclassified 2684
253 Ga0209588_1034100 3300027671 Bacteria 1634
254 Ga0209588_1070124 3300027671 Bacteria 1132
255 Ga0209588_1079441 3300027671 Unclassified 1060
256 Ga0209588_1083659 3300027671 Unclassified 1030
257 Ga0209588_1112399 3300027671 Bacteria 875
258 Ga0268265_10518090 3300028380 Bacteria 1127
259 Ga0268264_10174741 3300028381 Bacteria 1946
260 Ga0373926_0049678 3300035083 Bacteria 1511
261 Ga0373923_0111706 3300035111 Bacteria 1214
262 Ga0373923_0240864 3300035111 Unclassified 845
263 Ga0373923_0596883 3300035111 Unclassified 543
264 Ga0373936_0231543 3300035113 Unclassified 822
265 Ga0373954_0193071 3300035118 Bacteria 1000
266 Ga0373955_0142574 3300035172 Bacteria 1406
267 Ga0373924_0163239 3300035410 Unclassified 977
268 Ga0373935_0003428 3300035692 Bacteria 9212
269 Ga0373935_0017550 3300035692 Bacteria 4345
270 Ga0373935_0166813 3300035692 Bacteria 1504
271 Ga0373927_0073083 3300035695 Bacteria 2220
272 Ga0373947_0005378 3300035725 Bacteria 7471
273 Ga0373947_0598386 3300035725 Unclassified 751
274 Ga0373937_0000340 3300036401 Bacteria 44240
275 Ga0373937_0066068 3300036401 Bacteria 3330
276 Ga0373937_0351653 3300036401 Bacteria 1396
277 Ga0373937_0592746 3300036401 Unclassified 1052
278 Ga0373937_0646484 3300036401 Unclassified 1003
279 Ga0373925_0002562 3300037068 Bacteria 14479
280 Ga0373925_0124159 3300037068 Bacteria 2007
281 Ga0373925_0289779 3300037068 Unclassified 1320
282 Ga0395899_0004441 3300037312 Bacteria 10939
283 Ga0395899_0014116 3300037312 Bacteria 6096
284 Ga0395899_0607564 3300037312 Unclassified 696
285 Ga0395900_0000016 3300037418 Bacteria 382407
286 Ga0395900_0023776 3300037418 Bacteria 6269
287 Ga0395900_0562453 3300037418 Bacteria 1084
288 Ga0395898_0009246 3300037466 Bacteria 10366
289 Ga0395898_0017364 3300037466 Bacteria 7351
290 Ga0395898_0035198 3300037466 Bacteria 4983
291 Ga0395898_0675423 3300037466 Bacteria 975
292 Ga0395898_1458263 3300037466 Unclassified 611
293 Ga0395905_0006525 3300037471 Bacteria 11733
294 Ga0395905_0554332 3300037471 Bacteria 1050
295 Ga0395905_0973308 3300037471 Unclassified 751
296 Ga0395905_1620208 3300037471 Bacteria 552
297 Ga0436364_0379917 3300037853 Bacteria 167058
298 Ga0395901_0000022 3300038443 Bacteria 296356
299 Ga0395901_0123076 3300038443 Bacteria 2726
300 Ga0395901_0129191 3300038443 Bacteria 2655
301 Ga0395901_0230074 3300038443 Bacteria 1936
302 Ga0395901_0244809 3300038443 Bacteria 1869
303 Ga0395901_0278056 3300038443 Bacteria 1740
304 Ga0395901_0429457 3300038443 Bacteria 1354
305 Ga0451853_3401108 3300041512 Bacteria 930
306 Ga0466972_0011409 3300044658 Bacteria 4459
307 Ga0466972_0348573 3300044658 Bacteria 693
308 Ga0466965_0054240 3300044683 Bacteria 1993
309 Ga0466966_0012920 3300044684 Bacteria 5529
310 Ga0466966_0131520 3300044684 Bacteria 1532
311 Ga0466961_0020224 3300044693 Bacteria 4283
312 Ga0466961_0046406 3300044693 Bacteria 2779
313 Ga0466963_0008341 3300044694 Bacteria 6207
314 Ga0466963_0254152 3300044694 Bacteria 1233
315 Ga0466964_0109911 3300044706 Unclassified 1228
316 Ga0466964_0206704 3300044706 Bacteria 946
317 Ga0466971_0025763 3300044719 Bacteria 2627
318 Ga0466957_0003501 3300044842 Bacteria 8626
319 Ga0466957_0274417 3300044842 Bacteria 1127
320 Ga0466957_0666492 3300044842 Bacteria 732
321 Ga0466959_0021002 3300045049 Bacteria 4814
322 Ga0466959_0028651 3300045049 Bacteria 4129
323 Ga0451576_0142336 3300045051 Bacteria 2501
324 Ga0451576_0195431 3300045051 Unclassified 2113
325 Ga0451576_1775622 3300045051 Unclassified 638
326 Ga0466958_0261972 3300045836 Bacteria 1107
327 Ga0466958_0475151 3300045836 Bacteria 810
328 Ga0466967_0330538 3300045976 Unclassified 1472
329 Ga0466967_0363685 3300045976 Bacteria 1402
330 Ga0495592_0013124 3300046454 Bacteria 6305
331 Ga0495629_0024463 3300046459 Bacteria 4301
332 Ga0495641_0221210 3300046461 Unclassified 849
333 Ga0495651_0012559 3300046462 Bacteria 6536
334 Ga0495580_0001149 3300046472 Bacteria 23327
335 Ga0495582_0033420 3300046473 Bacteria 2827
336 Ga0495639_0007749 3300046475 Bacteria 4617
337 Ga0495664_0311214 3300046477 Unclassified 950
338 Ga0495607_0000060 3300046501 Bacteria 108449
339 Ga0495628_0051648 3300046516 Bacteria 3250
340 Ga0495628_0112794 3300046516 Bacteria 2090
341 Ga0495630_0010636 3300046517 Bacteria 6643
342 Ga0495630_0210626 3300046517 Bacteria 1483
343 Ga0495666_0022303 3300046526 Bacteria 3135
344 Ga0495586_0306006 3300046535 Bacteria 911
345 Ga0495587_0271882 3300046536 Bacteria 951
346 Ga0495645_0116541 3300046543 Bacteria 1885
347 Ga0495645_0535970 3300046543 Unclassified 727
348 Ga0495634_0018975 3300046642 Bacteria 4890
349 Ga0495599_0011070 3300046678 Bacteria 5534
350 Ga0495599_0156701 3300046678 Bacteria 1409
351 Ga0495599_0511697 3300046678 Unclassified 706
352 Ga0495647_0009655 3300046681 Bacteria 3273
353 Ga0495658_0022074 3300046683 Bacteria 3363
354 Ga0495658_0459523 3300046683 Unclassified 813
355 Ga0495658_0569169 3300046683 Bacteria 726
356 Ga0495669_0069586 3300046684 Bacteria 1602
357 Ga0495604_0159107 3300047317 Bacteria 1597
358 Ga0495604_0183594 3300047317 Bacteria 1462
359 Ga0495674_0100363 3300047319 Bacteria 2463
360 Ga0495676_0061168 3300047321 Bacteria 2947
361 Ga0495680_0664427 3300047322 Unclassified 691
362 Ga0495675_0078713 3300047444 Bacteria 2076
363 Ga0495684_0053163 3300047471 Unclassified 3090
364 Ga0495626_0197645 3300048091 Unclassified 826
365 Ga0496100_0133703 3300048903 Bacteria 1750
366 Ga0496101_0153573 3300048904 Bacteria 1762
367 Ga0496102_0747008 3300048905 Bacteria 901
368 Ga0496104_0056079 3300048907 Bacteria 3726
369 Ga0496104_0097523 3300048907 Bacteria 2814
370 Ga0496104_0156694 3300048907 Bacteria 2185
371 Ga0496104_0713730 3300048907 Unclassified 910
372 Ga0496105_0007596 3300048908 Bacteria 8405
373 Ga0496105_0219478 3300048908 Bacteria 1548
374 Ga0496106_0316386 3300048909 Unclassified 1253
375 Ga0496107_0497397 3300048910 Unclassified 904
376 Ga0496110_0011844 3300048913 Bacteria 7162
377 Ga0496111_0002177 3300048914 Bacteria 11737
378 Ga0496112_0233609 3300048915 Unclassified 1793
379 Ga0496112_0624595 3300048915 Unclassified 1008
380 Ga0496112_0643936 3300048915 Bacteria 990
381 Ga0496114_0002982 3300048917 Bacteria 12980
382 Ga0496114_0039972 3300048917 Bacteria 3882
383 Ga0496114_0051194 3300048917 Bacteria 3438
384 Ga0496114_0366845 3300048917 Bacteria 1274
385 Ga0496115_0005268 3300048918 Bacteria 9400
386 Ga0496115_0037093 3300048918 Bacteria 3862
387 Ga0496115_0745853 3300048918 Unclassified 766
388 Ga0496124_0000661 3300048927 Bacteria 56824
389 Ga0501032_0002690 3300049569 Bacteria 13856
390 Ga0501032_0345639 3300049569 Bacteria 958
391 Ga0501033_0002886 3300049570 Bacteria 14393
392 Ga0501033_0056572 3300049570 Bacteria 2899
393 Ga0501033_0512147 3300049570 Bacteria 829
394 Ga0501034_0019471 3300049571 Bacteria 6941
395 Ga0501034_0023221 3300049571 Bacteria 6319
396 Ga0501036_0006992 3300049572 Bacteria 9184
397 Ga0501037_0011253 3300049573 Bacteria 6587
398 Ga0501037_0510632 3300049573 Bacteria 814
399 Ga0501038_0003476 3300049574 Bacteria 14676
400 Ga0501039_0009816 3300049575 Bacteria 7294
401 Ga0501043_0000305 3300049579 Bacteria 44560
402 Ga0501043_0007956 3300049579 Bacteria 8376
403 Ga0501046_0000385 3300049580 Bacteria 44283
404 Ga0501046_0000723 3300049580 Bacteria 31896
405 Ga0501046_0778482 3300049580 Bacteria 671
406 Ga0501047_0000365 3300049581 Bacteria 51203
407 Ga0501047_0014029 3300049581 Bacteria 7614
408 Ga0501047_0017428 3300049581 Bacteria 6879
409 Ga0501047_0240262 3300049581 Bacteria 1662
410 Ga0501048_0001146 3300049582 Bacteria 19894
411 Ga0501048_0025332 3300049582 Bacteria 4323
412 Ga0501067_0087533 3300049583 Bacteria 1728
413 Ga0501068_0050822 3300049584 Bacteria 2506
414 Ga0501069_0003860 3300049585 Bacteria 7719
415 Ga0501070_0000809 3300049586 Bacteria 28427
416 Ga0501073_0007452 3300049589 Bacteria 8135
417 Ga0501073_0016949 3300049589 Bacteria 5276
418 Ga0501074_0008671 3300049590 Bacteria 7364
419 Ga0501198_000018 3300049649 Bacteria 91465
420 Ga0501222_000058 3300049662 Bacteria 36531
421 Ga0501257_002531 3300049686 Bacteria 3856
422 Ga0501079_0013249 3300049741 Bacteria 6287
423 Ga0501080_0001079 3300049742 Bacteria 22484
424 Ga0501080_0016520 3300049742 Bacteria 6819
425 Ga0501083_0007287 3300049744 Bacteria 7844
426 Ga0501035_0015448 3300049822 Bacteria 7042
427 Ga0501035_0056803 3300049822 Bacteria 3491
428 Ga0501044_0000787 3300049823 Bacteria 38327
429 Ga0501044_0011866 3300049823 Bacteria 9440
430 Ga0501044_0191962 3300049823 Bacteria 2005
431 nmdc:mga09592_637841_c1 3300050508 Bacteria 910
432 nmdc:mga0n895_39959_c1 3300050512 Unclassified 4556
433 nmdc:mga0n895_423205_c1 3300050512 Bacteria 1346
434 nmdc:mga0rr50_1025223_c1 3300050513 Bacteria 703
435 nmdc:mga0rr50_188564_c1 3300050513 Bacteria 1689
436 nmdc:mga0rr50_52416_c1 3300050513 Unclassified 3032
437 nmdc:mga08x19_133387_c1 3300050514 Bacteria 1672
438 nmdc:mga0a205_358028_c1 3300050515 Unclassified 1326
439 nmdc:mga0a205_377514_c1 3300050515 Bacteria 1283
440 Ga0495601_0038010 3300053077 Bacteria 3009
441 Ga0495601_0083673 3300053077 Bacteria 2049
442 Ga0495612_0137004 3300053078 Unclassified 1060
443 Ga0500635_0072656 3300053080 Bacteria 1223
444 Ga0495595_0335133 3300053084 Unclassified 763
445 Ga0495619_0348912 3300053085 Unclassified 1024
446 Ga0500636_0005778 3300053177 Bacteria 7083
447 Ga0501084_0584770 3300054114 Bacteria 944
448 Ga0587083_0002623 3300059505 Bacteria 2272
449 Ga0587088_018985 3300059508 Bacteria 1126
450 Ga0587091_065172 3300059511 Unclassified 783
451 Ga0587072_077363 3300059643 Unclassified 713
452 Ga0587079_014444 3300059647 Unclassified 1326
453 Ga0587102_010959 3300059649 Bacteria 905
454 Ga0587071_012261 3300060344 Bacteria 1460
455 Ga0501082_0007897 3300060353 Bacteria 9186
456 Ga0466962_0021468 3300061719 Bacteria 3100
457 Ga0466962_0331376 3300061719 Bacteria 756
458 Ga0105240_10008843
459 rootH1_10112701
460 Ga0055540_1043463
461 Ga0058863_10053560
462 Ga0058861_10010186
463 Ga0058861_12063059
464 Ga0058862_10061456
465 Ga0058862_12281400
466 Ga0070658_10306663
467 Ga0070658_10485874
468 Ga0070683_100113834
469 Ga0070683_100442654
470 Ga0070683_101468358
471 Ga0070670_100704141
472 Ga0070680_100008830
473 Ga0070680_100111214
474 Ga0070680_100389484
475 Ga0070680_100436678
476 Ga0070682_100159247
477 Ga0068868_100006831
478 Ga0070660_100341052
479 Ga0070691_10001067
480 Ga0070691_10050839
481 Ga0070691_10070516
482 Ga0070669_100097138
483 Ga0070671_100200917
484 Ga0070709_10503242
485 Ga0070714_100014998
486 Ga0070714_100143780
487 Ga0070714_100425285
488 Ga0070714_100631250
489 Ga0070714_101395746
490 Ga0070713_100222013
491 Ga0070711_100003054
492 Ga0070711_100929974
493 Ga0070708_100016014
494 Ga0070708_100894453
495 Ga0070681_10000261
496 Ga0070681_10007715
497 Ga0070681_10042596
498 Ga0070681_10201787
499 Ga0070681_10342983
500 Ga0070681_10405857
501 Ga0070707_100062438
502 Ga0070707_100337633
503 Ga0070699_100015103
504 Ga0070679_100001058
505 Ga0070679_100012566
506 Ga0070679_100013086
507 Ga0070679_100118111
508 Ga0070679_100174864
509 Ga0070679_100209791
510 Ga0070679_100982182
511 Ga0070684_100852823
512 Ga0070697_100530951
513 Ga0068853_100167714
514 Ga0070686_100205083
515 Ga0070695_100770637
516 Ga0070696_101371774
517 Ga0070693_100026287
518 Ga0068855_100018336
519 Ga0068855_100061338
520 Ga0068855_100164276
521 Ga0068855_100361773
522 Ga0068855_100363930
523 Ga0068855_101671596
524 Ga0068857_100004033
525 Ga0068857_100117720
526 Ga0068854_100026058
527 Ga0068854_100836810
528 Ga0068856_100052969
529 Ga0068856_100146178
530 Ga0068856_100153288
531 Ga0068856_100921797
532 Ga0068852_100007405
533 Ga0068852_100103108
534 Ga0068866_10193032
535 Ga0068863_100018171
536 Ga0068863_100983120
537 Ga0068862_101641244
538 Ga0081539_10001712
539 Ga0081539_10171674
540 Ga0070717_10074910
541 Ga0070717_10142151
542 Ga0070717_10221819
543 Ga0070717_10222719
544 Ga0070717_10361954
545 Ga0070717_11532725
546 Ga0075363_100243467
547 Ga0070715_10005978
548 Ga0070715_10047276
549 Ga0070715_10333439
550 Ga0070716_100000297
551 Ga0070716_100003953
552 Ga0070712_100010506
553 Ga0070712_100063227
554 Ga0070712_100295570
555 Ga0097621_100058644
556 Ga0097621_100335633
557 Ga0097621_100345187
558 Ga0097621_101298961
559 Ga0068871_100062095
560 Ga0068871_100284846
561 Ga0068871_100405145
562 Ga0075431_100260779
563 Ga0075433_10465983
564 Ga0075434_100018450
565 Ga0075434_100313055
566 Ga0075429_100575608
567 Ga0075436_100216390
568 Ga0075435_100023610
569 Ga0075435_100056835
570 Ga0075435_101071427
571 Ga0099794_10010558
572 Ga0099794_10012806
573 Ga0099794_10023137
574 Ga0099794_10042316
575 Ga0099794_10163697
576 Ga0099794_10436467
577 Ga0099795_10066244
578 Ga0099795_10129612
579 Ga0105240_10021605
580 Ga0105240_10061206
581 Ga0105240_10267467
582 Ga0105240_10862042
583 Ga0105245_11025371
584 Ga0105237_11201270
585 Ga0105238_10011868
586 Ga0105238_10012970
587 Ga0105238_10070272
588 Ga0105238_10320944
589 Ga0099796_10012411
590 Ga0105239_10165178
591 Ga0105239_10218133
592 Ga0105239_11046263
593 Ga0157371_10412777
594 Ga0157370_10018981
595 Ga0157370_10069113
596 Ga0157370_10078677
597 Ga0157370_10105807
598 Ga0157370_10244769
599 Ga0157369_10033616
600 Ga0157369_10066338
601 Ga0157369_10071326
602 Ga0157369_10213695
603 Ga0157369_10723843
604 Ga0157374_10010978
605 Ga0157378_10213118
606 Ga0157378_10249391
607 Ga0157372_10361759
608 Ga0157372_10838573
609 Ga0182008_10011658
610 Ga0157379_10348427
611 Ga0157376_10000005
612 Ga0157376_10004386
613 Ga0182006_1066511
614 Ga0163161_10362216
615 Ga0206352_10157314
616 Ga0206350_10074510
617 Ga0154015_1170078
618 Ga0213875_10000164
619 Ga0224712_10000802
620 Ga0209051_1011418
621 Ga0209051_1037834
622 Ga0207697_10121625
623 Ga0207692_10262107
624 Ga0207685_10284140
625 Ga0207699_10153886
626 Ga0207699_10406743
627 Ga0207705_10180832
628 Ga0207707_10000003
629 Ga0207707_10002748
630 Ga0207707_10127653
631 Ga0207707_10182817
632 Ga0207695_10024625
633 Ga0207695_10093386
634 Ga0207695_10160332
635 Ga0207695_10264811
636 Ga0207695_10414233
637 Ga0207695_10479246
638 Ga0207671_10271667
639 Ga0207693_10040199
640 Ga0207693_10062880
641 Ga0207693_10220140
642 Ga0207663_10003858
643 Ga0207663_10169672
644 Ga0207660_10002758
645 Ga0207660_10004566
646 Ga0207660_10075221
647 Ga0207660_10109358
648 Ga0207660_10588203
649 Ga0207660_10791910
650 Ga0207657_10128757
651 Ga0207652_10000024
652 Ga0207652_10016335
653 Ga0207652_10394142
654 Ga0207652_10439559
655 Ga0207652_10561484
656 Ga0207646_10292503
657 Ga0207681_10020064
658 Ga0207694_10007201
659 Ga0207694_10027533
660 Ga0207694_10089838
661 Ga0207694_10228538
662 Ga0207650_10599779
663 Ga0207687_10008058
664 Ga0207687_10089542
665 Ga0207700_10039227
666 Ga0207700_10156072
667 Ga0207700_10252062
668 Ga0207700_10532214
669 Ga0207700_10739128
670 Ga0207700_10980427
671 Ga0207664_10021222
672 Ga0207664_10257906
673 Ga0207664_10418097
674 Ga0207664_10647257
675 Ga0207664_11022895
676 Ga0207644_10142881
677 Ga0207704_11278496
678 Ga0207665_10000020
679 Ga0207665_10018216
680 Ga0207665_10211448
681 Ga0207661_10016372
682 Ga0207661_10117024
683 Ga0207661_10251540
684 Ga0207661_10314373
685 Ga0207661_10787017
686 Ga0207679_10813680
687 Ga0207667_10023516
688 Ga0207667_10033862
689 Ga0207667_10035437
690 Ga0207667_10222263
691 Ga0207668_10809641
692 Ga0207640_10039965
693 Ga0207640_10079817
694 Ga0207677_10333865
695 Ga0207677_10527932
696 Ga0207639_10010633
697 Ga0207702_10115686
698 Ga0207702_10252578
699 Ga0207702_10402796
700 Ga0207702_11090187
701 Ga0207641_10237426
702 Ga0207674_10007451
703 Ga0207674_10135714
704 Ga0207674_10284026
705 Ga0207675_101083061
706 Ga0207698_10036750
707 Ga0207698_10162587
708 Ga0207698_10955953
709 Ga0209588_1011402
710 Ga0209588_1034100
711 Ga0209588_1070124
712 Ga0209588_1079441
713 Ga0209588_1083659
714 Ga0209588_1112399
715 Ga0268265_10518090
716 Ga0268264_10174741
717 Ga0373926_0049678
718 Ga0373923_0111706
719 Ga0373923_0240864
720 Ga0373923_0596883
721 Ga0373936_0231543
722 Ga0373954_0193071
723 Ga0373955_0142574
724 Ga0373924_0163239
725 Ga0373935_0003428
726 Ga0373935_0017550
727 Ga0373935_0166813
728 Ga0373927_0073083
729 Ga0373947_0005378
730 Ga0373947_0598386
731 Ga0373937_0000340
732 Ga0373937_0066068
733 Ga0373937_0351653
734 Ga0373937_0592746
735 Ga0373937_0646484
736 Ga0373925_0002562
737 Ga0373925_0124159
738 Ga0373925_0289779
739 Ga0395899_0004441
740 Ga0395899_0014116
741 Ga0395899_0607564
742 Ga0395900_0000016
743 Ga0395900_0023776
744 Ga0395900_0562453
745 Ga0395898_0009246
746 Ga0395898_0017364
747 Ga0395898_0035198
748 Ga0395898_0675423
749 Ga0395898_1458263
750 Ga0395905_0006525
751 Ga0395905_0554332
752 Ga0395905_0973308
753 Ga0395905_1620208
754 Ga0436364_0379917
755 Ga0395901_0000022
756 Ga0395901_0123076
757 Ga0395901_0129191
758 Ga0395901_0230074
759 Ga0395901_0244809
760 Ga0395901_0278056
761 Ga0395901_0429457
762 Ga0451853_3401108
763 Ga0466972_0011409
764 Ga0466972_0348573
765 Ga0466965_0054240
766 Ga0466966_0012920
767 Ga0466966_0131520
768 Ga0466961_0020224
769 Ga0466961_0046406
770 Ga0466963_0008341
771 Ga0466963_0254152
772 Ga0466964_0109911
773 Ga0466964_0206704
774 Ga0466971_0025763
775 Ga0466957_0003501
776 Ga0466957_0274417
777 Ga0466957_0666492
778 Ga0466959_0021002
779 Ga0466959_0028651
780 Ga0451576_0142336
781 Ga0451576_0195431
782 Ga0451576_1775622
783 Ga0466958_0261972
784 Ga0466958_0475151
785 Ga0466967_0330538
786 Ga0466967_0363685
787 Ga0495592_0013124
788 Ga0495629_0024463
789 Ga0495641_0221210
790 Ga0495651_0012559
791 Ga0495580_0001149
792 Ga0495582_0033420
793 Ga0495639_0007749
794 Ga0495664_0311214
795 Ga0495607_0000060
796 Ga0495628_0051648
797 Ga0495628_0112794
798 Ga0495630_0010636
799 Ga0495630_0210626
800 Ga0495666_0022303
801 Ga0495586_0306006
802 Ga0495587_0271882
803 Ga0495645_0116541
804 Ga0495645_0535970
805 Ga0495634_0018975
806 Ga0495599_0011070
807 Ga0495599_0156701
808 Ga0495599_0511697
809 Ga0495647_0009655
810 Ga0495658_0022074
811 Ga0495658_0459523
812 Ga0495658_0569169
813 Ga0495669_0069586
814 Ga0495604_0159107
815 Ga0495604_0183594
816 Ga0495674_0100363
817 Ga0495676_0061168
818 Ga0495680_0664427
819 Ga0495675_0078713
820 Ga0495684_0053163
821 Ga0495626_0197645
822 Ga0496100_0133703
823 Ga0496101_0153573
824 Ga0496102_0747008
825 Ga0496104_0056079
826 Ga0496104_0097523
827 Ga0496104_0156694
828 Ga0496104_0713730
829 Ga0496105_0007596
830 Ga0496105_0219478
831 Ga0496106_0316386
832 Ga0496107_0497397
833 Ga0496110_0011844
834 Ga0496111_0002177
835 Ga0496112_0233609
836 Ga0496112_0624595
837 Ga0496112_0643936
838 Ga0496114_0002982
839 Ga0496114_0039972
840 Ga0496114_0051194
841 Ga0496114_0366845
842 Ga0496115_0005268
843 Ga0496115_0037093
844 Ga0496115_0745853
845 Ga0496124_0000661
846 Ga0501032_0002690
847 Ga0501032_0345639
848 Ga0501033_0002886
849 Ga0501033_0056572
850 Ga0501033_0512147
851 Ga0501034_0019471
852 Ga0501034_0023221
853 Ga0501036_0006992
854 Ga0501037_0011253
855 Ga0501037_0510632
856 Ga0501038_0003476
857 Ga0501039_0009816
858 Ga0501043_0000305
859 Ga0501043_0007956
860 Ga0501046_0000385
861 Ga0501046_0000723
862 Ga0501046_0778482
863 Ga0501047_0000365
864 Ga0501047_0014029
865 Ga0501047_0017428
866 Ga0501047_0240262
867 Ga0501048_0001146
868 Ga0501048_0025332
869 Ga0501067_0087533
870 Ga0501068_0050822
871 Ga0501069_0003860
872 Ga0501070_0000809
873 Ga0501073_0007452
874 Ga0501073_0016949
875 Ga0501074_0008671
876 Ga0501198_000018
877 Ga0501222_000058
878 Ga0501257_002531
879 Ga0501079_0013249
880 Ga0501080_0001079
881 Ga0501080_0016520
882 Ga0501083_0007287
883 Ga0501035_0015448
884 Ga0501035_0056803
885 Ga0501044_0000787
886 Ga0501044_0011866
887 Ga0501044_0191962
888 nmdc:mga09592_637841_c1
889 nmdc:mga0n895_39959_c1
890 nmdc:mga0n895_423205_c1
891 nmdc:mga0rr50_1025223_c1
892 nmdc:mga0rr50_188564_c1
893 nmdc:mga0rr50_52416_c1
894 nmdc:mga08x19_133387_c1
895 nmdc:mga0a205_358028_c1
896 nmdc:mga0a205_377514_c1
897 Ga0495601_0038010
898 Ga0495601_0083673
899 Ga0495612_0137004
900 Ga0500635_0072656
901 Ga0495595_0335133
902 Ga0495619_0348912
903 Ga0500636_0005778
904 Ga0501084_0584770
905 Ga0587083_0002623
906 Ga0587088_018985
907 Ga0587091_065172
908 Ga0587072_077363
909 Ga0587079_014444
910 Ga0587102_010959
911 Ga0587071_012261
912 Ga0501082_0007897
913 Ga0466962_0021468
914 Ga0466962_0331376

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11821

ActD

Alternative complex III, ActD subunit

26

194

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6loe-assembly1.cif.gz_D cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.8223 1 174
6f0k-assembly1.cif.gz_D alternative complex iii 0.772 3 172
6f0k-assembly1.cif.gz_D alternative complex iii 0.7644 3 172
2j9d-assembly3.cif.gz_H structure of glnk1 with bound effectors indicates regulatory mechanism for ammonia uptake 0.7638 5 32
2j9d-assembly3.cif.gz_G structure of glnk1 with bound effectors indicates regulatory mechanism for ammonia uptake 0.7623 5 32
ID Description Score Start End Superfamily
af_I1MD23_46_172_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.7762 51 115 1.10.10.1740
af_P87146_48_163_1.10.560.10 Mainly Alpha;Orthogonal Bundle;GROEL; domain 1;GroEL-like equatorial domain 0.6885 52 124 1.10.560.10
1nzaA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6796 1 40 3.30.70.120
af_P9WHR9_7_150_1.10.287.1260 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6617 50 139 1.10.287.1260
af_A0A0R0FUL1_125_350_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.661 44 118 1.50.40.10
ID Description Score Start End GO Terms
AF-M6K509-F1-model_v4 PF11821 domain protein 0.9167 46 115 GO:0016020
AF-A0A2M9G325-F1-model_v4 DUF3341 domain-containing protein 0.8844 1 174 GO:0016020
AF-M6K509-F1-model_v4 PF11821 domain protein 0.8816 46 115 GO:0016020
AF-A0A518KZD0-F1-model_v4 deleted 0.8725 1 172
AF-A0A2M9G325-F1-model_v4 DUF3341 domain-containing protein 0.8705 1 174 GO:0016020

Map