F447967

General Info

Members Datasets Scaffolds Average Seq Length
457 221 914 282

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10009398|Ga0081455_100093986
Length 300
Sequence MLPPFALEEPTSVHEALALRARYGETACLYAGGTELLLTMKEGLLRYERLINIKLIPELAGMALEDGALHIGAITTHRMLERSPVVQRHFPTVAEMAAHVANVRVREVGTLGGNLCFAEPHADPGTLLLVYDASVALAQQGGTHTLALEQFFVGPFEVALADDEILTAIRVPALPAHTAAVYLKYGLLERPSVGVAVAVTALPDQVQEVRIAVGCVGPTPRRLRDVEGLLSQKELPEVRATLDAAGALAGSAADAVTDLHGSAEYKAYLVGVLLRRAFERAYQQAIRGDVGDTARGRGTA

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
56 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
135 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
136 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
137 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
138 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
144 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
145 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
146 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
147 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
150 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
153 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
154 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
155 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
156 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
159 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
160 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
161 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
162 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
163 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
164 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
165 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
166 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
167 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
168 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
169 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
170 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
171 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
194 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
195 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
196 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
197 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
198 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
199 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
200 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
201 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
202 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
203 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
206 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
212 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
213 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
217 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
220 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
221 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.34
Metatranscriptomes 0.66
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.19
Rhizosphere 97.37
Stem 0
Stem Tuber 0
Unclassified 22.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10009398 3300005937 Bacteria 10058
2 MBSR1b_contig_3467893 2162886012 Unclassified 1481
3 rootL2_10256048 3300003322 Bacteria 1450
4 JGI25407J50210_10006511 3300003373 Unclassified 2910
5 Ga0058861_12058085 3300004800 Bacteria 2339
6 Ga0058862_12785725 3300004803 Bacteria 1603
7 Ga0065704_10015937 3300005289 Unclassified 2092
8 Ga0065712_10068270 3300005290 Bacteria 12285
9 Ga0065715_10005960 3300005293 Bacteria 3013
10 Ga0065715_10011007 3300005293 Bacteria 2431
11 Ga0065715_10021377 3300005293 Bacteria 1400
12 Ga0065715_10089356 3300005293 Bacteria 10935
13 Ga0065715_10090916 3300005293 Bacteria 6310
14 Ga0065715_10117752 3300005293 Bacteria 2336
15 Ga0070658_10001401 3300005327 Bacteria 20587
16 Ga0070676_10063469 3300005328 Unclassified 2200
17 Ga0070690_100359054 3300005330 Bacteria 1060
18 Ga0070670_100000474 3300005331 Bacteria 32348
19 Ga0070670_100000548 3300005331 Bacteria 29878
20 Ga0070670_100002987 3300005331 Bacteria 13995
21 Ga0070670_100029304 3300005331 Bacteria 4737
22 Ga0070666_10061564 3300005335 Bacteria 2541
23 Ga0070680_100001199 3300005336 Bacteria 18690
24 Ga0070680_100005240 3300005336 Bacteria 9813
25 Ga0070680_100032162 3300005336 Bacteria 4221
26 Ga0070682_100031594 3300005337 Bacteria 3203
27 Ga0070682_100040447 3300005337 Bacteria 2869
28 Ga0070682_100364683 3300005337 Bacteria 1081
29 Ga0068868_100012244 3300005338 Bacteria 6267
30 Ga0070660_100000826 3300005339 Bacteria 20570
31 Ga0070660_100013957 3300005339 Bacteria 5780
32 Ga0070660_100182919 3300005339 Bacteria 1696
33 Ga0070660_100292755 3300005339 Bacteria 1333
34 Ga0070689_100025912 3300005340 Bacteria 4409
35 Ga0070661_100000667 3300005344 Bacteria 25166
36 Ga0070661_100016599 3300005344 Bacteria 5208
37 Ga0070661_100057401 3300005344 Bacteria 2853
38 Ga0070668_100109508 3300005347 Bacteria 2198
39 Ga0070669_100008240 3300005353 Bacteria 7445
40 Ga0070669_100044369 3300005353 Unclassified 3239
41 Ga0070675_100070533 3300005354 Bacteria 2896
42 Ga0070675_100278044 3300005354 Bacteria 1470
43 Ga0070671_100161136 3300005355 Unclassified 1896
44 Ga0070671_100300216 3300005355 Bacteria 1367
45 Ga0070674_100010401 3300005356 Bacteria 5625
46 Ga0070674_100183203 3300005356 Bacteria 1606
47 Ga0070673_100023118 3300005364 Bacteria 4538
48 Ga0070673_100204372 3300005364 Unclassified 1702
49 Ga0070659_100006191 3300005366 Bacteria 8642
50 Ga0070659_100010738 3300005366 Bacteria 6749
51 Ga0070659_100087822 3300005366 Bacteria 2490
52 Ga0070659_100241360 3300005366 Bacteria 1495
53 Ga0070667_100060426 3300005367 Bacteria 3206
54 Ga0070667_100335976 3300005367 Unclassified 1365
55 Ga0070713_100034796 3300005436 Bacteria 4051
56 Ga0070700_100041695 3300005441 Unclassified 2815
57 Ga0070694_100011414 3300005444 Bacteria 5501
58 Ga0070663_100033139 3300005455 Bacteria 3567
59 Ga0070678_100016807 3300005456 Bacteria 4690
60 Ga0070678_100051718 3300005456 Bacteria 2979
61 Ga0070681_10001346 3300005458 Bacteria 21455
62 Ga0070681_10019168 3300005458 Bacteria 6846
63 Ga0070681_10035075 3300005458 Bacteria 5039
64 Ga0070681_10038388 3300005458 Bacteria 4801
65 Ga0070681_10098230 3300005458 Bacteria 2874
66 Ga0070681_10105060 3300005458 Unclassified 2766
67 Ga0068867_100051888 3300005459 Unclassified 3025
68 Ga0070707_100000836 3300005468 Bacteria 30471
69 Ga0070707_100359045 3300005468 Unclassified 1415
70 Ga0070698_100074145 3300005471 Bacteria 3409
71 Ga0070698_100188909 3300005471 Bacteria 1998
72 Ga0070679_100052572 3300005530 Bacteria 4056
73 Ga0070679_100068882 3300005530 Unclassified 3529
74 Ga0070679_100101825 3300005530 Bacteria 2858
75 Ga0070672_100069974 3300005543 Bacteria 2787
76 Ga0070672_100095714 3300005543 Bacteria 2401
77 Ga0070686_100024984 3300005544 Bacteria 3587
78 Ga0070695_100026331 3300005545 Bacteria 3597
79 Ga0070695_100065117 3300005545 Unclassified 2372
80 Ga0070695_100399507 3300005545 Bacteria 1042
81 Ga0070696_100399926 3300005546 Archaea 1074
82 Ga0070665_100096051 3300005548 Unclassified 2969
83 Ga0070704_100021510 3300005549 Bacteria 4184
84 Ga0068855_100034242 3300005563 Bacteria 6059
85 Ga0070664_100001994 3300005564 Bacteria 16372
86 Ga0070664_100008469 3300005564 Bacteria 8316
87 Ga0070664_100132806 3300005564 Bacteria 2187
88 Ga0070664_100154435 3300005564 Bacteria 2027
89 Ga0068857_100273202 3300005577 Unclassified 1553
90 Ga0068854_100018025 3300005578 Bacteria 4733
91 Ga0068856_100027993 3300005614 Bacteria 5499
92 Ga0068856_100067885 3300005614 Bacteria 3524
93 Ga0068856_100085239 3300005614 Bacteria 3139
94 Ga0068859_100406298 3300005617 Bacteria 1458
95 Ga0068864_100098585 3300005618 Bacteria 2589
96 Ga0068861_100663687 3300005719 Bacteria 965
97 Ga0068858_100202404 3300005842 Bacteria 1878
98 Ga0081455_10021344 3300005937 Bacteria 6076
99 Ga0081538_10002101 3300005981 Bacteria 19859
100 Ga0081538_10006932 3300005981 Bacteria 9857
101 Ga0081538_10008764 3300005981 Bacteria 8532
102 Ga0081538_10034547 3300005981 Bacteria 3340
103 Ga0075432_10043536 3300006058 Bacteria 1573
104 Ga0075427_10003806 3300006194 Bacteria 2104
105 Ga0075428_100032409 3300006844 Bacteria 5772
106 Ga0075428_100064743 3300006844 Unclassified 4004
107 Ga0075428_100191416 3300006844 Unclassified 2212
108 Ga0075428_100722421 3300006844 Unclassified 1061
109 Ga0075430_100026524 3300006846 Unclassified 4927
110 Ga0075430_100136354 3300006846 Bacteria 2045
111 Ga0075430_100248903 3300006846 Bacteria 1473
112 Ga0075430_100364880 3300006846 Unclassified 1192
113 Ga0075431_100007120 3300006847 Bacteria 11112
114 Ga0075431_100070519 3300006847 Bacteria 3606
115 Ga0075431_100070920 3300006847 Unclassified 3594
116 Ga0075431_100488471 3300006847 Unclassified 1223
117 Ga0075433_10003664 3300006852 Bacteria 11875
118 Ga0075433_10013564 3300006852 Bacteria 6632
119 Ga0075433_10073009 3300006852 Unclassified 3018
120 Ga0075433_10251879 3300006852 Unclassified 1567
121 Ga0075433_10368905 3300006852 Bacteria 1268
122 Ga0075433_10581761 3300006852 Unclassified 983
123 Ga0075434_100001988 3300006871 Bacteria 17737
124 Ga0075434_100002296 3300006871 Bacteria 16724
125 Ga0075434_100048265 3300006871 Unclassified 4224
126 Ga0075434_100054923 3300006871 Unclassified 3957
127 Ga0075434_100242727 3300006871 Bacteria 1821
128 Ga0075434_100334986 3300006871 Unclassified 1534
129 Ga0075429_100313739 3300006880 Unclassified 1373
130 Ga0097620_100406274 3300006931 Bacteria 1458
131 Ga0075435_100008951 3300007076 Bacteria 7217
132 Ga0075435_100013645 3300007076 Bacteria 6053
133 Ga0075435_100044742 3300007076 Bacteria 3547
134 Ga0075435_100045239 3300007076 Unclassified 3528
135 Ga0075435_100094697 3300007076 Bacteria 2469
136 Ga0099795_10020463 3300007788 Unclassified 2156
137 Ga0111539_10166674 3300009094 Bacteria 2575
138 Ga0111539_10182794 3300009094 Bacteria 2449
139 Ga0111539_10231354 3300009094 Bacteria 2152
140 Ga0111539_10276194 3300009094 Bacteria 1955
141 Ga0111539_10332681 3300009094 Unclassified 1768
142 Ga0105245_10562320 3300009098 Unclassified 1163
143 Ga0114129_10043500 3300009147 Bacteria 6318
144 Ga0114129_10047122 3300009147 Bacteria 6058
145 Ga0114129_10068921 3300009147 Bacteria 4931
146 Ga0114129_10098599 3300009147 Unclassified 4045
147 Ga0114129_10121327 3300009147 Bacteria 3597
148 Ga0114129_10174851 3300009147 Unclassified 2925
149 Ga0114129_10329110 3300009147 Unclassified 2029
150 Ga0114129_10342122 3300009147 Bacteria 1984
151 Ga0114129_10385187 3300009147 Bacteria 1851
152 Ga0114129_10393364 3300009147 Bacteria 1828
153 Ga0105242_10095703 3300009176 Bacteria 2507
154 Ga0105237_10131905 3300009545 Bacteria 2493
155 Ga0105249_10477749 3300009553 Bacteria 1289
156 Ga0105239_10022347 3300010375 Bacteria 6975
157 Ga0105239_10257714 3300010375 Bacteria 1960
158 Ga0105239_10481305 3300010375 Unclassified 1410
159 Ga0105246_10057594 3300011119 Bacteria 2689
160 Ga0105246_10167347 3300011119 Bacteria 1680
161 Ga0157373_10016620 3300013100 Bacteria 5365
162 Ga0157373_10046111 3300013100 Bacteria 3111
163 Ga0157370_10277289 3300013104 Bacteria 1549
164 Ga0157374_10148442 3300013296 Bacteria 2278
165 Ga0157378_10019446 3300013297 Bacteria 5970
166 Ga0157378_10102866 3300013297 Unclassified 2609
167 Ga0157378_10645332 3300013297 Unclassified 1074
168 Ga0163162_10006153 3300013306 Bacteria 11618
169 Ga0163162_10220361 3300013306 Bacteria 2027
170 Ga0163162_10357861 3300013306 Bacteria 1592
171 Ga0157372_10110725 3300013307 Unclassified 3145
172 Ga0157372_10208245 3300013307 Bacteria 2266
173 Ga0157372_10372332 3300013307 Bacteria 1664
174 Ga0157375_10072991 3300013308 Bacteria 3450
175 Ga0157375_10281890 3300013308 Bacteria 1825
176 Ga0157380_10244590 3300014326 Bacteria 1620
177 Ga0157379_10456592 3300014968 Bacteria 1180
178 Ga0157376_10025947 3300014969 Bacteria 4623
179 Ga0157376_10104172 3300014969 Bacteria 2486
180 Ga0182007_10028409 3300015262 Bacteria 1922
181 Ga0163161_10133196 3300017792 Bacteria 1876
182 Ga0224712_10163707 3300022467 Bacteria 994
183 Ga0207697_10019276 3300025315 Unclassified 2793
184 Ga0207697_10024153 3300025315 Bacteria 2489
185 Ga0207688_10013051 3300025901 Bacteria 4518
186 Ga0207688_10126666 3300025901 Bacteria 1494
187 Ga0207680_10026657 3300025903 Bacteria 3206
188 Ga0207680_10199014 3300025903 Bacteria 1364
189 Ga0207647_10128096 3300025904 Bacteria 1493
190 Ga0207699_10142971 3300025906 Bacteria 1574
191 Ga0207645_10108904 3300025907 Bacteria 1792
192 Ga0207705_10032375 3300025909 Bacteria 3736
193 Ga0207707_10004406 3300025912 Bacteria 12431
194 Ga0207707_10009312 3300025912 Bacteria 8516
195 Ga0207707_10009765 3300025912 Bacteria 8325
196 Ga0207707_10012715 3300025912 Bacteria 7317
197 Ga0207707_10015518 3300025912 Bacteria 6635
198 Ga0207707_10016784 3300025912 Bacteria 6378
199 Ga0207707_10054403 3300025912 Bacteria 3484
200 Ga0207671_10337862 3300025914 Bacteria 1193
201 Ga0207663_10422079 3300025916 Unclassified 1024
202 Ga0207660_10011667 3300025917 Bacteria 5730
203 Ga0207660_10081048 3300025917 Bacteria 2384
204 Ga0207660_10096438 3300025917 Bacteria 2202
205 Ga0207657_10003785 3300025919 Bacteria 16082
206 Ga0207657_10025553 3300025919 Bacteria 5443
207 Ga0207657_10118234 3300025919 Bacteria 2182
208 Ga0207649_10015511 3300025920 Bacteria 4281
209 Ga0207649_10052171 3300025920 Bacteria 2536
210 Ga0207652_10007035 3300025921 Bacteria 9066
211 Ga0207652_10094797 3300025921 Bacteria 2628
212 Ga0207646_10001248 3300025922 Bacteria 31874
213 Ga0207681_10065171 3300025923 Bacteria 2517
214 Ga0207650_10000375 3300025925 Bacteria 42170
215 Ga0207650_10001075 3300025925 Bacteria 20306
216 Ga0207650_10001151 3300025925 Bacteria 19432
217 Ga0207650_10023088 3300025925 Bacteria 4410
218 Ga0207659_10066657 3300025926 Unclassified 2613
219 Ga0207644_10242473 3300025931 Bacteria 1435
220 Ga0207644_10444090 3300025931 Unclassified 1065
221 Ga0207690_10009296 3300025932 Bacteria 5839
222 Ga0207690_10013074 3300025932 Unclassified 4980
223 Ga0207690_10020487 3300025932 Bacteria 4087
224 Ga0207706_10002174 3300025933 Bacteria 19135
225 Ga0207706_10010794 3300025933 Bacteria 8336
226 Ga0207706_10033312 3300025933 Bacteria 4587
227 Ga0207706_10034898 3300025933 Bacteria 4474
228 Ga0207686_10560708 3300025934 Bacteria 894
229 Ga0207670_10188064 3300025936 Bacteria 1561
230 Ga0207704_10162189 3300025938 Bacteria 1592
231 Ga0207691_10002941 3300025940 Bacteria 16625
232 Ga0207691_10015766 3300025940 Bacteria 7183
233 Ga0207691_10018361 3300025940 Bacteria 6626
234 Ga0207679_10000638 3300025945 Bacteria 23367
235 Ga0207679_10002481 3300025945 Bacteria 11362
236 Ga0207679_10108717 3300025945 Bacteria 2184
237 Ga0207667_10473562 3300025949 Bacteria 1271
238 Ga0207668_10119194 3300025972 Bacteria 1995
239 Ga0207677_10292512 3300026023 Bacteria 1342
240 Ga0207678_10009737 3300026067 Bacteria 8450
241 Ga0207708_10067409 3300026075 Unclassified 2737
242 Ga0207708_10562669 3300026075 Unclassified 962
243 Ga0207702_10009258 3300026078 Bacteria 8277
244 Ga0207702_10051123 3300026078 Bacteria 3491
245 Ga0207648_10114752 3300026089 Bacteria 2367
246 Ga0207675_100190459 3300026118 Bacteria 1967
247 Ga0207675_100232950 3300026118 Bacteria 1777
248 Ga0207683_10002395 3300026121 Bacteria 16386
249 Ga0207683_10048684 3300026121 Bacteria 3710
250 Ga0207683_10248905 3300026121 Bacteria 1622
251 Ga0210002_1001689 3300027617 Unclassified 3149
252 Ga0209971_1019709 3300027682 Bacteria 1602
253 Ga0209974_10030751 3300027876 Unclassified 1779
254 Ga0207428_10179140 3300027907 Bacteria 1602
255 Ga0307408_100237058 3300031548 Unclassified 1497
256 Ga0307413_10143943 3300031824 Bacteria 1651
257 Ga0307410_10149932 3300031852 Bacteria 1735
258 Ga0307412_10012972 3300031911 Bacteria 4872
259 Ga0307409_100018785 3300031995 Bacteria 4660
260 Ga0307409_100351323 3300031995 Bacteria 1391
261 Ga0307416_100009420 3300032002 Bacteria 6391
262 Ga0307416_100284562 3300032002 Bacteria 1632
263 Ga0307414_10317485 3300032004 Bacteria 1325
264 Ga0307415_100280311 3300032126 Bacteria 1370
265 Ga0373936_0095539 3300035113 Unclassified 1250
266 Ga0373939_0184506 3300035114 Unclassified 780
267 Ga0373945_0024939 3300035116 Bacteria 2075
268 Ga0373943_0168176 3300035170 Unclassified 1198
269 Ga0373946_0207994 3300035171 Unclassified 940
270 Ga0373931_0240153 3300035691 Bacteria 1098
271 Ga0373931_0327235 3300035691 Unclassified 954
272 Ga0373935_0304964 3300035692 Unclassified 1126
273 Ga0373947_0311429 3300035725 Unclassified 1051
274 Ga0373925_0009458 3300037068 Bacteria 7094
275 Ga0451837_0056602 3300041494 Unclassified 859
276 Ga0439446_0026374 3300042156 Unclassified 1665
277 Ga0439444_0009120 3300042437 Bacteria 1558
278 Ga0451577_0454748 3300042876 Bacteria 1163
279 Ga0453683_0000163 3300044673 Bacteria 97466
280 Ga0451576_0616367 3300045051 Bacteria 1140
281 Ga0495651_0002632 3300046462 Bacteria 13902
282 Ga0495653_0041281 3300046463 Unclassified 3602
283 Ga0495580_0001992 3300046472 Bacteria 17965
284 Ga0495580_0162012 3300046472 Bacteria 1548
285 Ga0495580_0201603 3300046472 Unclassified 1371
286 Ga0495582_0007820 3300046473 Bacteria 5911
287 Ga0495664_0019267 3300046477 Unclassified 3922
288 Ga0495608_0007140 3300046511 Bacteria 7901
289 Ga0495618_0057651 3300046514 Unclassified 2460
290 Ga0495628_0000647 3300046516 Bacteria 31863
291 Ga0495630_0237968 3300046517 Unclassified 1391
292 Ga0495640_0097926 3300046533 Unclassified 1928
293 Ga0495587_0001504 3300046536 Bacteria 15501
294 Ga0495645_0059989 3300046543 Unclassified 2758
295 Ga0495667_0001173 3300046559 Bacteria 17117
296 Ga0495635_0103339 3300046663 Unclassified 1947
297 Ga0495657_0016465 3300046675 Bacteria 5387
298 Ga0495599_0051779 3300046678 Unclassified 2572
299 Ga0495613_0054367 3300046689 Bacteria 2944
300 Ga0495581_0037758 3300047315 Bacteria 2796
301 Ga0495604_0010400 3300047317 Bacteria 7371
302 Ga0495680_0019492 3300047322 Bacteria 5722
303 Ga0495675_0000146 3300047444 Bacteria 49305
304 Ga0495684_0003791 3300047471 Bacteria 11783
305 Ga0495602_0086680 3300048088 Unclassified 2613
306 Ga0496102_0065026 3300048905 Bacteria 3342
307 Ga0496103_0161153 3300048906 Bacteria 1439
308 Ga0496104_0701648 3300048907 Unclassified 920
309 Ga0496109_0278996 3300048912 Bacteria 1575
310 Ga0496112_0010234 3300048915 Bacteria 8502
311 Ga0496112_0033787 3300048915 Unclassified 4974
312 Ga0496112_0036436 3300048915 Bacteria 4799
313 Ga0496112_0104186 3300048915 Bacteria 2807
314 Ga0496113_0059569 3300048916 Unclassified 2877
315 Ga0496113_0393417 3300048916 Bacteria 1113
316 Ga0501031_0003825 3300049568 Bacteria 9683
317 Ga0501031_0309354 3300049568 Unclassified 1024
318 Ga0501032_0008636 3300049569 Bacteria 7423
319 Ga0501033_0012929 3300049570 Bacteria 6367
320 Ga0501034_0024690 3300049571 Bacteria 6114
321 Ga0501036_0006898 3300049572 Bacteria 9232
322 Ga0501037_0007900 3300049573 Bacteria 7795
323 Ga0501037_0106704 3300049573 Bacteria 2018
324 Ga0501038_0102994 3300049574 Bacteria 2374
325 Ga0501039_0030219 3300049575 Bacteria 4176
326 Ga0501039_0152604 3300049575 Bacteria 1815
327 Ga0501039_0342861 3300049575 Unclassified 1174
328 Ga0501039_0420857 3300049575 Bacteria 1049
329 Ga0501040_0015636 3300049576 Bacteria 5016
330 Ga0501040_0084613 3300049576 Bacteria 2200
331 Ga0501040_0175144 3300049576 Bacteria 1520
332 Ga0501040_0279235 3300049576 Bacteria 1193
333 Ga0501041_0041118 3300049577 Bacteria 2807
334 Ga0501042_0000287 3300049578 Bacteria 24863
335 Ga0501042_0308324 3300049578 Unclassified 1144
336 Ga0501042_0343282 3300049578 Bacteria 1079
337 Ga0501043_0010592 3300049579 Bacteria 7218
338 Ga0501043_0033013 3300049579 Bacteria 4071
339 Ga0501043_0364339 3300049579 Bacteria 1097
340 Ga0501043_0690529 3300049579 Bacteria 746
341 Ga0501046_0239002 3300049580 Bacteria 1340
342 Ga0501046_0279742 3300049580 Bacteria 1222
343 Ga0501047_0071964 3300049581 Bacteria 3328
344 Ga0501048_0020507 3300049582 Bacteria 4843
345 Ga0501048_0024002 3300049582 Bacteria 4453
346 Ga0501068_0144709 3300049584 Bacteria 1491
347 Ga0501069_0001726 3300049585 Bacteria 10891
348 Ga0501070_0013345 3300049586 Bacteria 6929
349 Ga0501071_0000846 3300049587 Bacteria 16405
350 Ga0501071_0075698 3300049587 Bacteria 2457
351 Ga0501071_0153058 3300049587 Unclassified 1721
352 Ga0501071_0244069 3300049587 Bacteria 1354
353 Ga0501072_0063222 3300049588 Bacteria 2920
354 Ga0501072_0146058 3300049588 Bacteria 1886
355 Ga0501072_0149082 3300049588 Unclassified 1865
356 Ga0501072_0418813 3300049588 Bacteria 1062
357 Ga0501073_0018960 3300049589 Bacteria 4972
358 Ga0501073_0265677 3300049589 Bacteria 1184
359 Ga0501074_0017952 3300049590 Bacteria 5140
360 Ga0501075_0003978 3300049591 Bacteria 9969
361 Ga0501075_0031043 3300049591 Bacteria 3963
362 Ga0501075_0444368 3300049591 Unclassified 989
363 Ga0501076_0017737 3300049592 Bacteria 5412
364 Ga0501076_0035503 3300049592 Bacteria 3900
365 Ga0501076_0037749 3300049592 Bacteria 3791
366 Ga0501076_0041117 3300049592 Bacteria 3635
367 Ga0501076_0208953 3300049592 Bacteria 1594
368 Ga0501076_0682850 3300049592 Unclassified 848
369 Ga0501077_0003103 3300049593 Bacteria 9989
370 Ga0501077_0054860 3300049593 Bacteria 2530
371 Ga0501077_0263787 3300049593 Unclassified 1095
372 Ga0501079_0006060 3300049741 Bacteria 9062
373 Ga0501079_0007097 3300049741 Bacteria 8453
374 Ga0501079_0058399 3300049741 Bacteria 2976
375 Ga0501080_0017689 3300049742 Bacteria 6595
376 Ga0501080_0059626 3300049742 Bacteria 3551
377 Ga0501080_0366158 3300049742 Bacteria 1300
378 Ga0501080_0460688 3300049742 Unclassified 1139
379 Ga0501080_0498462 3300049742 Bacteria 1088
380 Ga0501081_0000958 3300049743 Bacteria 17152
381 Ga0501081_0008653 3300049743 Bacteria 6612
382 Ga0501083_0123107 3300049744 Unclassified 1701
383 Ga0501083_0179386 3300049744 Bacteria 1383
384 Ga0501083_0209343 3300049744 Bacteria 1271
385 Ga0501035_0197305 3300049822 Bacteria 1728
386 Ga0501035_0239271 3300049822 Bacteria 1544
387 Ga0501044_0204614 3300049823 Bacteria 1931
388 Ga0501045_0004653 3300049824 Bacteria 9474
389 Ga0501045_0402655 3300049824 Bacteria 1018
390 Ga0501045_0457107 3300049824 Bacteria 949
391 nmdc:mga05p37_12282_c1 3300050507 Bacteria 10227
392 nmdc:mga05p37_27066_c1 3300050507 Bacteria 6979
393 nmdc:mga05p37_334643_c1 3300050507 Unclassified 1787
394 nmdc:mga05p37_3724_c1 3300050507 Bacteria 17844
395 nmdc:mga05p37_38568_c1 3300050507 Bacteria 5861
396 nmdc:mga05p37_39156_c1 3300050507 Bacteria 5818
397 nmdc:mga05p37_66671_c1 3300050507 Bacteria 4427
398 nmdc:mga09592_211978_c1 3300050508 Unclassified 1678
399 nmdc:mga09592_290771_c1 3300050508 Unclassified 1417
400 nmdc:mga0qj67_16438_c1 3300050509 Bacteria 5612
401 nmdc:mga0qj67_178742_c1 3300050509 Bacteria 1723
402 nmdc:mga0qj67_191199_c1 3300050509 Bacteria 1663
403 nmdc:mga0qj67_273955_c1 3300050509 Unclassified 1368
404 nmdc:mga0qj67_362434_c1 3300050509 Unclassified 1171
405 nmdc:mga0qj67_427240_c1 3300050509 Bacteria 1068
406 nmdc:mga06r32_198473_c1 3300050510 Bacteria 1994
407 nmdc:mga06r32_93838_c1 3300050510 Unclassified 2936
408 nmdc:mga08y16_149969_c1 3300050511 Bacteria 2424
409 nmdc:mga08y16_153952_c1 3300050511 Bacteria 2389
410 nmdc:mga08y16_212373_c1 3300050511 Bacteria 2004
411 nmdc:mga08y16_30115_c1 3300050511 Bacteria 5713
412 nmdc:mga08y16_40116_c1 3300050511 Bacteria 4908
413 nmdc:mga08y16_80411_c1 3300050511 Bacteria 3398
414 nmdc:mga08y16_919548_c1 3300050511 Unclassified 860
415 nmdc:mga0n895_11391_c1 3300050512 Bacteria 7932
416 nmdc:mga0n895_11839_c1 3300050512 Bacteria 7800
417 nmdc:mga0n895_160883_c1 3300050512 Unclassified 2277
418 nmdc:mga0n895_163522_c1 3300050512 Unclassified 2257
419 nmdc:mga0n895_1681_c1 3300050512 Bacteria 16701
420 nmdc:mga0n895_216106_c1 3300050512 Bacteria 1947
421 nmdc:mga0n895_2651_c1 3300050512 Bacteria 14113
422 nmdc:mga0n895_412945_c1 3300050512 Bacteria 1365
423 nmdc:mga0n895_493395_c1 3300050512 Unclassified 1234
424 nmdc:mga0n895_52866_c1 3300050512 Bacteria 3989
425 nmdc:mga0n895_54737_c1 3300050512 Bacteria 3926
426 nmdc:mga0n895_86509_c1 3300050512 Unclassified 3131
427 nmdc:mga0n895_92975_c1 3300050512 Unclassified 3019
428 nmdc:mga0rr50_129027_c1 3300050513 Bacteria 2022
429 nmdc:mga0rr50_16359_c1 3300050513 Bacteria 4924
430 nmdc:mga0rr50_21962_c1 3300050513 Bacteria 4369
431 nmdc:mga0rr50_23095_c1 3300050513 Bacteria 4282
432 nmdc:mga0rr50_3373_c1 3300050513 Bacteria 9174
433 nmdc:mga0rr50_55203_c1 3300050513 Bacteria 2963
434 nmdc:mga0rr50_56985_c1 3300050513 Bacteria 2921
435 nmdc:mga0rr50_819987_c1 3300050513 Unclassified 794
436 nmdc:mga08x19_107121_c1 3300050514 Bacteria 1860
437 nmdc:mga08x19_17744_c1 3300050514 Bacteria 4358
438 nmdc:mga0a205_110872_c1 3300050515 Bacteria 2643
439 nmdc:mga0a205_152195_c1 3300050515 Unclassified 2212
440 nmdc:mga0a205_174597_c1 3300050515 Unclassified 2044
441 nmdc:mga0a205_233488_c2 3300050515 Unclassified 997
442 nmdc:mga0a205_30969_c1 3300050515 Bacteria 5124
443 nmdc:mga0a205_375229_c1 3300050515 Bacteria 1288
444 nmdc:mga0a205_4197_c1 3300050515 Bacteria 12919
445 nmdc:mga0a205_7835_c1 3300050515 Bacteria 9703
446 Ga0501084_0089512 3300054114 Bacteria 2583
447 Ga0501084_0199949 3300054114 Bacteria 1686
448 Ga0501084_0213263 3300054114 Bacteria 1629
449 Ga0501082_0004187 3300060353 Bacteria 12606
450 Ga0501082_0036605 3300060353 Bacteria 4227
451 Ga0501082_0328599 3300060353 Bacteria 1332
452 Ga0501082_0361928 3300060353 Bacteria 1265
453 Ga0501082_0529869 3300060353 Unclassified 1030
454 Ga0530510_0006570 3300061734 Bacteria 8104
455 Ga0530510_0049981 3300061734 Bacteria 3020
456 Ga0530510_0142095 3300061734 Bacteria 1769
457 Ga0530510_0370161 3300061734 Unclassified 1078
458 Ga0081455_10009398
459 MBSR1b_contig_3467893
460 rootL2_10256048
461 JGI25407J50210_10006511
462 Ga0058861_12058085
463 Ga0058862_12785725
464 Ga0065704_10015937
465 Ga0065712_10068270
466 Ga0065715_10005960
467 Ga0065715_10011007
468 Ga0065715_10021377
469 Ga0065715_10089356
470 Ga0065715_10090916
471 Ga0065715_10117752
472 Ga0070658_10001401
473 Ga0070676_10063469
474 Ga0070690_100359054
475 Ga0070670_100000474
476 Ga0070670_100000548
477 Ga0070670_100002987
478 Ga0070670_100029304
479 Ga0070666_10061564
480 Ga0070680_100001199
481 Ga0070680_100005240
482 Ga0070680_100032162
483 Ga0070682_100031594
484 Ga0070682_100040447
485 Ga0070682_100364683
486 Ga0068868_100012244
487 Ga0070660_100000826
488 Ga0070660_100013957
489 Ga0070660_100182919
490 Ga0070660_100292755
491 Ga0070689_100025912
492 Ga0070661_100000667
493 Ga0070661_100016599
494 Ga0070661_100057401
495 Ga0070668_100109508
496 Ga0070669_100008240
497 Ga0070669_100044369
498 Ga0070675_100070533
499 Ga0070675_100278044
500 Ga0070671_100161136
501 Ga0070671_100300216
502 Ga0070674_100010401
503 Ga0070674_100183203
504 Ga0070673_100023118
505 Ga0070673_100204372
506 Ga0070659_100006191
507 Ga0070659_100010738
508 Ga0070659_100087822
509 Ga0070659_100241360
510 Ga0070667_100060426
511 Ga0070667_100335976
512 Ga0070713_100034796
513 Ga0070700_100041695
514 Ga0070694_100011414
515 Ga0070663_100033139
516 Ga0070678_100016807
517 Ga0070678_100051718
518 Ga0070681_10001346
519 Ga0070681_10019168
520 Ga0070681_10035075
521 Ga0070681_10038388
522 Ga0070681_10098230
523 Ga0070681_10105060
524 Ga0068867_100051888
525 Ga0070707_100000836
526 Ga0070707_100359045
527 Ga0070698_100074145
528 Ga0070698_100188909
529 Ga0070679_100052572
530 Ga0070679_100068882
531 Ga0070679_100101825
532 Ga0070672_100069974
533 Ga0070672_100095714
534 Ga0070686_100024984
535 Ga0070695_100026331
536 Ga0070695_100065117
537 Ga0070695_100399507
538 Ga0070696_100399926
539 Ga0070665_100096051
540 Ga0070704_100021510
541 Ga0068855_100034242
542 Ga0070664_100001994
543 Ga0070664_100008469
544 Ga0070664_100132806
545 Ga0070664_100154435
546 Ga0068857_100273202
547 Ga0068854_100018025
548 Ga0068856_100027993
549 Ga0068856_100067885
550 Ga0068856_100085239
551 Ga0068859_100406298
552 Ga0068864_100098585
553 Ga0068861_100663687
554 Ga0068858_100202404
555 Ga0081455_10021344
556 Ga0081538_10002101
557 Ga0081538_10006932
558 Ga0081538_10008764
559 Ga0081538_10034547
560 Ga0075432_10043536
561 Ga0075427_10003806
562 Ga0075428_100032409
563 Ga0075428_100064743
564 Ga0075428_100191416
565 Ga0075428_100722421
566 Ga0075430_100026524
567 Ga0075430_100136354
568 Ga0075430_100248903
569 Ga0075430_100364880
570 Ga0075431_100007120
571 Ga0075431_100070519
572 Ga0075431_100070920
573 Ga0075431_100488471
574 Ga0075433_10003664
575 Ga0075433_10013564
576 Ga0075433_10073009
577 Ga0075433_10251879
578 Ga0075433_10368905
579 Ga0075433_10581761
580 Ga0075434_100001988
581 Ga0075434_100002296
582 Ga0075434_100048265
583 Ga0075434_100054923
584 Ga0075434_100242727
585 Ga0075434_100334986
586 Ga0075429_100313739
587 Ga0097620_100406274
588 Ga0075435_100008951
589 Ga0075435_100013645
590 Ga0075435_100044742
591 Ga0075435_100045239
592 Ga0075435_100094697
593 Ga0099795_10020463
594 Ga0111539_10166674
595 Ga0111539_10182794
596 Ga0111539_10231354
597 Ga0111539_10276194
598 Ga0111539_10332681
599 Ga0105245_10562320
600 Ga0114129_10043500
601 Ga0114129_10047122
602 Ga0114129_10068921
603 Ga0114129_10098599
604 Ga0114129_10121327
605 Ga0114129_10174851
606 Ga0114129_10329110
607 Ga0114129_10342122
608 Ga0114129_10385187
609 Ga0114129_10393364
610 Ga0105242_10095703
611 Ga0105237_10131905
612 Ga0105249_10477749
613 Ga0105239_10022347
614 Ga0105239_10257714
615 Ga0105239_10481305
616 Ga0105246_10057594
617 Ga0105246_10167347
618 Ga0157373_10016620
619 Ga0157373_10046111
620 Ga0157370_10277289
621 Ga0157374_10148442
622 Ga0157378_10019446
623 Ga0157378_10102866
624 Ga0157378_10645332
625 Ga0163162_10006153
626 Ga0163162_10220361
627 Ga0163162_10357861
628 Ga0157372_10110725
629 Ga0157372_10208245
630 Ga0157372_10372332
631 Ga0157375_10072991
632 Ga0157375_10281890
633 Ga0157380_10244590
634 Ga0157379_10456592
635 Ga0157376_10025947
636 Ga0157376_10104172
637 Ga0182007_10028409
638 Ga0163161_10133196
639 Ga0224712_10163707
640 Ga0207697_10019276
641 Ga0207697_10024153
642 Ga0207688_10013051
643 Ga0207688_10126666
644 Ga0207680_10026657
645 Ga0207680_10199014
646 Ga0207647_10128096
647 Ga0207699_10142971
648 Ga0207645_10108904
649 Ga0207705_10032375
650 Ga0207707_10004406
651 Ga0207707_10009312
652 Ga0207707_10009765
653 Ga0207707_10012715
654 Ga0207707_10015518
655 Ga0207707_10016784
656 Ga0207707_10054403
657 Ga0207671_10337862
658 Ga0207663_10422079
659 Ga0207660_10011667
660 Ga0207660_10081048
661 Ga0207660_10096438
662 Ga0207657_10003785
663 Ga0207657_10025553
664 Ga0207657_10118234
665 Ga0207649_10015511
666 Ga0207649_10052171
667 Ga0207652_10007035
668 Ga0207652_10094797
669 Ga0207646_10001248
670 Ga0207681_10065171
671 Ga0207650_10000375
672 Ga0207650_10001075
673 Ga0207650_10001151
674 Ga0207650_10023088
675 Ga0207659_10066657
676 Ga0207644_10242473
677 Ga0207644_10444090
678 Ga0207690_10009296
679 Ga0207690_10013074
680 Ga0207690_10020487
681 Ga0207706_10002174
682 Ga0207706_10010794
683 Ga0207706_10033312
684 Ga0207706_10034898
685 Ga0207686_10560708
686 Ga0207670_10188064
687 Ga0207704_10162189
688 Ga0207691_10002941
689 Ga0207691_10015766
690 Ga0207691_10018361
691 Ga0207679_10000638
692 Ga0207679_10002481
693 Ga0207679_10108717
694 Ga0207667_10473562
695 Ga0207668_10119194
696 Ga0207677_10292512
697 Ga0207678_10009737
698 Ga0207708_10067409
699 Ga0207708_10562669
700 Ga0207702_10009258
701 Ga0207702_10051123
702 Ga0207648_10114752
703 Ga0207675_100190459
704 Ga0207675_100232950
705 Ga0207683_10002395
706 Ga0207683_10048684
707 Ga0207683_10248905
708 Ga0210002_1001689
709 Ga0209971_1019709
710 Ga0209974_10030751
711 Ga0207428_10179140
712 Ga0307408_100237058
713 Ga0307413_10143943
714 Ga0307410_10149932
715 Ga0307412_10012972
716 Ga0307409_100018785
717 Ga0307409_100351323
718 Ga0307416_100009420
719 Ga0307416_100284562
720 Ga0307414_10317485
721 Ga0307415_100280311
722 Ga0373936_0095539
723 Ga0373939_0184506
724 Ga0373945_0024939
725 Ga0373943_0168176
726 Ga0373946_0207994
727 Ga0373931_0240153
728 Ga0373931_0327235
729 Ga0373935_0304964
730 Ga0373947_0311429
731 Ga0373925_0009458
732 Ga0451837_0056602
733 Ga0439446_0026374
734 Ga0439444_0009120
735 Ga0451577_0454748
736 Ga0453683_0000163
737 Ga0451576_0616367
738 Ga0495651_0002632
739 Ga0495653_0041281
740 Ga0495580_0001992
741 Ga0495580_0162012
742 Ga0495580_0201603
743 Ga0495582_0007820
744 Ga0495664_0019267
745 Ga0495608_0007140
746 Ga0495618_0057651
747 Ga0495628_0000647
748 Ga0495630_0237968
749 Ga0495640_0097926
750 Ga0495587_0001504
751 Ga0495645_0059989
752 Ga0495667_0001173
753 Ga0495635_0103339
754 Ga0495657_0016465
755 Ga0495599_0051779
756 Ga0495613_0054367
757 Ga0495581_0037758
758 Ga0495604_0010400
759 Ga0495680_0019492
760 Ga0495675_0000146
761 Ga0495684_0003791
762 Ga0495602_0086680
763 Ga0496102_0065026
764 Ga0496103_0161153
765 Ga0496104_0701648
766 Ga0496109_0278996
767 Ga0496112_0010234
768 Ga0496112_0033787
769 Ga0496112_0036436
770 Ga0496112_0104186
771 Ga0496113_0059569
772 Ga0496113_0393417
773 Ga0501031_0003825
774 Ga0501031_0309354
775 Ga0501032_0008636
776 Ga0501033_0012929
777 Ga0501034_0024690
778 Ga0501036_0006898
779 Ga0501037_0007900
780 Ga0501037_0106704
781 Ga0501038_0102994
782 Ga0501039_0030219
783 Ga0501039_0152604
784 Ga0501039_0342861
785 Ga0501039_0420857
786 Ga0501040_0015636
787 Ga0501040_0084613
788 Ga0501040_0175144
789 Ga0501040_0279235
790 Ga0501041_0041118
791 Ga0501042_0000287
792 Ga0501042_0308324
793 Ga0501042_0343282
794 Ga0501043_0010592
795 Ga0501043_0033013
796 Ga0501043_0364339
797 Ga0501043_0690529
798 Ga0501046_0239002
799 Ga0501046_0279742
800 Ga0501047_0071964
801 Ga0501048_0020507
802 Ga0501048_0024002
803 Ga0501068_0144709
804 Ga0501069_0001726
805 Ga0501070_0013345
806 Ga0501071_0000846
807 Ga0501071_0075698
808 Ga0501071_0153058
809 Ga0501071_0244069
810 Ga0501072_0063222
811 Ga0501072_0146058
812 Ga0501072_0149082
813 Ga0501072_0418813
814 Ga0501073_0018960
815 Ga0501073_0265677
816 Ga0501074_0017952
817 Ga0501075_0003978
818 Ga0501075_0031043
819 Ga0501075_0444368
820 Ga0501076_0017737
821 Ga0501076_0035503
822 Ga0501076_0037749
823 Ga0501076_0041117
824 Ga0501076_0208953
825 Ga0501076_0682850
826 Ga0501077_0003103
827 Ga0501077_0054860
828 Ga0501077_0263787
829 Ga0501079_0006060
830 Ga0501079_0007097
831 Ga0501079_0058399
832 Ga0501080_0017689
833 Ga0501080_0059626
834 Ga0501080_0366158
835 Ga0501080_0460688
836 Ga0501080_0498462
837 Ga0501081_0000958
838 Ga0501081_0008653
839 Ga0501083_0123107
840 Ga0501083_0179386
841 Ga0501083_0209343
842 Ga0501035_0197305
843 Ga0501035_0239271
844 Ga0501044_0204614
845 Ga0501045_0004653
846 Ga0501045_0402655
847 Ga0501045_0457107
848 nmdc:mga05p37_12282_c1
849 nmdc:mga05p37_27066_c1
850 nmdc:mga05p37_334643_c1
851 nmdc:mga05p37_3724_c1
852 nmdc:mga05p37_38568_c1
853 nmdc:mga05p37_39156_c1
854 nmdc:mga05p37_66671_c1
855 nmdc:mga09592_211978_c1
856 nmdc:mga09592_290771_c1
857 nmdc:mga0qj67_16438_c1
858 nmdc:mga0qj67_178742_c1
859 nmdc:mga0qj67_191199_c1
860 nmdc:mga0qj67_273955_c1
861 nmdc:mga0qj67_362434_c1
862 nmdc:mga0qj67_427240_c1
863 nmdc:mga06r32_198473_c1
864 nmdc:mga06r32_93838_c1
865 nmdc:mga08y16_149969_c1
866 nmdc:mga08y16_153952_c1
867 nmdc:mga08y16_212373_c1
868 nmdc:mga08y16_30115_c1
869 nmdc:mga08y16_40116_c1
870 nmdc:mga08y16_80411_c1
871 nmdc:mga08y16_919548_c1
872 nmdc:mga0n895_11391_c1
873 nmdc:mga0n895_11839_c1
874 nmdc:mga0n895_160883_c1
875 nmdc:mga0n895_163522_c1
876 nmdc:mga0n895_1681_c1
877 nmdc:mga0n895_216106_c1
878 nmdc:mga0n895_2651_c1
879 nmdc:mga0n895_412945_c1
880 nmdc:mga0n895_493395_c1
881 nmdc:mga0n895_52866_c1
882 nmdc:mga0n895_54737_c1
883 nmdc:mga0n895_86509_c1
884 nmdc:mga0n895_92975_c1
885 nmdc:mga0rr50_129027_c1
886 nmdc:mga0rr50_16359_c1
887 nmdc:mga0rr50_21962_c1
888 nmdc:mga0rr50_23095_c1
889 nmdc:mga0rr50_3373_c1
890 nmdc:mga0rr50_55203_c1
891 nmdc:mga0rr50_56985_c1
892 nmdc:mga0rr50_819987_c1
893 nmdc:mga08x19_107121_c1
894 nmdc:mga08x19_17744_c1
895 nmdc:mga0a205_110872_c1
896 nmdc:mga0a205_152195_c1
897 nmdc:mga0a205_174597_c1
898 nmdc:mga0a205_233488_c2
899 nmdc:mga0a205_30969_c1
900 nmdc:mga0a205_375229_c1
901 nmdc:mga0a205_4197_c1
902 nmdc:mga0a205_7835_c1
903 Ga0501084_0089512
904 Ga0501084_0199949
905 Ga0501084_0213263
906 Ga0501082_0004187
907 Ga0501082_0036605
908 Ga0501082_0328599
909 Ga0501082_0361928
910 Ga0501082_0529869
911 Ga0530510_0006570
912 Ga0530510_0049981
913 Ga0530510_0142095
914 Ga0530510_0370161

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00941

FAD_binding_5

FAD binding domain in molybdopterin dehydrogenase

3

174

0.98

PF03450

CO_deh_flav_C

CO dehydrogenase flavoprotein C-terminal domain

190

281

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7dqx-assembly1.cif.gz_B crystal structure of xanthine dehydrogenase family protein 0.936 3 276
1ffv-assembly1.cif.gz_F carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9352 2 275
1ffu-assembly1.cif.gz_F carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor 0.9284 2 275
7dqx-assembly1.cif.gz_B crystal structure of xanthine dehydrogenase family protein 0.9262 3 276
1ffv-assembly1.cif.gz_F carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9254 2 275
ID Description Score Start End Superfamily
1t3qF02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9688 51 168 3.30.465.10
1ffvC03 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9685 54 166 3.30.465.10
1t3qF02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9608 51 168 3.30.465.10
af_I6Y7N2_57_165_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9564 62 166 3.30.465.10
4zohB02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9538 54 166 3.30.465.10
ID Description Score Start End GO Terms
AF-A0A7C3JLQ4-F1-model_v4 Xanthine dehydrogenase family protein subunit M 0.9927 94 276 GO:0016491
GO:0071949
AF-A0A7C3JLQ4-F1-model_v4 Xanthine dehydrogenase family protein subunit M 0.9873 94 276 GO:0016491
GO:0071949
AF-A0A7C2B877-F1-model_v4 Xanthine dehydrogenase family protein subunit M 0.9658 2 274 GO:0016491
GO:0071949
AF-A0A6A0QWV7-F1-model_v4 Xanthine dehydrogenase family protein subunit M 0.9638 2 274 GO:0016491
GO:0071949
AF-A0A1F7T1S2-F1-model_v4 FAD-binding PCMH-type domain-containing protein 0.9623 2 275 GO:0016491
GO:0071949

Map