F447963

General Info

Members Datasets Scaffolds Average Seq Length
457 238 451 265

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100015549|Ga0070665_1000155497
Length 285
Sequence MTGEGENASLLRRVRRAASADGTAQNHIIRIRGLVNGFGDKIIHDHIDLDVCRGEVLGVVGGSGSGKSVLMRSIIGLIHPKEGDVRVFGEPTCGDIEGSAMRRLEMRWGVLFQEGALFSSQTVAENIQVPLREYTKMSQTLMDEIAAMKIAMVGLPPDTCNKYPSELSGGMKKRAGLARALALDPELLFLDEPTAGLDPISANQFDELINQLQESLGLTVMMVTHDIDTLHAVTDRIAVLVNKKLVIGTIDELRKNQDPWIKDYFSGVRGRAALSAMDLASQEAH

Samples

Sample ID Description Type Environment
1 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
2 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
3 2842694124 Methylopila sp. R-72369 Isolate Unclassified
4 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
5 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
6 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
90 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
91 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
134 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
135 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
136 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
137 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
138 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
139 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
140 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
141 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
142 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
143 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
146 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
147 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
148 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
149 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
156 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
159 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
160 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
167 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
168 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
169 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
172 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
173 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
174 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
175 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
176 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
179 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
182 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
186 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
187 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
188 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
203 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
204 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
205 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
206 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
207 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
208 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
209 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
210 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
211 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
212 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
213 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
216 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
224 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
225 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
226 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
227 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
228 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
229 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
230 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
231 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
232 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
233 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
234 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
235 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
236 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
237 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
238 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.69
Metatranscriptomes 0
Isolates 1.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.6
Nodule 0.22
Rhizoplane 0.66
Rhizosphere 91.03
Stem 0
Stem Tuber 0
Unclassified 3.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10001012 3300003187 Bacteria 21230
2 JGI25153J46596_10001304 3300003215 Bacteria 14944
3 JGI25160J50197_1022236 3300003354 Bacteria 1863
4 Ga0065707_10082983 3300005295 Bacteria 11043
5 Ga0065707_10220948 3300005295 Bacteria 1225
6 Ga0070658_10018547 3300005327 Bacteria 5571
7 Ga0070658_10213339 3300005327 Bacteria 1631
8 Ga0070658_10221903 3300005327 Bacteria 1599
9 Ga0070683_100618244 3300005329 Bacteria 1037
10 Ga0068869_100095935 3300005334 Bacteria 2238
11 Ga0070666_10032582 3300005335 Bacteria 3443
12 Ga0070680_100365866 3300005336 Bacteria 1227
13 Ga0068868_100348562 3300005338 Bacteria 1268
14 Ga0070661_100001122 3300005344 Bacteria 18807
15 Ga0070661_100286740 3300005344 Bacteria 1279
16 Ga0070669_100017193 3300005353 Bacteria 5160
17 Ga0070674_100079587 3300005356 Bacteria 2338
18 Ga0070659_100022636 3300005366 Bacteria 4798
19 Ga0070659_100541302 3300005366 Bacteria 996
20 Ga0070667_100133922 3300005367 Bacteria 2165
21 Ga0070709_10000178 3300005434 Bacteria 40284
22 Ga0070710_10084176 3300005437 Bacteria 1863
23 Ga0070711_100013345 3300005439 Bacteria 5158
24 Ga0070711_100142632 3300005439 Bacteria 1798
25 Ga0070705_100227084 3300005440 Bacteria 1296
26 Ga0070678_100029987 3300005456 Bacteria 3732
27 Ga0070681_10000021 3300005458 Bacteria 116877
28 Ga0070681_10042836 3300005458 Bacteria 4536
29 Ga0070681_10149357 3300005458 Bacteria 2264
30 Ga0070681_10370413 3300005458 Bacteria 1343
31 Ga0068867_100025132 3300005459 Bacteria 4272
32 Ga0070698_100128726 3300005471 Bacteria 2488
33 Ga0070699_100084393 3300005518 Bacteria 2772
34 Ga0070679_100000298 3300005530 Bacteria 42304
35 Ga0070679_100063581 3300005530 Bacteria 3678
36 Ga0070679_100455277 3300005530 Bacteria 1224
37 Ga0070684_100160171 3300005535 Bacteria 2041
38 Ga0070697_100193861 3300005536 Bacteria 1725
39 Ga0068853_100002435 3300005539 Bacteria 13925
40 Ga0068853_100029250 3300005539 Bacteria 4643
41 Ga0068853_100722662 3300005539 Bacteria 951
42 Ga0070672_100088542 3300005543 Bacteria 2493
43 Ga0070696_100061224 3300005546 Bacteria 2633
44 Ga0070696_100187913 3300005546 Bacteria 1536
45 Ga0070696_100193195 3300005546 Bacteria 1516
46 Ga0070665_100015549 3300005548 Bacteria 7643
47 Ga0070665_100028487 3300005548 Bacteria 5624
48 Ga0070665_100033362 3300005548 Bacteria 5180
49 Ga0070665_100276682 3300005548 Bacteria 1680
50 Ga0070665_100305193 3300005548 Bacteria 1595
51 Ga0070665_100560768 3300005548 Bacteria 1155
52 Ga0068855_100000010 3300005563 Bacteria 246022
53 Ga0068855_100041788 3300005563 Bacteria 5433
54 Ga0070664_100194752 3300005564 Bacteria 1807
55 Ga0068857_100035745 3300005577 Bacteria 4401
56 Ga0068857_100655922 3300005577 Bacteria 995
57 Ga0068856_100000460 3300005614 Bacteria 44894
58 Ga0068852_100033092 3300005616 Bacteria 4288
59 Ga0068852_100043727 3300005616 Bacteria 3800
60 Ga0068864_100188444 3300005618 Bacteria 1889
61 Ga0068866_10040570 3300005718 Bacteria 2305
62 Ga0068866_10063599 3300005718 Bacteria 1924
63 Ga0068861_100158084 3300005719 Bacteria 1867
64 Ga0068863_100019194 3300005841 Bacteria 6544
65 Ga0068858_100137048 3300005842 Bacteria 2297
66 Ga0068860_100126911 3300005843 Bacteria 2445
67 Ga0081538_10001311 3300005981 Bacteria 25698
68 Ga0081540_1014990 3300005983 Bacteria 4926
69 Ga0081539_10066835 3300005985 Bacteria 1947
70 Ga0070716_100033515 3300006173 Bacteria 2810
71 Ga0070712_100001600 3300006175 Bacteria 13842
72 Ga0070712_100002867 3300006175 Bacteria 10680
73 Ga0097621_100000693 3300006237 Bacteria 23626
74 Ga0097621_100006007 3300006237 Bacteria 8580
75 Ga0097621_100056985 3300006237 Bacteria 3193
76 Ga0097621_100058996 3300006237 Bacteria 3141
77 Ga0068871_100000385 3300006358 Bacteria 31027
78 Ga0068871_100007249 3300006358 Bacteria 7909
79 Ga0068871_100023375 3300006358 Bacteria 4780
80 Ga0068871_100151738 3300006358 Bacteria 1976
81 Ga0075428_100168090 3300006844 Bacteria 2379
82 Ga0075430_100139643 3300006846 Bacteria 2018
83 Ga0075431_100163961 3300006847 Bacteria 2285
84 Ga0075431_100444660 3300006847 Bacteria 1293
85 Ga0075434_100128878 3300006871 Bacteria 2548
86 Ga0068865_100014874 3300006881 Bacteria 4952
87 Ga0068865_100104501 3300006881 Bacteria 2079
88 Ga0075436_100000327 3300006914 Bacteria 30470
89 Ga0105250_10000010 3300009092 Bacteria 298384
90 Ga0105240_10000675 3300009093 Bacteria 62663
91 Ga0105240_10055789 3300009093 Bacteria 4946
92 Ga0105240_10141303 3300009093 Bacteria 2878
93 Ga0105240_10166144 3300009093 Bacteria 2617
94 Ga0105240_10216515 3300009093 Bacteria 2234
95 Ga0111539_10000097 3300009094 Bacteria 91946
96 Ga0111539_10029470 3300009094 Bacteria 6685
97 Ga0105241_10060420 3300009174 Bacteria 2916
98 Ga0105241_10138379 3300009174 Bacteria 1979
99 Ga0105241_10308760 3300009174 Bacteria 1360
100 Ga0105242_10004594 3300009176 Bacteria 10703
101 Ga0105242_10048968 3300009176 Bacteria 3437
102 Ga0105242_10273544 3300009176 Bacteria 1531
103 Ga0105242_10309813 3300009176 Bacteria 1444
104 Ga0105248_10000009 3300009177 Bacteria 403549
105 Ga0105248_10013067 3300009177 Bacteria 9147
106 Ga0105248_10784978 3300009177 Bacteria 1075
107 Ga0105237_10053669 3300009545 Bacteria 4042
108 Ga0105237_10181238 3300009545 Bacteria 2106
109 Ga0105238_10013230 3300009551 Bacteria 8325
110 Ga0105238_10014297 3300009551 Bacteria 8024
111 Ga0105238_10028247 3300009551 Bacteria 5716
112 Ga0105238_10061746 3300009551 Bacteria 3749
113 Ga0105238_10451340 3300009551 Bacteria 1283
114 Ga0105249_10013501 3300009553 Bacteria 7213
115 Ga0105249_10193256 3300009553 Bacteria 1987
116 Ga0105239_10001127 3300010375 Bacteria 36856
117 Ga0105239_10008108 3300010375 Bacteria 11989
118 Ga0105239_10012933 3300010375 Bacteria 9285
119 Ga0105239_10026242 3300010375 Bacteria 6413
120 Ga0105239_10149364 3300010375 Bacteria 2608
121 Ga0105239_10482877 3300010375 Bacteria 1408
122 Ga0157373_10107571 3300013100 Bacteria 1960
123 Ga0157371_10172691 3300013102 Bacteria 1545
124 Ga0157371_10278521 3300013102 Bacteria 1208
125 Ga0157370_10097457 3300013104 Bacteria 2758
126 Ga0157370_10109201 3300013104 Bacteria 2586
127 Ga0157369_10004375 3300013105 Bacteria 16679
128 Ga0157369_10016283 3300013105 Bacteria 8370
129 Ga0157369_10040284 3300013105 Bacteria 5100
130 Ga0157369_10451944 3300013105 Bacteria 1330
131 Ga0157374_10047290 3300013296 Bacteria 3989
132 Ga0157374_10135570 3300013296 Bacteria 2386
133 Ga0157378_10070393 3300013297 Bacteria 3141
134 Ga0157378_10136840 3300013297 Bacteria 2271
135 Ga0157378_10364101 3300013297 Bacteria 1416
136 Ga0163162_10018409 3300013306 Bacteria 6844
137 Ga0163162_10315001 3300013306 Bacteria 1697
138 Ga0163162_10389860 3300013306 Bacteria 1526
139 Ga0157372_10126980 3300013307 Bacteria 2933
140 Ga0157372_10219921 3300013307 Bacteria 2202
141 Ga0157375_10012677 3300013308 Bacteria 7482
142 Ga0163163_10028135 3300014325 Bacteria 5393
143 Ga0163163_10119109 3300014325 Bacteria 2673
144 Ga0163163_10189245 3300014325 Bacteria 2107
145 Ga0163163_10593439 3300014325 Bacteria 1171
146 Ga0157380_10008620 3300014326 Bacteria 7287
147 Ga0157380_10021230 3300014326 Bacteria 4868
148 Ga0182008_10095222 3300014497 Bacteria 1469
149 Ga0157379_10001252 3300014968 Bacteria 20605
150 Ga0157379_10021519 3300014968 Bacteria 5709
151 Ga0157379_10223953 3300014968 Bacteria 1704
152 Ga0157379_10597410 3300014968 Bacteria 1030
153 Ga0157376_10123241 3300014969 Bacteria 2301
154 Ga0213872_10047570 3300021361 Bacteria 1950
155 Ga0213876_10001119 3300021384 Bacteria 17114
156 Ga0209130_1001492 3300025284 Bacteria 15195
157 Ga0209025_1000509 3300025294 Bacteria 74336
158 Ga0209758_1000085 3300025297 Bacteria 256191
159 Ga0209758_1004952 3300025297 Bacteria 10671
160 Ga0207426_1000080 3300025302 Bacteria 304917
161 Ga0209257_1000376 3300025304 Bacteria 89065
162 Ga0207696_1000159 3300025711 Bacteria 111473
163 Ga0207682_10165229 3300025893 Bacteria 1005
164 Ga0207692_10101400 3300025898 Bacteria 1581
165 Ga0207642_10081845 3300025899 Bacteria 1570
166 Ga0207680_10022243 3300025903 Bacteria 3445
167 Ga0207699_10000207 3300025906 Bacteria 35120
168 Ga0207705_10213023 3300025909 Bacteria 1466
169 Ga0207654_10077895 3300025911 Bacteria 1988
170 Ga0207654_10104370 3300025911 Bacteria 1752
171 Ga0207707_10000002 3300025912 Bacteria 1142054
172 Ga0207707_10056532 3300025912 Bacteria 3414
173 Ga0207707_10061304 3300025912 Bacteria 3273
174 Ga0207695_10000003 3300025913 Bacteria 1368691
175 Ga0207695_10037544 3300025913 Bacteria 5226
176 Ga0207695_10063309 3300025913 Bacteria 3814
177 Ga0207695_10170681 3300025913 Bacteria 2100
178 Ga0207695_10171572 3300025913 Bacteria 2094
179 Ga0207695_10193866 3300025913 Bacteria 1948
180 Ga0207671_10047897 3300025914 Bacteria 3163
181 Ga0207671_10098378 3300025914 Bacteria 2213
182 Ga0207693_10001241 3300025915 Bacteria 22688
183 Ga0207693_10001861 3300025915 Bacteria 18466
184 Ga0207663_10007220 3300025916 Bacteria 5748
185 Ga0207663_10406781 3300025916 Bacteria 1042
186 Ga0207660_10001679 3300025917 Bacteria 14829
187 Ga0207660_10297293 3300025917 Bacteria 1285
188 Ga0207649_10000284 3300025920 Bacteria 39562
189 Ga0207649_10313488 3300025920 Bacteria 1150
190 Ga0207652_10000223 3300025921 Bacteria 59425
191 Ga0207652_10093595 3300025921 Bacteria 2645
192 Ga0207652_10214260 3300025921 Bacteria 1735
193 Ga0207681_10076899 3300025923 Bacteria 2345
194 Ga0207694_10000011 3300025924 Bacteria 417640
195 Ga0207694_10024377 3300025924 Bacteria 4594
196 Ga0207694_10349679 3300025924 Bacteria 1223
197 Ga0207694_10424667 3300025924 Bacteria 1108
198 Ga0207700_10044486 3300025928 Bacteria 3269
199 Ga0207700_10141276 3300025928 Bacteria 1979
200 Ga0207686_10111036 3300025934 Bacteria 1849
201 Ga0207686_10120705 3300025934 Bacteria 1784
202 Ga0207669_10032719 3300025937 Bacteria 2924
203 Ga0207669_10174833 3300025937 Bacteria 1533
204 Ga0207691_10066690 3300025940 Bacteria 3256
205 Ga0207711_10000003 3300025941 Bacteria 1042791
206 Ga0207711_10000005 3300025941 Bacteria 822972
207 Ga0207711_10000015 3300025941 Bacteria 494097
208 Ga0207711_10014384 3300025941 Bacteria 6571
209 Ga0207711_10024895 3300025941 Bacteria 5021
210 Ga0207689_10110624 3300025942 Bacteria 2258
211 Ga0207679_10315022 3300025945 Bacteria 1353
212 Ga0207667_10000093 3300025949 Bacteria 145814
213 Ga0207667_10621456 3300025949 Bacteria 1088
214 Ga0207712_10154103 3300025961 Bacteria 1778
215 Ga0207668_10443620 3300025972 Bacteria 1106
216 Ga0207703_10266268 3300026035 Bacteria 1551
217 Ga0207703_10370078 3300026035 Bacteria 1323
218 Ga0207639_10002042 3300026041 Bacteria 13609
219 Ga0207639_10084713 3300026041 Bacteria 2518
220 Ga0207639_10116746 3300026041 Bacteria 2186
221 Ga0207639_10512746 3300026041 Bacteria 1097
222 Ga0207702_10000148 3300026078 Bacteria 81831
223 Ga0207702_10490222 3300026078 Bacteria 1197
224 Ga0207641_10037982 3300026088 Bacteria 4024
225 Ga0207648_10015939 3300026089 Bacteria 6886
226 Ga0207648_10299676 3300026089 Bacteria 1441
227 Ga0207674_10054895 3300026116 Bacteria 4054
228 Ga0207674_10217079 3300026116 Bacteria 1861
229 Ga0207675_100025854 3300026118 Bacteria 5461
230 Ga0207683_10006884 3300026121 Bacteria 9737
231 Ga0207698_10030504 3300026142 Bacteria 3878
232 Ga0207698_10127384 3300026142 Bacteria 2168
233 Ga0207428_10000211 3300027907 Bacteria 80851
234 Ga0268266_10012052 3300028379 Bacteria 7483
235 Ga0268266_10025276 3300028379 Bacteria 5054
236 Ga0268266_10025815 3300028379 Bacteria 4999
237 Ga0268266_10045306 3300028379 Bacteria 3762
238 Ga0268266_10090872 3300028379 Bacteria 2676
239 Ga0268266_10246070 3300028379 Bacteria 1652
240 Ga0268264_10220961 3300028381 Bacteria 1744
241 Ga0268264_10256628 3300028381 Bacteria 1626
242 Ga0265318_10000052 3300028577 Bacteria 116086
243 Ga0307517_10101456 3300028786 Bacteria 2265
244 Ga0265338_10000007 3300028800 Bacteria 498229
245 Ga0265338_10007062 3300028800 Bacteria 14081
246 Ga0265338_10031164 3300028800 Bacteria 5231
247 Ga0265338_10100839 3300028800 Bacteria 2353
248 Ga0265338_10144248 3300028800 Bacteria 1860
249 Ga0265330_10001764 3300031235 Bacteria 12154
250 Ga0265330_10063995 3300031235 Bacteria 1598
251 Ga0265325_10000001 3300031241 Bacteria 726814
252 Ga0265325_10000490 3300031241 Bacteria 28750
253 Ga0265325_10048835 3300031241 Bacteria 2186
254 Ga0265340_10000265 3300031247 Bacteria 27074
255 Ga0265340_10005274 3300031247 Bacteria 7175
256 Ga0265339_10000812 3300031249 Bacteria 24127
257 Ga0265339_10063003 3300031249 Bacteria 1992
258 Ga0265331_10000020 3300031250 Bacteria 258149
259 Ga0265331_10000611 3300031250 Bacteria 31257
260 Ga0265331_10014875 3300031250 Bacteria 4127
261 Ga0265331_10016642 3300031250 Bacteria 3855
262 Ga0265327_10000076 3300031251 Bacteria 212272
263 Ga0265316_10002042 3300031344 Bacteria 21259
264 Ga0265316_10012782 3300031344 Bacteria 7500
265 Ga0265316_10027551 3300031344 Bacteria 4703
266 Ga0265316_10204975 3300031344 Bacteria 1461
267 Ga0265316_10329919 3300031344 Bacteria 1107
268 Ga0307513_10165332 3300031456 Bacteria 2098
269 Ga0307513_10280439 3300031456 Bacteria 1444
270 Ga0307408_100107917 3300031548 Bacteria 2133
271 Ga0265313_10004377 3300031595 Bacteria 10900
272 Ga0265313_10007052 3300031595 Bacteria 7776
273 Ga0265313_10013494 3300031595 Bacteria 4898
274 Ga0265313_10032555 3300031595 Bacteria 2660
275 Ga0307508_10123110 3300031616 Bacteria 2196
276 Ga0265314_10018015 3300031711 Bacteria 5522
277 Ga0265314_10039188 3300031711 Bacteria 3416
278 Ga0265314_10067635 3300031711 Bacteria 2405
279 Ga0265314_10101169 3300031711 Bacteria 1852
280 Ga0265342_10026505 3300031712 Bacteria 3630
281 Ga0307516_10009947 3300031730 Bacteria 10535
282 Ga0307516_10024010 3300031730 Bacteria 6235
283 Ga0307516_10306345 3300031730 Bacteria 1263
284 Ga0307405_10427439 3300031731 Bacteria 1044
285 Ga0307410_10129491 3300031852 Bacteria 1852
286 Ga0307406_10230373 3300031901 Bacteria 1383
287 Ga0307406_10325002 3300031901 Bacteria 1192
288 Ga0307416_100230012 3300032002 Bacteria 1787
289 Ga0307416_100620102 3300032002 Bacteria 1163
290 Ga0307415_100224723 3300032126 Bacteria 1508
291 Ga0373954_0043567 3300035118 Bacteria 2093
292 Ga0373957_0225012 3300035120 Bacteria 786
293 Ga0373931_0268237 3300035691 Bacteria 1044
294 Ga0373927_0234168 3300035695 Bacteria 1207
295 Ga0373933_0035079 3300035724 Bacteria 2927
296 Ga0373947_0151908 3300035725 Bacteria 1492
297 Ga0373937_0002502 3300036401 Bacteria 15266
298 Ga0373937_0014736 3300036401 Bacteria 6902
299 Ga0373937_0068439 3300036401 Bacteria 3273
300 Ga0373937_0259725 3300036401 Bacteria 1638
301 Ga0373925_0019559 3300037068 Bacteria 4927
302 Ga0373925_0094193 3300037068 Bacteria 2293
303 Ga0373925_0216858 3300037068 Bacteria 1526
304 Ga0395900_0111346 3300037418 Bacteria 2812
305 Ga0395905_0102062 3300037471 Bacteria 2693
306 Ga0436365_0428631 3300039437 Bacteria 1982
307 Ga0436365_1122293 3300039437 Bacteria 76517
308 Ga0436360_0662483 3300039438 Bacteria 943
309 Ga0436361_0250859 3300039447 Bacteria 3049
310 Ga0436361_0839909 3300039447 Bacteria 5145
311 Ga0451789_0427557 3300041443 Bacteria 937
312 Ga0451849_1218451 3300041505 Bacteria 2825
313 Ga0466967_0379653 3300045976 Bacteria 1372
314 Ga0466967_0540169 3300045976 Bacteria 1147
315 Ga0495580_0031639 3300046472 Bacteria 3822
316 Ga0495610_0028080 3300046512 Bacteria 2981
317 Ga0495610_0032421 3300046512 Bacteria 2713
318 Ga0495630_0254115 3300046517 Bacteria 1343
319 Ga0495652_0219112 3300046529 Bacteria 1431
320 Ga0495645_0030652 3300046543 Bacteria 3918
321 Ga0495645_0137737 3300046543 Bacteria 1706
322 Ga0495622_0004441 3300046557 Bacteria 6511
323 Ga0495622_0108797 3300046557 Bacteria 1269
324 Ga0495657_0299655 3300046675 Bacteria 959
325 Ga0495599_0312024 3300046678 Bacteria 948
326 Ga0495649_0162296 3300046694 Bacteria 1171
327 Ga0495600_0339378 3300046809 Bacteria 942
328 Ga0495636_0145249 3300047318 Bacteria 1062
329 Ga0495614_0206616 3300048089 Bacteria 890
330 Ga0496106_0403501 3300048909 Bacteria 1099
331 Ga0496115_0030245 3300048918 Bacteria 4259
332 Ga0496121_0001026 3300048924 Bacteria 49755
333 Ga0496126_0000314 3300048929 Bacteria 102938
334 Ga0495682_0001385 3300049460 Bacteria 13229
335 Ga0501031_0003980 3300049568 Bacteria 9524
336 Ga0501032_0002111 3300049569 Bacteria 15684
337 Ga0501032_0165540 3300049569 Bacteria 1451
338 Ga0501033_0004856 3300049570 Bacteria 10709
339 Ga0501033_0062572 3300049570 Bacteria 2740
340 Ga0501033_0075211 3300049570 Bacteria 2479
341 Ga0501033_0172522 3300049570 Bacteria 1553
342 Ga0501033_0207314 3300049570 Bacteria 1399
343 Ga0501033_0396787 3300049570 Bacteria 962
344 Ga0501034_0020103 3300049571 Bacteria 6817
345 Ga0501034_0098911 3300049571 Bacteria 2912
346 Ga0501034_0294579 3300049571 Bacteria 1560
347 Ga0501036_0001296 3300049572 Bacteria 19151
348 Ga0501036_0072405 3300049572 Bacteria 2913
349 Ga0501036_0186385 3300049572 Bacteria 1746
350 Ga0501037_0008096 3300049573 Bacteria 7701
351 Ga0501037_0402080 3300049573 Bacteria 939
352 Ga0501038_0049545 3300049574 Bacteria 3631
353 Ga0501038_0255724 3300049574 Bacteria 1386
354 Ga0501038_0264483 3300049574 Bacteria 1358
355 Ga0501039_0012399 3300049575 Bacteria 6507
356 Ga0501039_0156708 3300049575 Bacteria 1789
357 Ga0501040_0027902 3300049576 Bacteria 3803
358 Ga0501042_0010598 3300049578 Bacteria 6190
359 Ga0501043_0018973 3300049579 Bacteria 5397
360 Ga0501043_0075151 3300049579 Bacteria 2654
361 Ga0501046_0005546 3300049580 Bacteria 11274
362 Ga0501046_0023333 3300049580 Bacteria 5091
363 Ga0501046_0043026 3300049580 Bacteria 3598
364 Ga0501047_0077273 3300049581 Bacteria 3203
365 Ga0501047_0132393 3300049581 Bacteria 2374
366 Ga0501047_0170216 3300049581 Bacteria 2047
367 Ga0501047_0232860 3300049581 Bacteria 1695
368 Ga0501047_0281494 3300049581 Bacteria 1507
369 Ga0501048_0018168 3300049582 Bacteria 5172
370 Ga0501067_0007353 3300049583 Bacteria 6118
371 Ga0501068_0010615 3300049584 Bacteria 5181
372 Ga0501069_0005623 3300049585 Bacteria 6523
373 Ga0501069_0007791 3300049585 Bacteria 5623
374 Ga0501069_0011486 3300049585 Bacteria 4692
375 Ga0501070_0011350 3300049586 Bacteria 7527
376 Ga0501070_0040006 3300049586 Bacteria 3910
377 Ga0501070_0056464 3300049586 Bacteria 3255
378 Ga0501070_0124466 3300049586 Bacteria 2131
379 Ga0501071_0480465 3300049587 Bacteria 952
380 Ga0501072_0068692 3300049588 Bacteria 2797
381 Ga0501072_0197023 3300049588 Bacteria 1606
382 Ga0501073_0024731 3300049589 Bacteria 4311
383 Ga0501073_0027941 3300049589 Bacteria 4030
384 Ga0501073_0054368 3300049589 Bacteria 2803
385 Ga0501073_0143448 3300049589 Bacteria 1655
386 Ga0501074_0001757 3300049590 Bacteria 14801
387 Ga0501074_0037729 3300049590 Bacteria 3501
388 Ga0501075_0026629 3300049591 Bacteria 4259
389 Ga0501076_0041094 3300049592 Bacteria 3636
390 Ga0501077_0007245 3300049593 Bacteria 6842
391 Ga0501077_0111900 3300049593 Bacteria 1731
392 Ga0501079_0009757 3300049741 Bacteria 7280
393 Ga0501079_0013267 3300049741 Bacteria 6282
394 Ga0501079_0042922 3300049741 Bacteria 3491
395 Ga0501080_0014487 3300049742 Bacteria 7263
396 Ga0501080_0093293 3300049742 Bacteria 2795
397 Ga0501080_0212649 3300049742 Bacteria 1772
398 Ga0501080_0261205 3300049742 Bacteria 1578
399 Ga0501080_0318600 3300049742 Bacteria 1408
400 Ga0501080_0627321 3300049742 Bacteria 953
401 Ga0501081_0036485 3300049743 Bacteria 3353
402 Ga0501083_0004403 3300049744 Bacteria 9927
403 Ga0501083_0016604 3300049744 Bacteria 5148
404 Ga0501083_0043904 3300049744 Bacteria 3027
405 Ga0501083_0069804 3300049744 Bacteria 2338
406 Ga0501083_0125673 3300049744 Bacteria 1681
407 Ga0501035_0006403 3300049822 Bacteria 11069
408 Ga0501035_0049075 3300049822 Bacteria 3783
409 Ga0501035_0068802 3300049822 Bacteria 3139
410 Ga0501035_0164909 3300049822 Bacteria 1916
411 Ga0501035_0179002 3300049822 Bacteria 1828
412 Ga0501035_0492714 3300049822 Bacteria 1009
413 Ga0501044_0031230 3300049823 Bacteria 5607
414 Ga0501044_0034904 3300049823 Bacteria 5269
415 Ga0501044_0044502 3300049823 Bacteria 4606
416 Ga0501044_0060970 3300049823 Bacteria 3860
417 Ga0501044_0215921 3300049823 Bacteria 1870
418 Ga0501044_0565456 3300049823 Bacteria 1033
419 Ga0501045_0019349 3300049824 Bacteria 4853
420 nmdc:mga0qj67_149203_c1 3300050509 Bacteria 1896
421 nmdc:mga0qj67_79788_c1 3300050509 Bacteria 2621
422 nmdc:mga08y16_179_c1 3300050511 Bacteria 56078
423 nmdc:mga08y16_31003_c1 3300050511 Bacteria 5623
424 nmdc:mga0n895_71556_c1 3300050512 Bacteria 3439
425 nmdc:mga0n895_94786_c1 3300050512 Bacteria 2989
426 nmdc:mga0rr50_49135_c1 3300050513 Bacteria 3122
427 nmdc:mga08x19_30592_c1 3300050514 Bacteria 3383
428 nmdc:mga08x19_80_c1 3300050514 Bacteria 87696
429 Ga0500643_000026 3300053087 Bacteria 259231
430 Ga0500646_0046224 3300053090 Bacteria 1242
431 Ga0500555_041375 3300053103 Bacteria 1282
432 Ga0500595_053801 3300053119 Bacteria 1238
433 Ga0500642_0000303 3300053130 Bacteria 17604
434 Ga0500642_0114234 3300053130 Bacteria 1261
435 Ga0500652_077618 3300053131 Bacteria 1381
436 Ga0500559_0034131 3300053136 Bacteria 2193
437 Ga0500573_0000004 3300053140 Bacteria 341236
438 Ga0500616_0007964 3300053153 Bacteria 6652
439 Ga0500619_002422 3300053154 Bacteria 3588
440 Ga0500609_007097 3300053731 Bacteria 1514
441 Ga0501084_0000236 3300054114 Bacteria 41685
442 Ga0501084_0002143 3300054114 Bacteria 15776
443 Ga0501084_0016171 3300054114 Bacteria 6195
444 Ga0501082_0013502 3300060353 Bacteria 7017
445 Ga0501082_0052921 3300060353 Bacteria 3500
446 Ga0501082_0061525 3300060353 Bacteria 3232
447 Ga0501082_0078996 3300060353 Bacteria 2838
448 Ga0501082_0110761 3300060353 Bacteria 2376
449 Ga0501082_0588416 3300060353 Bacteria 974
450 Ga0501082_0659674 3300060353 Bacteria 916
451 Ga0530510_0023651 3300061734 Bacteria 4381

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049744 Ga0501083_0125673 Ga0501083_0125673_19_711 222
2 3300035120 Ga0373957_0225012 Ga0373957_0225012_12_707 230
3 3300025917 Ga0207660_10297293 Ga0207660_102972932 238
4 3300025921 Ga0207652_10093595 Ga0207652_100935952 238
5 3300006846 Ga0075430_100139643 Ga0075430_1001396432 248
6 3300053130 Ga0500642_0000303 Ga0500642_0000303_2870_3640 251
7 3300013105 Ga0157369_10451944 Ga0157369_104519442 252
8 3300048918 Ga0496115_0030245 Ga0496115_0030245_2473_3246 252
9 iso_pu_bacteria 2842333319 2842340115 252
10 3300005546 Ga0070696_100061224 Ga0070696_1000612242 253
11 3300048929 Ga0496126_0000314 Ga0496126_0000314_87328_88092 253
12 3300053131 Ga0500652_077618 Ga0500652_077618_285_1127 253
13 3300009176 Ga0105242_10004594 Ga0105242_100045946 254
14 3300028800 Ga0265338_10031164 Ga0265338_100311645 254
15 3300031344 Ga0265316_10204975 Ga0265316_102049752 254
16 iso_pu_bacteria 2842694124 2842696960 254
17 3300005295 Ga0065707_10082983 Ga0065707_100829834 255
18 3300005295 Ga0065707_10220948 Ga0065707_102209482 255
19 3300005344 Ga0070661_100286740 Ga0070661_1002867401 255
20 3300005353 Ga0070669_100017193 Ga0070669_1000171931 255
21 3300005356 Ga0070674_100079587 Ga0070674_1000795871 255
22 3300005458 Ga0070681_10000021 Ga0070681_1000002194 255
23 3300005458 Ga0070681_10370413 Ga0070681_103704132 255
24 3300005471 Ga0070698_100128726 Ga0070698_1001287262 255
25 3300005530 Ga0070679_100000298 Ga0070679_10000029848 255
26 3300005536 Ga0070697_100193861 Ga0070697_1001938612 255
27 3300005539 Ga0068853_100002435 Ga0068853_1000024356 255
28 3300005539 Ga0068853_100029250 Ga0068853_1000292502 255
29 3300005546 Ga0070696_100187913 Ga0070696_1001879132 255
30 3300005563 Ga0068855_100000010 Ga0068855_10000001024 255
31 3300005616 Ga0068852_100033092 Ga0068852_1000330921 255
32 3300005616 Ga0068852_100043727 Ga0068852_1000437275 255
33 3300005718 Ga0068866_10063599 Ga0068866_100635992 255
34 3300005719 Ga0068861_100158084 Ga0068861_1001580842 255
35 3300006173 Ga0070716_100033515 Ga0070716_1000335152 255
36 3300006847 Ga0075431_100444660 Ga0075431_1004446601 255
37 3300006881 Ga0068865_100104501 Ga0068865_1001045012 255
38 3300009092 Ga0105250_10000010 Ga0105250_10000010203 255
39 3300009093 Ga0105240_10000675 Ga0105240_1000067534 255
40 3300009094 Ga0111539_10000097 Ga0111539_1000009782 255
41 3300009174 Ga0105241_10308760 Ga0105241_103087602 255
42 3300009177 Ga0105248_10000009 Ga0105248_1000000992 255
43 3300009551 Ga0105238_10014297 Ga0105238_1001429710 255
44 3300009553 Ga0105249_10193256 Ga0105249_101932562 255
45 3300010375 Ga0105239_10001127 Ga0105239_1000112734 255
46 3300010375 Ga0105239_10008108 Ga0105239_100081085 255
47 3300010375 Ga0105239_10026242 Ga0105239_100262428 255
48 3300013105 Ga0157369_10016283 Ga0157369_100162833 255
49 3300013297 Ga0157378_10070393 Ga0157378_100703932 255
50 3300013297 Ga0157378_10136840 Ga0157378_101368402 255
51 3300013306 Ga0163162_10315001 Ga0163162_103150012 255
52 3300014325 Ga0163163_10593439 Ga0163163_105934392 255
53 3300014326 Ga0157380_10008620 Ga0157380_100086206 255
54 3300014968 Ga0157379_10001252 Ga0157379_100012522 255
55 3300025711 Ga0207696_1000159 Ga0207696_100015920 255
56 3300025911 Ga0207654_10077895 Ga0207654_100778952 255
57 3300025912 Ga0207707_10000002 Ga0207707_100000021179 255
58 3300025913 Ga0207695_10000003 Ga0207695_10000003396 255
59 3300025913 Ga0207695_10171572 Ga0207695_101715722 255
60 3300025914 Ga0207671_10098378 Ga0207671_100983782 255
61 3300025916 Ga0207663_10406781 Ga0207663_104067811 255
62 3300025917 Ga0207660_10001679 Ga0207660_100016798 255
63 3300025921 Ga0207652_10000223 Ga0207652_1000022367 255
64 3300025923 Ga0207681_10076899 Ga0207681_100768992 255
65 3300025924 Ga0207694_10000011 Ga0207694_10000011365 255
66 3300025928 Ga0207700_10141276 Ga0207700_101412762 255
67 3300025937 Ga0207669_10032719 Ga0207669_100327192 255
68 3300025941 Ga0207711_10000003 Ga0207711_10000003419 255
69 3300025941 Ga0207711_10000005 Ga0207711_10000005716 255
70 3300025941 Ga0207711_10000015 Ga0207711_10000015172 255
71 3300025949 Ga0207667_10000093 Ga0207667_1000009312 255
72 3300025961 Ga0207712_10154103 Ga0207712_101541032 255
73 3300026041 Ga0207639_10002042 Ga0207639_100020425 255
74 3300026041 Ga0207639_10512746 Ga0207639_105127462 255
75 3300026078 Ga0207702_10490222 Ga0207702_104902222 255
76 3300026089 Ga0207648_10299676 Ga0207648_102996761 255
77 3300026118 Ga0207675_100025854 Ga0207675_1000258545 255
78 3300026142 Ga0207698_10030504 Ga0207698_100305045 255
79 3300026142 Ga0207698_10127384 Ga0207698_101273843 255
80 3300027907 Ga0207428_10000211 Ga0207428_1000021173 255
81 3300028800 Ga0265338_10000007 Ga0265338_10000007514 255
82 3300028800 Ga0265338_10007062 Ga0265338_1000706210 255
83 3300028800 Ga0265338_10144248 Ga0265338_101442482 255
84 3300031235 Ga0265330_10001764 Ga0265330_100017644 255
85 3300031235 Ga0265330_10063995 Ga0265330_100639952 255
86 3300031241 Ga0265325_10000001 Ga0265325_10000001272 255
87 3300031241 Ga0265325_10048835 Ga0265325_100488352 255
88 3300031247 Ga0265340_10000265 Ga0265340_100002658 255
89 3300031247 Ga0265340_10005274 Ga0265340_100052742 255
90 3300031249 Ga0265339_10000812 Ga0265339_100008128 255
91 3300031250 Ga0265331_10016642 Ga0265331_100166422 255
92 3300031344 Ga0265316_10002042 Ga0265316_100020425 255
93 3300031344 Ga0265316_10012782 Ga0265316_100127824 255
94 3300031344 Ga0265316_10329919 Ga0265316_103299192 255
95 3300031548 Ga0307408_100107917 Ga0307408_1001079172 255
96 3300031595 Ga0265313_10007052 Ga0265313_100070528 255
97 3300031595 Ga0265313_10013494 Ga0265313_100134945 255
98 3300031711 Ga0265314_10039188 Ga0265314_100391884 255
99 3300031711 Ga0265314_10067635 Ga0265314_100676353 255
100 3300031711 Ga0265314_10101169 Ga0265314_101011692 255
101 3300031712 Ga0265342_10026505 Ga0265342_100265054 255
102 3300031730 Ga0307516_10009947 Ga0307516_100099473 255
103 3300031731 Ga0307405_10427439 Ga0307405_104274392 255
104 3300031901 Ga0307406_10230373 Ga0307406_102303732 255
105 3300032002 Ga0307416_100620102 Ga0307416_1006201022 255
106 3300032126 Ga0307415_100224723 Ga0307415_1002247232 255
107 3300035691 Ga0373931_0268237 Ga0373931_0268237_96_878 255
108 3300036401 Ga0373937_0259725 Ga0373937_0259725_206_976 255
109 3300039447 Ga0436361_0250859 Ga0436361_0250859_561_1349 255
110 3300041505 Ga0451849_1218451 Ga0451849_1218451_1721_2551 255
111 3300046529 Ga0495652_0219112 Ga0495652_0219112_122_892 255
112 3300046543 Ga0495645_0030652 Ga0495645_0030652_3086_3856 255
113 3300046543 Ga0495645_0137737 Ga0495645_0137737_666_1436 255
114 3300046557 Ga0495622_0108797 Ga0495622_0108797_362_1150 255
115 3300046678 Ga0495599_0312024 Ga0495599_0312024_50_820 255
116 3300046809 Ga0495600_0339378 Ga0495600_0339378_68_838 255
117 3300049460 Ga0495682_0001385 Ga0495682_0001385_11982_12752 255
118 3300049569 Ga0501032_0165540 Ga0501032_0165540_182_952 255
119 3300049571 Ga0501034_0020103 Ga0501034_0020103_1058_1828 255
120 3300049572 Ga0501036_0072405 Ga0501036_0072405_1701_2471 255
121 3300049574 Ga0501038_0255724 Ga0501038_0255724_364_1134 255
122 3300049579 Ga0501043_0075151 Ga0501043_0075151_1704_2474 255
123 3300049585 Ga0501069_0005623 Ga0501069_0005623_3407_4177 255
124 3300049586 Ga0501070_0040006 Ga0501070_0040006_2338_3108 255
125 3300049589 Ga0501073_0024731 Ga0501073_0024731_2243_3013 255
126 3300049590 Ga0501074_0037729 Ga0501074_0037729_1433_2203 255
127 3300049593 Ga0501077_0111900 Ga0501077_0111900_904_1674 255
128 3300049741 Ga0501079_0009757 Ga0501079_0009757_1091_1861 255
129 3300049742 Ga0501080_0014487 Ga0501080_0014487_3097_3867 255
130 3300049822 Ga0501035_0006403 Ga0501035_0006403_2282_3052 255
131 3300049822 Ga0501035_0068802 Ga0501035_0068802_673_1443 255
132 3300049823 Ga0501044_0031230 Ga0501044_0031230_2363_3133 255
133 3300049823 Ga0501044_0215921 Ga0501044_0215921_920_1690 255
134 3300050511 nmdc:mga08y16_179_c1 nmdc:mga08y16_179_c1_5998_6771 255
135 3300053154 Ga0500619_002422 Ga0500619_002422_1955_2725 255
136 3300054114 Ga0501084_0000236 Ga0501084_0000236_14541_15311 255
137 3300054114 Ga0501084_0016171 Ga0501084_0016171_5209_5979 255
138 3300060353 Ga0501082_0588416 Ga0501082_0588416_149_919 255
139 3300060353 Ga0501082_0659674 Ga0501082_0659674_98_868 255
140 3300005439 Ga0070711_100142632 Ga0070711_1001426321 256
141 3300005518 Ga0070699_100084393 Ga0070699_1000843932 256
142 3300021361 Ga0213872_10047570 Ga0213872_100475702 256
143 3300028577 Ga0265318_10000052 Ga0265318_1000005274 256
144 3300031456 Ga0307513_10165332 Ga0307513_101653322 256
145 3300031852 Ga0307410_10129491 Ga0307410_101294912 256
146 3300032002 Ga0307416_100230012 Ga0307416_1002300122 256
147 3300039447 Ga0436361_0839909 Ga0436361_0839909_611_1399 256
148 3300049574 Ga0501038_0264483 Ga0501038_0264483_355_1125 256
149 3300049575 Ga0501039_0156708 Ga0501039_0156708_907_1677 256
150 3300049576 Ga0501040_0027902 Ga0501040_0027902_1981_2751 256
151 3300049588 Ga0501072_0068692 Ga0501072_0068692_1388_2158 256
152 3300049591 Ga0501075_0026629 Ga0501075_0026629_664_1434 256
153 3300049592 Ga0501076_0041094 Ga0501076_0041094_2417_3187 256
154 3300049593 Ga0501077_0007245 Ga0501077_0007245_2549_3319 256
155 3300049741 Ga0501079_0042922 Ga0501079_0042922_1508_2278 256
156 3300049742 Ga0501080_0212649 Ga0501080_0212649_341_1111 256
157 3300049743 Ga0501081_0036485 Ga0501081_0036485_277_1047 256
158 3300049744 Ga0501083_0069804 Ga0501083_0069804_1413_2183 256
159 3300060353 Ga0501082_0078996 Ga0501082_0078996_1139_1909 256
160 3300061734 Ga0530510_0023651 Ga0530510_0023651_2505_3275 256
161 3300005842 Ga0068858_100137048 Ga0068858_1001370482 257
162 3300026035 Ga0207703_10266268 Ga0207703_102662682 257
163 3300037418 Ga0395900_0111346 Ga0395900_0111346_976_1749 257
164 3300037471 Ga0395905_0102062 Ga0395905_0102062_624_1397 257
165 3300048924 Ga0496121_0001026 Ga0496121_0001026_11831_12607 257
166 3300005344 Ga0070661_100001122 Ga0070661_1000011224 258
167 3300005434 Ga0070709_10000178 Ga0070709_1000017825 258
168 3300005437 Ga0070710_10084176 Ga0070710_100841762 258
169 3300005439 Ga0070711_100013345 Ga0070711_1000133452 258
170 3300005440 Ga0070705_100227084 Ga0070705_1002270842 258
171 3300005614 Ga0068856_100000460 Ga0068856_10000046027 258
172 3300006175 Ga0070712_100001600 Ga0070712_10000160011 258
173 3300006175 Ga0070712_100002867 Ga0070712_10000286715 258
174 3300006871 Ga0075434_100128878 Ga0075434_1001288782 258
175 3300006914 Ga0075436_100000327 Ga0075436_10000032726 258
176 3300014968 Ga0157379_10021519 Ga0157379_100215192 258
177 3300014968 Ga0157379_10597410 Ga0157379_105974102 258
178 3300025304 Ga0209257_1000376 Ga0209257_100037618 258
179 3300025898 Ga0207692_10101400 Ga0207692_101014002 258
180 3300025906 Ga0207699_10000207 Ga0207699_1000020724 258
181 3300025915 Ga0207693_10001241 Ga0207693_100012413 258
182 3300025915 Ga0207693_10001861 Ga0207693_1000186118 258
183 3300025916 Ga0207663_10007220 Ga0207663_100072206 258
184 3300025920 Ga0207649_10000284 Ga0207649_1000028432 258
185 3300025928 Ga0207700_10044486 Ga0207700_100444863 258
186 3300025949 Ga0207667_10621456 Ga0207667_106214562 258
187 3300026078 Ga0207702_10000148 Ga0207702_1000014811 258
188 3300031241 Ga0265325_10000490 Ga0265325_1000049032 258
189 3300031344 Ga0265316_10027551 Ga0265316_100275514 258
190 3300031595 Ga0265313_10004377 Ga0265313_100043772 258
191 3300035724 Ga0373933_0035079 Ga0373933_0035079_881_1666 258
192 3300036401 Ga0373937_0014736 Ga0373937_0014736_1587_2366 258
193 3300036401 Ga0373937_0068439 Ga0373937_0068439_2336_3121 258
194 3300037068 Ga0373925_0019559 Ga0373925_0019559_1733_2512 258
195 3300037068 Ga0373925_0216858 Ga0373925_0216858_269_1054 258
196 3300048909 Ga0496106_0403501 Ga0496106_0403501_300_1088 258
197 3300049570 Ga0501033_0172522 Ga0501033_0172522_624_1403 258
198 3300049586 Ga0501070_0124466 Ga0501070_0124466_833_1612 258
199 3300050512 nmdc:mga0n895_71556_c1 nmdc:mga0n895_71556_c1_1562_2347 258
200 3300050512 nmdc:mga0n895_94786_c1 nmdc:mga0n895_94786_c1_1546_2334 258
201 3300050513 nmdc:mga0rr50_49135_c1 nmdc:mga0rr50_49135_c1_2308_3096 258
202 3300050514 nmdc:mga08x19_80_c1 nmdc:mga08x19_80_c1_76366_77154 258
203 3300053119 Ga0500595_053801 Ga0500595_053801_10_789 258
204 3300005985 Ga0081539_10066835 Ga0081539_100668352 259
205 3300021384 Ga0213876_10001119 Ga0213876_1000111911 259
206 3300039437 Ga0436365_1122293 Ga0436365_1122293_990_1772 259
207 3300046517 Ga0495630_0254115 Ga0495630_0254115_540_1325 259
208 3300049581 Ga0501047_0232860 Ga0501047_0232860_191_973 259
209 3300049585 Ga0501069_0007791 Ga0501069_0007791_1265_2059 259
210 3300050509 nmdc:mga0qj67_149203_c1 nmdc:mga0qj67_149203_c1_495_1280 259
211 3300053153 Ga0500616_0007964 Ga0500616_0007964_1372_2187 259
212 3300053731 Ga0500609_007097 Ga0500609_007097_317_1141 259
213 iso_pu_bacteria 2883291878 2883293173 259
214 iso_pu_bacteria 2883354860 2883356156 259
215 3300005366 Ga0070659_100022636 Ga0070659_1000226363 260
216 3300005458 Ga0070681_10042836 Ga0070681_100428366 260
217 3300005530 Ga0070679_100455277 Ga0070679_1004552771 260
218 3300013100 Ga0157373_10107571 Ga0157373_101075711 260
219 3300013102 Ga0157371_10278521 Ga0157371_102785211 260
220 3300013104 Ga0157370_10097457 Ga0157370_100974572 260
221 3300013104 Ga0157370_10109201 Ga0157370_101092013 260
222 3300013105 Ga0157369_10004375 Ga0157369_1000437515 260
223 3300013307 Ga0157372_10126980 Ga0157372_101269802 260
224 3300014497 Ga0182008_10095222 Ga0182008_100952222 260
225 3300025912 Ga0207707_10056532 Ga0207707_100565326 260
226 3300031250 Ga0265331_10000020 Ga0265331_10000020209 260
227 3300031250 Ga0265331_10000611 Ga0265331_100006113 260
228 3300031251 Ga0265327_10000076 Ga0265327_10000076170 260
229 3300031711 Ga0265314_10018015 Ga0265314_100180154 260
230 3300039438 Ga0436360_0662483 Ga0436360_0662483_65_853 260
231 3300049571 Ga0501034_0294579 Ga0501034_0294579_720_1505 260
232 3300049580 Ga0501046_0023333 Ga0501046_0023333_450_1244 260
233 3300049581 Ga0501047_0132393 Ga0501047_0132393_208_993 260
234 3300049589 Ga0501073_0143448 Ga0501073_0143448_794_1588 260
235 3300049742 Ga0501080_0261205 Ga0501080_0261205_744_1529 260
236 3300049822 Ga0501035_0492714 Ga0501035_0492714_18_803 260
237 3300049823 Ga0501044_0565456 Ga0501044_0565456_21_818 260
238 3300060353 Ga0501082_0061525 Ga0501082_0061525_2414_3208 260
239 3300005327 Ga0070658_10213339 Ga0070658_102133392 261
240 3300005548 Ga0070665_100305193 Ga0070665_1003051932 261
241 3300005563 Ga0068855_100041788 Ga0068855_1000417885 261
242 3300009093 Ga0105240_10141303 Ga0105240_101413034 261
243 3300013102 Ga0157371_10172691 Ga0157371_101726912 261
244 3300025913 Ga0207695_10193866 Ga0207695_101938662 261
245 3300028379 Ga0268266_10246070 Ga0268266_102460702 261
246 3300028800 Ga0265338_10100839 Ga0265338_101008392 261
247 3300031249 Ga0265339_10063003 Ga0265339_100630032 261
248 3300031250 Ga0265331_10014875 Ga0265331_100148754 261
249 3300031595 Ga0265313_10032555 Ga0265313_100325552 261
250 3300031616 Ga0307508_10123110 Ga0307508_101231102 261
251 3300031730 Ga0307516_10306345 Ga0307516_103063452 261
252 3300039437 Ga0436365_0428631 Ga0436365_0428631_106_897 261
253 3300049568 Ga0501031_0003980 Ga0501031_0003980_3565_4353 261
254 3300049569 Ga0501032_0002111 Ga0501032_0002111_5236_6024 261
255 3300049570 Ga0501033_0004856 Ga0501033_0004856_6020_6808 261
256 3300049570 Ga0501033_0062572 Ga0501033_0062572_879_1667 261
257 3300049570 Ga0501033_0075211 Ga0501033_0075211_118_912 261
258 3300049571 Ga0501034_0098911 Ga0501034_0098911_315_1103 261
259 3300049572 Ga0501036_0001296 Ga0501036_0001296_8199_8987 261
260 3300049572 Ga0501036_0186385 Ga0501036_0186385_821_1609 261
261 3300049573 Ga0501037_0008096 Ga0501037_0008096_5211_5999 261
262 3300049573 Ga0501037_0402080 Ga0501037_0402080_26_820 261
263 3300049574 Ga0501038_0049545 Ga0501038_0049545_1809_2597 261
264 3300049575 Ga0501039_0012399 Ga0501039_0012399_521_1309 261
265 3300049578 Ga0501042_0010598 Ga0501042_0010598_5033_5821 261
266 3300049579 Ga0501043_0018973 Ga0501043_0018973_708_1496 261
267 3300049580 Ga0501046_0005546 Ga0501046_0005546_5301_6089 261
268 3300049581 Ga0501047_0077273 Ga0501047_0077273_628_1422 261
269 3300049581 Ga0501047_0281494 Ga0501047_0281494_398_1186 261
270 3300049582 Ga0501048_0018168 Ga0501048_0018168_2241_3029 261
271 3300049583 Ga0501067_0007353 Ga0501067_0007353_4903_5691 261
272 3300049584 Ga0501068_0010615 Ga0501068_0010615_1707_2495 261
273 3300049585 Ga0501069_0011486 Ga0501069_0011486_3618_4406 261
274 3300049586 Ga0501070_0011350 Ga0501070_0011350_1686_2474 261
275 3300049587 Ga0501071_0480465 Ga0501071_0480465_84_872 261
276 3300049588 Ga0501072_0197023 Ga0501072_0197023_521_1309 261
277 3300049589 Ga0501073_0027941 Ga0501073_0027941_1557_2345 261
278 3300049590 Ga0501074_0001757 Ga0501074_0001757_8842_9630 261
279 3300049741 Ga0501079_0013267 Ga0501079_0013267_589_1377 261
280 3300049742 Ga0501080_0093293 Ga0501080_0093293_322_1110 261
281 3300049744 Ga0501083_0004403 Ga0501083_0004403_7901_8689 261
282 3300049744 Ga0501083_0043904 Ga0501083_0043904_1266_2054 261
283 3300049822 Ga0501035_0049075 Ga0501035_0049075_1524_2312 261
284 3300049822 Ga0501035_0164909 Ga0501035_0164909_1019_1813 261
285 3300049823 Ga0501044_0034904 Ga0501044_0034904_580_1368 261
286 3300049823 Ga0501044_0044502 Ga0501044_0044502_99_893 261
287 3300049823 Ga0501044_0060970 Ga0501044_0060970_1039_1827 261
288 3300049824 Ga0501045_0019349 Ga0501045_0019349_747_1535 261
289 3300054114 Ga0501084_0002143 Ga0501084_0002143_5656_6444 261
290 3300060353 Ga0501082_0013502 Ga0501082_0013502_1810_2598 261
291 3300060353 Ga0501082_0052921 Ga0501082_0052921_403_1191 261
292 3300005548 Ga0070665_100028487 Ga0070665_1000284874 262
293 3300005981 Ga0081538_10001311 Ga0081538_100013118 262
294 3300006844 Ga0075428_100168090 Ga0075428_1001680902 262
295 3300006847 Ga0075431_100163961 Ga0075431_1001639612 262
296 3300009093 Ga0105240_10166144 Ga0105240_101661442 262
297 3300009094 Ga0111539_10029470 Ga0111539_100294703 262
298 3300009551 Ga0105238_10061746 Ga0105238_100617462 262
299 3300014326 Ga0157380_10021230 Ga0157380_100212304 262
300 3300025913 Ga0207695_10063309 Ga0207695_100633093 262
301 3300025937 Ga0207669_10174833 Ga0207669_101748332 262
302 3300028379 Ga0268266_10012052 Ga0268266_100120524 262
303 3300049570 Ga0501033_0396787 Ga0501033_0396787_117_908 262
304 3300049581 Ga0501047_0170216 Ga0501047_0170216_1188_1979 262
305 3300049822 Ga0501035_0179002 Ga0501035_0179002_897_1688 262
306 3300050509 nmdc:mga0qj67_79788_c1 nmdc:mga0qj67_79788_c1_1520_2317 262
307 3300050511 nmdc:mga08y16_31003_c1 nmdc:mga08y16_31003_c1_2932_3729 262
308 3300003215 JGI25153J46596_10001304 JGI25153J46596_1000130410 263
309 3300005546 Ga0070696_100193195 Ga0070696_1001931952 263
310 3300025297 Ga0209758_1000085 Ga0209758_100008569 263
311 3300049570 Ga0501033_0207314 Ga0501033_0207314_56_871 263
312 3300049586 Ga0501070_0056464 Ga0501070_0056464_866_1681 263
313 3300049589 Ga0501073_0054368 Ga0501073_0054368_1226_2029 263
314 3300049742 Ga0501080_0318600 Ga0501080_0318600_491_1306 263
315 3300049742 Ga0501080_0627321 Ga0501080_0627321_14_817 263
316 3300049744 Ga0501083_0016604 Ga0501083_0016604_2791_3594 263
317 3300060353 Ga0501082_0110761 Ga0501082_0110761_107_910 263
318 3300035695 Ga0373927_0234168 Ga0373927_0234168_200_1039 264
319 3300035725 Ga0373947_0151908 Ga0373947_0151908_376_1215 264
320 3300037068 Ga0373925_0094193 Ga0373925_0094193_874_1713 264
321 3300046472 Ga0495580_0031639 Ga0495580_0031639_677_1516 264
322 3300049580 Ga0501046_0043026 Ga0501046_0043026_2443_3243 264
323 3300009176 Ga0105242_10309813 Ga0105242_103098132 265
324 3300031901 Ga0307406_10325002 Ga0307406_103250022 265
325 3300035118 Ga0373954_0043567 Ga0373954_0043567_941_1783 265
326 3300045976 Ga0466967_0540169 Ga0466967_0540169_208_1011 265
327 3300053087 Ga0500643_000026 Ga0500643_000026_63754_64554 265
328 3300053090 Ga0500646_0046224 Ga0500646_0046224_83_883 265
329 3300053103 Ga0500555_041375 Ga0500555_041375_286_1086 265
330 3300050514 nmdc:mga08x19_30592_c1 nmdc:mga08x19_30592_c1_2337_3149 266
331 3300005327 Ga0070658_10221903 Ga0070658_102219032 267
332 3300005329 Ga0070683_100618244 Ga0070683_1006182441 267
333 3300005336 Ga0070680_100365866 Ga0070680_1003658662 267
334 3300005366 Ga0070659_100541302 Ga0070659_1005413021 267
335 3300005458 Ga0070681_10149357 Ga0070681_101493572 267
336 3300005530 Ga0070679_100063581 Ga0070679_1000635814 267
337 3300005577 Ga0068857_100035745 Ga0068857_1000357456 267
338 3300009551 Ga0105238_10013230 Ga0105238_100132308 267
339 3300025909 Ga0207705_10213023 Ga0207705_102130232 267
340 3300025912 Ga0207707_10061304 Ga0207707_100613044 267
341 3300025924 Ga0207694_10424667 Ga0207694_104246672 267
342 3300025945 Ga0207679_10315022 Ga0207679_103150222 267
343 3300026116 Ga0207674_10054895 Ga0207674_100548955 267
344 3300036401 Ga0373937_0002502 Ga0373937_0002502_7578_8399 267
345 3300048089 Ga0495614_0206616 Ga0495614_0206616_54_863 267
346 3300005456 Ga0070678_100029987 Ga0070678_1000299875 268
347 3300005459 Ga0068867_100025132 Ga0068867_1000251322 268
348 3300005539 Ga0068853_100722662 Ga0068853_1007226621 268
349 3300005543 Ga0070672_100088542 Ga0070672_1000885424 268
350 3300005718 Ga0068866_10040570 Ga0068866_100405702 268
351 3300006237 Ga0097621_100056985 Ga0097621_1000569852 268
352 3300006358 Ga0068871_100007249 Ga0068871_1000072498 268
353 3300006881 Ga0068865_100014874 Ga0068865_1000148743 268
354 3300009093 Ga0105240_10055789 Ga0105240_100557892 268
355 3300009176 Ga0105242_10048968 Ga0105242_100489685 268
356 3300009551 Ga0105238_10028247 Ga0105238_100282472 268
357 3300013296 Ga0157374_10047290 Ga0157374_100472905 268
358 3300013306 Ga0163162_10018409 Ga0163162_100184094 268
359 3300013308 Ga0157375_10012677 Ga0157375_100126778 268
360 3300025899 Ga0207642_10081845 Ga0207642_100818452 268
361 3300025913 Ga0207695_10037544 Ga0207695_100375442 268
362 3300025924 Ga0207694_10024377 Ga0207694_100243773 268
363 3300025934 Ga0207686_10120705 Ga0207686_101207052 268
364 3300025940 Ga0207691_10066690 Ga0207691_100666904 268
365 3300026041 Ga0207639_10116746 Ga0207639_101167462 268
366 3300026089 Ga0207648_10015939 Ga0207648_100159396 268
367 3300026121 Ga0207683_10006884 Ga0207683_100068847 268
368 3300053140 Ga0500573_0000004 Ga0500573_0000004_63231_64043 268
369 3300009177 Ga0105248_10784978 Ga0105248_107849782 269
370 3300009545 Ga0105237_10053669 Ga0105237_100536693 269
371 3300013306 Ga0163162_10389860 Ga0163162_103898602 269
372 3300014968 Ga0157379_10223953 Ga0157379_102239532 269
373 3300005327 Ga0070658_10018547 Ga0070658_100185471 270
374 3300005334 Ga0068869_100095935 Ga0068869_1000959352 270
375 3300005335 Ga0070666_10032582 Ga0070666_100325823 270
376 3300005367 Ga0070667_100133922 Ga0070667_1001339222 270
377 3300005535 Ga0070684_100160171 Ga0070684_1001601712 270
378 3300005548 Ga0070665_100033362 Ga0070665_1000333625 270
379 3300005548 Ga0070665_100276682 Ga0070665_1002766822 270
380 3300005548 Ga0070665_100560768 Ga0070665_1005607682 270
381 3300005564 Ga0070664_100194752 Ga0070664_1001947522 270
382 3300005577 Ga0068857_100655922 Ga0068857_1006559222 270
383 3300005841 Ga0068863_100019194 Ga0068863_1000191947 270
384 3300009093 Ga0105240_10216515 Ga0105240_102165152 270
385 3300009177 Ga0105248_10013067 Ga0105248_100130676 270
386 3300009545 Ga0105237_10181238 Ga0105237_101812382 270
387 3300009553 Ga0105249_10013501 Ga0105249_100135018 270
388 3300010375 Ga0105239_10012933 Ga0105239_100129335 270
389 3300010375 Ga0105239_10149364 Ga0105239_101493643 270
390 3300010375 Ga0105239_10482877 Ga0105239_104828771 270
391 3300013105 Ga0157369_10040284 Ga0157369_100402846 270
392 3300013297 Ga0157378_10364101 Ga0157378_103641012 270
393 3300013307 Ga0157372_10219921 Ga0157372_102199212 270
394 3300014325 Ga0163163_10028135 Ga0163163_100281356 270
395 3300014325 Ga0163163_10119109 Ga0163163_101191093 270
396 3300025893 Ga0207682_10165229 Ga0207682_101652292 270
397 3300025903 Ga0207680_10022243 Ga0207680_100222433 270
398 3300025911 Ga0207654_10104370 Ga0207654_101043702 270
399 3300025913 Ga0207695_10170681 Ga0207695_101706812 270
400 3300025914 Ga0207671_10047897 Ga0207671_100478972 270
401 3300025920 Ga0207649_10313488 Ga0207649_103134882 270
402 3300025921 Ga0207652_10214260 Ga0207652_102142602 270
403 3300025941 Ga0207711_10014384 Ga0207711_100143843 270
404 3300025941 Ga0207711_10024895 Ga0207711_100248952 270
405 3300025942 Ga0207689_10110624 Ga0207689_101106242 270
406 3300026035 Ga0207703_10370078 Ga0207703_103700782 270
407 3300026088 Ga0207641_10037982 Ga0207641_100379825 270
408 3300026116 Ga0207674_10217079 Ga0207674_102170792 270
409 3300028379 Ga0268266_10025276 Ga0268266_100252761 270
410 3300028379 Ga0268266_10025815 Ga0268266_100258157 270
411 3300028379 Ga0268266_10045306 Ga0268266_100453063 270
412 3300028381 Ga0268264_10256628 Ga0268264_102566282 270
413 3300046675 Ga0495657_0299655 Ga0495657_0299655_53_901 270
414 3300047318 Ga0495636_0145249 Ga0495636_0145249_103_921 270
415 3300053136 Ga0500559_0034131 Ga0500559_0034131_1182_2030 270
416 3300006237 Ga0097621_100000693 Ga0097621_1000006932 271
417 3300006358 Ga0068871_100000385 Ga0068871_1000003858 271
418 3300013296 Ga0157374_10135570 Ga0157374_101355702 271
419 3300014969 Ga0157376_10123241 Ga0157376_101232412 271
420 3300025934 Ga0207686_10111036 Ga0207686_101110362 271
421 3300005338 Ga0068868_100348562 Ga0068868_1003485622 272
422 3300005618 Ga0068864_100188444 Ga0068864_1001884442 272
423 3300005843 Ga0068860_100126911 Ga0068860_1001269113 272
424 3300006237 Ga0097621_100006007 Ga0097621_1000060077 272
425 3300006237 Ga0097621_100058996 Ga0097621_1000589963 272
426 3300006358 Ga0068871_100023375 Ga0068871_1000233757 272
427 3300006358 Ga0068871_100151738 Ga0068871_1001517382 272
428 3300009174 Ga0105241_10060420 Ga0105241_100604203 272
429 3300009174 Ga0105241_10138379 Ga0105241_101383792 272
430 3300009551 Ga0105238_10451340 Ga0105238_104513402 272
431 3300014325 Ga0163163_10189245 Ga0163163_101892453 272
432 3300025924 Ga0207694_10349679 Ga0207694_103496792 272
433 3300025972 Ga0207668_10443620 Ga0207668_104436202 272
434 3300026041 Ga0207639_10084713 Ga0207639_100847132 272
435 3300028381 Ga0268264_10220961 Ga0268264_102209612 272
436 3300045976 Ga0466967_0379653 Ga0466967_0379653_335_1189 272
437 3300005548 Ga0070665_100015549 Ga0070665_1000155497 273
438 3300009176 Ga0105242_10273544 Ga0105242_102735442 273
439 3300028379 Ga0268266_10090872 Ga0268266_100908722 273
440 3300028786 Ga0307517_10101456 Ga0307517_101014562 273
441 3300031456 Ga0307513_10280439 Ga0307513_102804392 273
442 3300031730 Ga0307516_10024010 Ga0307516_100240106 273
443 3300041443 Ga0451789_0427557 Ga0451789_0427557_32_883 273
444 3300046557 Ga0495622_0004441 Ga0495622_0004441_2586_3440 273
445 3300053130 Ga0500642_0114234 Ga0500642_0114234_157_1017 273
446 iso_pu_bacteria 2844533157 2844538605 274
447 iso_pu_bacteria 2821443989 2821449315 275
448 3300005983 Ga0081540_1014990 Ga0081540_10149905 276
449 3300046512 Ga0495610_0032421 Ga0495610_0032421_1144_1980 278
450 3300003187 JGI25151J46595_10001012 JGI25151J46595_100010129 279
451 3300003354 JGI25160J50197_1022236 JGI25160J50197_10222362 279
452 3300025284 Ga0209130_1001492 Ga0209130_100149213 279
453 3300025294 Ga0209025_1000509 Ga0209025_100050968 279
454 3300025297 Ga0209758_1004952 Ga0209758_10049527 279
455 3300025302 Ga0207426_1000080 Ga0207426_1000080242 279
456 3300046512 Ga0495610_0028080 Ga0495610_0028080_739_1578 279
457 3300046694 Ga0495649_0162296 Ga0495649_0162296_261_1100 279

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

44

195

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ch8-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with adp-v 0.9662 17 256
7ch8-assembly1.cif.gz_I cryo-em structure of p.aeruginosa mlafebd with adp-v 0.9645 17 256
7cha-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with amppnp 0.962 17 256
7d06-assembly1.cif.gz_B cryo em structure of the nucleotide free acinetobacter mlafedb complex 0.9536 17 256
8fee-assembly1.cif.gz_H structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2) 0.9484 16 256
ID Description Score Start End Superfamily
af_P9WQL5_26_341_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.973 19 253 3.40.50.300
af_P63386_5_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.961 17 257 3.40.50.300
af_Q2G1F8_275_530_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9453 18 256 3.40.50.300
af_Q2G1L8_1_252_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9447 17 235 3.40.50.300
af_P16678_3_252_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9431 17 253 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A522AFW5-F1-model_v4 ATP-binding cassette domain-containing protein 0.9863 17 260 GO:0005524
GO:0016887
AF-A0A3C0VK17-F1-model_v4 ABC transporter ATP-binding protein 0.966 17 257 GO:0005524
GO:0016887
AF-F5P099-F1-model_v4 ABC transporter family protein 0.9623 16 238 GO:0005524
GO:0016887
AF-X1D8U0-F1-model_v4 ABC transporter domain-containing protein 0.9595 33 256 GO:0005524
GO:0015833
GO:0016887
GO:0055085
AF-A0A6I5VRF0-F1-model_v4 ATP-binding cassette domain-containing protein 0.9579 33 253 GO:0005524
GO:0015833
GO:0016887
GO:0055085

Feature Viewer

pLDDT pTM Quality
89.06 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map