F447941

General Info

Members Datasets Scaffolds Average Seq Length
457 243 914 153

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100574782|Ga0070669_1005747822
Length 170
Sequence MTHEPIDFSDDSTDDPRDVDDRPTPNDDDLLDVLGHALRVADPVPGNVLDGARAAFAWRTIDTELAELVFDSSQESSDVRAESAKRQITFRAPGVEIEVTVVENGTRRLVGQLVPPAMLTVELAGDDEVRSAESDQFGRFTFDAVEPGPVRLVVLGADGTPIVQTEWILF

Samples

Sample ID Description Type Environment
1 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
2 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
103 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
104 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
107 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
114 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
116 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
117 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
118 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
119 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
120 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
121 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
122 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
123 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
124 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
125 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
127 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
138 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
139 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
140 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
141 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
142 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
143 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
144 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
145 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
146 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
147 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
148 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
149 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
150 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
151 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
154 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
155 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
156 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
157 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
160 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
161 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
162 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
163 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
164 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
167 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
168 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
169 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
170 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
171 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
179 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
180 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
184 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
185 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
186 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
187 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
188 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
189 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
192 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
207 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
208 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
209 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
210 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
211 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
212 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
213 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
214 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
215 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
216 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
219 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
220 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
222 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
223 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
224 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
225 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
228 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
229 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
230 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
231 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
232 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
233 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
234 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
235 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
236 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
237 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
238 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
239 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
240 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
241 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
242 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
243 2891554331 Microbispora sp. CL1-1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.03
Metatranscriptomes 1.53
Isolates 0.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.41
Nodule 0
Rhizoplane 0.66
Rhizosphere 94.53
Stem 0
Stem Tuber 0
Unclassified 19.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070669_100574782 3300005353 Bacteria 942
2 Ga0006759J45824_1055496 3300003163 Bacteria 699
3 Ga0070658_10002486 3300005327 Bacteria 15396
4 Ga0070660_100294591 3300005339 Unclassified 1329
5 Ga0070673_101800733 3300005364 Bacteria 580
6 Ga0070709_10000438 3300005434 Bacteria 25206
7 Ga0070709_10631647 3300005434 Unclassified 827
8 Ga0070714_100001365 3300005435 Bacteria 17680
9 Ga0070714_100050085 3300005435 Bacteria 3556
10 Ga0070714_100343072 3300005435 Bacteria 1401
11 Ga0070713_100033291 3300005436 Bacteria 4126
12 Ga0070713_100041175 3300005436 Unclassified 3762
13 Ga0070713_100074270 3300005436 Bacteria 2880
14 Ga0070713_100120538 3300005436 Bacteria 2300
15 Ga0070710_10001816 3300005437 Bacteria 10079
16 Ga0070710_10015481 3300005437 Bacteria 3863
17 Ga0070711_100001243 3300005439 Bacteria 13783
18 Ga0070711_100018970 3300005439 Bacteria 4401
19 Ga0070708_100006642 3300005445 Bacteria 9209
20 Ga0070663_100258440 3300005455 Bacteria 1381
21 Ga0070681_11547336 3300005458 Bacteria 588
22 Ga0070685_10119686 3300005466 Unclassified 1633
23 Ga0070706_100001948 3300005467 Bacteria 21271
24 Ga0070706_100092037 3300005467 Bacteria 2813
25 Ga0070706_100121548 3300005467 Bacteria 2434
26 Ga0070706_100327797 3300005467 Bacteria 1428
27 Ga0070706_100550897 3300005467 Unclassified 1073
28 Ga0070706_100892176 3300005467 Bacteria 821
29 Ga0070707_100000261 3300005468 Bacteria 52696
30 Ga0070707_100184873 3300005468 Unclassified 2032
31 Ga0070707_100473024 3300005468 Unclassified 1214
32 Ga0070698_100000396 3300005471 Bacteria 45923
33 Ga0070698_100000553 3300005471 Bacteria 39988
34 Ga0070698_100000859 3300005471 Bacteria 33395
35 Ga0070698_100011546 3300005471 Bacteria 9370
36 Ga0070698_100682081 3300005471 Bacteria 969
37 Ga0070699_100075298 3300005518 Bacteria 2937
38 Ga0070699_100184329 3300005518 Bacteria 1853
39 Ga0070699_100293623 3300005518 Bacteria 1458
40 Ga0070679_100141582 3300005530 Unclassified 2384
41 Ga0070697_100084676 3300005536 Bacteria 2615
42 Ga0068853_100258068 3300005539 Bacteria 1601
43 Ga0070686_100091531 3300005544 Unclassified 2035
44 Ga0070665_100025145 3300005548 Bacteria 6000
45 Ga0070665_100208612 3300005548 Bacteria 1954
46 Ga0070665_101396240 3300005548 Bacteria 709
47 Ga0068855_100015526 3300005563 Bacteria 9170
48 Ga0068855_100110424 3300005563 Bacteria 3157
49 Ga0068855_100771034 3300005563 Unclassified 1024
50 Ga0068854_100026929 3300005578 Bacteria 3956
51 Ga0068856_100059286 3300005614 Bacteria 3781
52 Ga0068856_101394523 3300005614 Bacteria 715
53 Ga0070702_100189437 3300005615 Bacteria 1352
54 Ga0068852_100011988 3300005616 Bacteria 6557
55 Ga0068864_100346353 3300005618 Bacteria 1401
56 Ga0068861_100058022 3300005719 Unclassified 2959
57 Ga0081455_10017491 3300005937 Bacteria 6870
58 Ga0081455_10330464 3300005937 Unclassified 1082
59 Ga0081538_10116667 3300005981 Bacteria 1294
60 Ga0070717_10024059 3300006028 Bacteria 4833
61 Ga0070717_10045940 3300006028 Bacteria 3572
62 Ga0070717_10052915 3300006028 Bacteria 3346
63 Ga0070717_10118181 3300006028 Unclassified 2268
64 Ga0070717_11955216 3300006028 Bacteria 529
65 Ga0075365_10063446 3300006038 Bacteria 2474
66 Ga0075363_100823323 3300006048 Bacteria 565
67 Ga0075364_10006877 3300006051 Bacteria 6713
68 Ga0070715_10042417 3300006163 Bacteria 1912
69 Ga0070715_10075432 3300006163 Bacteria 1517
70 Ga0070716_100000223 3300006173 Bacteria 22742
71 Ga0070716_100000969 3300006173 Bacteria 12463
72 Ga0070712_100006855 3300006175 Bacteria 7096
73 Ga0070712_100044063 3300006175 Bacteria 3075
74 Ga0070712_100090522 3300006175 Unclassified 2240
75 Ga0070712_100106354 3300006175 Bacteria 2085
76 Ga0070712_100109327 3300006175 Bacteria 2060
77 Ga0070712_100424581 3300006175 Bacteria 1102
78 Ga0075367_10035403 3300006178 Bacteria 2889
79 Ga0075370_10006357 3300006353 Bacteria 5934
80 Ga0068871_100423418 3300006358 Bacteria 1189
81 Ga0075428_100087640 3300006844 Bacteria 3395
82 Ga0075428_100093413 3300006844 Bacteria 3280
83 Ga0075428_100247799 3300006844 Bacteria 1920
84 Ga0075428_100275817 3300006844 Bacteria 1809
85 Ga0075428_100300953 3300006844 Bacteria 1724
86 Ga0075428_100653502 3300006844 Bacteria 1121
87 Ga0075430_100141596 3300006846 Bacteria 2003
88 Ga0075430_100198690 3300006846 Bacteria 1665
89 Ga0075430_100516782 3300006846 Unclassified 985
90 Ga0075431_100032600 3300006847 Bacteria 5368
91 Ga0075431_100137977 3300006847 Bacteria 2514
92 Ga0075431_100271725 3300006847 Bacteria 1717
93 Ga0075431_100752263 3300006847 Unclassified 950
94 Ga0075431_102053656 3300006847 Bacteria 526
95 Ga0075429_100192696 3300006880 Bacteria 1786
96 Ga0075429_100207982 3300006880 Bacteria 1714
97 Ga0075429_100650493 3300006880 Bacteria 923
98 Ga0068865_100480062 3300006881 Bacteria 1033
99 Ga0075435_100016951 3300007076 Bacteria 5500
100 Ga0105240_10003352 3300009093 Bacteria 24922
101 Ga0105240_10296767 3300009093 Bacteria 1850
102 Ga0105240_10999616 3300009093 Bacteria 895
103 Ga0111539_10140135 3300009094 Bacteria 2831
104 Ga0111539_10394200 3300009094 Bacteria 1613
105 Ga0111539_10601794 3300009094 Bacteria 1280
106 Ga0111539_10720255 3300009094 Unclassified 1161
107 Ga0114129_10034162 3300009147 Bacteria 7182
108 Ga0114129_10379751 3300009147 Bacteria 1866
109 Ga0114129_10438065 3300009147 Bacteria 1716
110 Ga0114129_10929855 3300009147 Bacteria 1100
111 Ga0105243_10027558 3300009148 Bacteria 4354
112 Ga0105241_10006695 3300009174 Bacteria 8478
113 Ga0105248_10091715 3300009177 Unclassified 3421
114 Ga0105237_10044278 3300009545 Bacteria 4481
115 Ga0105238_10003550 3300009551 Bacteria 15549
116 Ga0105249_11617239 3300009553 Bacteria 720
117 Ga0105028_102935 3300009993 Unclassified 1787
118 Ga0105239_10073152 3300010375 Bacteria 3768
119 Ga0157370_10002635 3300013104 Bacteria 21559
120 Ga0157369_10002638 3300013105 Bacteria 21445
121 Ga0157374_10623263 3300013296 Bacteria 1089
122 Ga0157378_11291400 3300013297 Bacteria 771
123 Ga0157372_10170730 3300013307 Bacteria 2516
124 Ga0157375_10040747 3300013308 Bacteria 4480
125 Ga0163163_10029943 3300014325 Bacteria 5239
126 Ga0157380_10085981 3300014326 Unclassified 2583
127 Ga0157380_10815879 3300014326 Unclassified 951
128 Ga0157376_10559223 3300014969 Bacteria 1133
129 Ga0163161_10046236 3300017792 Unclassified 3140
130 Ga0197907_11505317 3300020069 Bacteria 1394
131 Ga0206356_10319309 3300020070 Bacteria 1594
132 Ga0206353_11053120 3300020082 Bacteria 2319
133 Ga0154015_1622925 3300020610 Unclassified 962
134 Ga0224712_10006101 3300022467 Bacteria 3410
135 Ga0224712_10006800 3300022467 Bacteria 3289
136 Ga0207692_10000109 3300025898 Bacteria 24511
137 Ga0207692_10004438 3300025898 Bacteria 5555
138 Ga0207647_10014338 3300025904 Bacteria 5464
139 Ga0207685_10027957 3300025905 Bacteria 1980
140 Ga0207699_10000535 3300025906 Bacteria 18785
141 Ga0207699_10023134 3300025906 Bacteria 3378
142 Ga0207699_10742994 3300025906 Bacteria 720
143 Ga0207684_10008959 3300025910 Bacteria 8874
144 Ga0207684_10134743 3300025910 Bacteria 2120
145 Ga0207684_10253843 3300025910 Bacteria 1517
146 Ga0207684_10436675 3300025910 Bacteria 1124
147 Ga0207684_10512391 3300025910 Bacteria 1028
148 Ga0207684_10606756 3300025910 Bacteria 934
149 Ga0207654_10006988 3300025911 Bacteria 5685
150 Ga0207695_10006639 3300025913 Bacteria 14938
151 Ga0207671_10000170 3300025914 Bacteria 99729
152 Ga0207693_10001183 3300025915 Bacteria 23297
153 Ga0207693_10010726 3300025915 Bacteria 7437
154 Ga0207693_10178069 3300025915 Bacteria 1673
155 Ga0207693_10237943 3300025915 Bacteria 1429
156 Ga0207693_10359394 3300025915 Unclassified 1139
157 Ga0207693_10586269 3300025915 Bacteria 868
158 Ga0207663_10000794 3300025916 Bacteria 14149
159 Ga0207663_10162205 3300025916 Bacteria 1579
160 Ga0207663_10826711 3300025916 Bacteria 739
161 Ga0207657_10250703 3300025919 Unclassified 1411
162 Ga0207652_10156333 3300025921 Unclassified 2043
163 Ga0207646_10001025 3300025922 Bacteria 35704
164 Ga0207646_10013904 3300025922 Bacteria 7675
165 Ga0207646_10376800 3300025922 Bacteria 1282
166 Ga0207694_10033516 3300025924 Bacteria 3934
167 Ga0207700_10000610 3300025928 Bacteria 20923
168 Ga0207700_10006837 3300025928 Bacteria 6936
169 Ga0207700_10167211 3300025928 Bacteria 1831
170 Ga0207700_10183519 3300025928 Bacteria 1754
171 Ga0207700_10644602 3300025928 Unclassified 944
172 Ga0207664_10000597 3300025929 Bacteria 25009
173 Ga0207664_10007708 3300025929 Bacteria 7471
174 Ga0207664_10054482 3300025929 Unclassified 3169
175 Ga0207664_10083296 3300025929 Bacteria 2607
176 Ga0207664_10120899 3300025929 Bacteria 2191
177 Ga0207665_10000406 3300025939 Bacteria 29572
178 Ga0207665_10000804 3300025939 Bacteria 21249
179 Ga0207711_10134140 3300025941 Unclassified 2222
180 Ga0207667_10078207 3300025949 Bacteria 3429
181 Ga0207640_10031284 3300025981 Bacteria 3287
182 Ga0207678_10450658 3300026067 Bacteria 1118
183 Ga0207702_10055543 3300026078 Bacteria 3359
184 Ga0207676_10226783 3300026095 Bacteria 1668
185 Ga0207675_100064748 3300026118 Unclassified 3417
186 Ga0207698_10080917 3300026142 Bacteria 2619
187 Ga0207428_10254957 3300027907 Bacteria 1307
188 Ga0207428_10270775 3300027907 Unclassified 1262
189 Ga0268266_10058409 3300028379 Bacteria 3321
190 Ga0268266_11144339 3300028379 Bacteria 753
191 Ga0307515_10000486 3300028794 Bacteria 94816
192 Ga0265340_10008503 3300031247 Bacteria 5540
193 Ga0265339_10024513 3300031249 Bacteria 3475
194 Ga0307408_100641039 3300031548 Unclassified 949
195 Ga0307516_10020455 3300031730 Bacteria 6837
196 Ga0307407_10255294 3300031903 Bacteria 1203
197 Ga0307409_100086232 3300031995 Unclassified 2555
198 Ga0307416_100010228 3300032002 Bacteria 6185
199 Ga0307416_100712466 3300032002 Bacteria 1094
200 Ga0307414_10666666 3300032004 Unclassified 939
201 Ga0307411_11462208 3300032005 Bacteria 627
202 Ga0307415_100240286 3300032126 Bacteria 1465
203 Ga0307415_100357583 3300032126 Bacteria 1232
204 Ga0373934_0005945 3300035086 Bacteria 4515
205 Ga0373923_0005971 3300035111 Bacteria 4171
206 Ga0373936_0005165 3300035113 Bacteria 4912
207 Ga0373945_0255983 3300035116 Bacteria 740
208 Ga0373953_0004520 3300035117 Bacteria 4443
209 Ga0373954_0144209 3300035118 Unclassified 1162
210 Ga0373954_0306419 3300035118 Bacteria 783
211 Ga0373956_0009089 3300035119 Bacteria 4029
212 Ga0373957_0005407 3300035120 Bacteria 3955
213 Ga0373943_0156246 3300035170 Bacteria 1239
214 Ga0373946_0095684 3300035171 Bacteria 1323
215 Ga0373955_0006146 3300035172 Bacteria 5457
216 Ga0373924_0113672 3300035410 Bacteria 1171
217 Ga0373935_0051837 3300035692 Bacteria 2606
218 Ga0373935_0254658 3300035692 Unclassified 1229
219 Ga0373935_0423825 3300035692 Bacteria 958
220 Ga0373927_0325547 3300035695 Bacteria 1012
221 Ga0373933_0012064 3300035724 Bacteria 4772
222 Ga0373947_0059647 3300035725 Bacteria 2314
223 Ga0373937_0123231 3300036401 Bacteria 2416
224 Ga0373925_0016378 3300037068 Bacteria 5369
225 Ga0395899_0921165 3300037312 Bacteria 532
226 Ga0395900_0593001 3300037418 Unclassified 1049
227 Ga0395898_0031954 3300037466 Bacteria 5256
228 Ga0395905_1367729 3300037471 Unclassified 612
229 Ga0436364_1269731 3300037853 Bacteria 1377
230 Ga0395901_0095984 3300038443 Bacteria 3107
231 Ga0395901_0260317 3300038443 Bacteria 1806
232 Ga0395901_0489299 3300038443 Bacteria 1254
233 Ga0436363_0889464 3300039450 Bacteria 3183
234 Ga0451833_0111291 3300041491 Unclassified 723
235 Ga0451837_0903752 3300041494 Unclassified 703
236 Ga0451845_0072238 3300041501 Unclassified 571
237 Ga0451851_1251420 3300041507 Bacteria 605
238 Ga0451853_1654412 3300041512 Bacteria 2217
239 Ga0439448_0199742 3300042005 Bacteria 701
240 Ga0439450_011494 3300042008 Bacteria 1736
241 Ga0450912_022859 3300042116 Bacteria 614
242 Ga0439435_0118516 3300042436 Bacteria 827
243 Ga0439460_0034002 3300042461 Bacteria 1467
244 Ga0439460_0037307 3300042461 Bacteria 1413
245 Ga0439440_0000035 3300042993 Bacteria 16984
246 Ga0439440_0026208 3300042993 Bacteria 1348
247 Ga0466969_0015451 3300044656 Bacteria 4002
248 Ga0466961_0059828 3300044693 Bacteria 2422
249 Ga0466961_0117316 3300044693 Bacteria 1672
250 Ga0466963_0600723 3300044694 Bacteria 777
251 Ga0466963_0786207 3300044694 Bacteria 671
252 Ga0466967_0254678 3300045976 Bacteria 1678
253 Ga0495592_0048834 3300046454 Bacteria 3146
254 Ga0495592_0801488 3300046454 Bacteria 560
255 Ga0495629_0002010 3300046459 Bacteria 15803
256 Ga0495641_0005518 3300046461 Bacteria 8507
257 Ga0495651_0002359 3300046462 Bacteria 14583
258 Ga0495651_0005194 3300046462 Bacteria 9929
259 Ga0495651_0463195 3300046462 Bacteria 817
260 Ga0495653_0012891 3300046463 Bacteria 6824
261 Ga0495582_0001323 3300046473 Bacteria 13885
262 Ga0495639_0006243 3300046475 Bacteria 5120
263 Ga0495662_0009975 3300046476 Bacteria 4664
264 Ga0495664_0014787 3300046477 Bacteria 4430
265 Ga0495664_0085182 3300046477 Bacteria 1897
266 Ga0495664_0167670 3300046477 Bacteria 1332
267 Ga0495664_0779652 3300046477 Bacteria 563
268 Ga0495608_0048095 3300046511 Bacteria 2834
269 Ga0495618_0005767 3300046514 Bacteria 7525
270 Ga0495618_0182274 3300046514 Bacteria 1334
271 Ga0495628_0034243 3300046516 Bacteria 4087
272 Ga0495628_0188553 3300046516 Bacteria 1557
273 Ga0495628_0241554 3300046516 Bacteria 1351
274 Ga0495630_0042595 3300046517 Bacteria 3390
275 Ga0495630_0462429 3300046517 Unclassified 972
276 Ga0495630_0924534 3300046517 Bacteria 664
277 Ga0495630_1035354 3300046517 Unclassified 623
278 Ga0495666_0538143 3300046526 Bacteria 521
279 Ga0495652_0003381 3300046529 Bacteria 15788
280 Ga0495652_0109309 3300046529 Bacteria 2226
281 Ga0495652_0134282 3300046529 Bacteria 1954
282 Ga0495665_0001462 3300046531 Bacteria 12684
283 Ga0495640_0008374 3300046533 Bacteria 8112
284 Ga0495586_0030824 3300046535 Bacteria 2870
285 Ga0495586_0280024 3300046535 Bacteria 954
286 Ga0495587_0157013 3300046536 Bacteria 1295
287 Ga0495645_0075902 3300046543 Bacteria 2419
288 Ga0495645_0109422 3300046543 Bacteria 1956
289 Ga0495645_0436323 3300046543 Archaea 828
290 Ga0495622_0028453 3300046557 Bacteria 2611
291 Ga0495667_0110988 3300046559 Bacteria 1771
292 Ga0495634_0122897 3300046642 Bacteria 1661
293 Ga0495634_0205716 3300046642 Bacteria 1220
294 Ga0495635_0036790 3300046663 Bacteria 3390
295 Ga0495657_0417930 3300046675 Bacteria 787
296 Ga0495599_0015209 3300046678 Bacteria 4772
297 Ga0495599_0123467 3300046678 Bacteria 1609
298 Ga0495599_0345797 3300046678 Archaea 892
299 Ga0495623_0018112 3300046679 Bacteria 4548
300 Ga0495646_0040487 3300046680 Bacteria 2869
301 Ga0495658_0005224 3300046683 Bacteria 6386
302 Ga0495613_0005692 3300046689 Bacteria 9339
303 Ga0495624_0001703 3300046690 Bacteria 16820
304 Ga0495600_0029118 3300046809 Bacteria 3575
305 Ga0495600_0633536 3300046809 Bacteria 647
306 Ga0495581_0030637 3300047315 Bacteria 3116
307 Ga0495604_0005775 3300047317 Bacteria 9814
308 Ga0495604_0016092 3300047317 Bacteria 5974
309 Ga0495674_0012774 3300047319 Bacteria 7907
310 Ga0495674_0261591 3300047319 Bacteria 1421
311 Ga0495680_0004789 3300047322 Bacteria 12844
312 Ga0495675_0007367 3300047444 Bacteria 6778
313 Ga0495684_0085570 3300047471 Bacteria 2390
314 Ga0495593_0001210 3300047673 Bacteria 15100
315 Ga0495602_0138291 3300048088 Bacteria 1931
316 Ga0496101_0089976 3300048904 Unclassified 2282
317 Ga0496107_0214529 3300048910 Bacteria 1431
318 Ga0496114_0397279 3300048917 Bacteria 1221
319 Ga0501031_0023644 3300049568 Unclassified 4006
320 Ga0501031_0375575 3300049568 Bacteria 920
321 Ga0501031_0772319 3300049568 Unclassified 616
322 Ga0501032_0182684 3300049569 Bacteria 1373
323 Ga0501032_0266278 3300049569 Bacteria 1111
324 Ga0501033_0491332 3300049570 Bacteria 850
325 Ga0501036_0036034 3300049572 Bacteria 4186
326 Ga0501036_0178879 3300049572 Bacteria 1786
327 Ga0501038_0627681 3300049574 Bacteria 811
328 Ga0501038_1104311 3300049574 Bacteria 579
329 Ga0501039_0034439 3300049575 Unclassified 3908
330 Ga0501039_0359874 3300049575 Bacteria 1143
331 Ga0501039_0548374 3300049575 Unclassified 907
332 Ga0501039_1455386 3300049575 Unclassified 527
333 Ga0501039_1474660 3300049575 Bacteria 523
334 Ga0501040_0024425 3300049576 Unclassified 4057
335 Ga0501040_0044140 3300049576 Unclassified 3039
336 Ga0501040_0096081 3300049576 Bacteria 2063
337 Ga0501040_0197145 3300049576 Bacteria 1429
338 Ga0501040_0261071 3300049576 Unclassified 1236
339 Ga0501040_0280946 3300049576 Bacteria 1189
340 Ga0501041_0426354 3300049577 Bacteria 841
341 Ga0501042_0102082 3300049578 Unclassified 2063
342 Ga0501042_0139898 3300049578 Unclassified 1745
343 Ga0501042_0156880 3300049578 Bacteria 1642
344 Ga0501042_0355510 3300049578 Bacteria 1060
345 Ga0501042_1027364 3300049578 Bacteria 601
346 Ga0501048_0058337 3300049582 Bacteria 2736
347 Ga0501048_0210027 3300049582 Bacteria 1381
348 Ga0501048_1412359 3300049582 Bacteria 500
349 Ga0501068_0703276 3300049584 Unclassified 661
350 Ga0501069_0172105 3300049585 Bacteria 1250
351 Ga0501070_0447646 3300049586 Bacteria 1041
352 Ga0501071_0010897 3300049587 Bacteria 6101
353 Ga0501071_0142632 3300049587 Unclassified 1784
354 Ga0501071_0173138 3300049587 Bacteria 1616
355 Ga0501071_0319526 3300049587 Bacteria 1179
356 Ga0501071_0423718 3300049587 Bacteria 1017
357 Ga0501072_0020780 3300049588 Bacteria 5088
358 Ga0501072_0068439 3300049588 Bacteria 2803
359 Ga0501072_0069381 3300049588 Bacteria 2783
360 Ga0501072_0182067 3300049588 Unclassified 1676
361 Ga0501072_0273036 3300049588 Bacteria 1345
362 Ga0501072_0278686 3300049588 Unclassified 1330
363 Ga0501072_0455837 3300049588 Bacteria 1012
364 Ga0501073_0025081 3300049589 Bacteria 4280
365 Ga0501074_0208159 3300049590 Bacteria 1394
366 Ga0501074_0357322 3300049590 Bacteria 1037
367 Ga0501074_0503241 3300049590 Bacteria 858
368 Ga0501075_0008916 3300049591 Bacteria 6999
369 Ga0501075_0010306 3300049591 Bacteria 6568
370 Ga0501075_0068899 3300049591 Bacteria 2673
371 Ga0501075_0132429 3300049591 Unclassified 1899
372 Ga0501075_0142148 3300049591 Bacteria 1829
373 Ga0501075_0207744 3300049591 Unclassified 1493
374 Ga0501075_0522100 3300049591 Bacteria 906
375 Ga0501076_0217741 3300049592 Bacteria 1561
376 Ga0501076_0235478 3300049592 Unclassified 1497
377 Ga0501076_0292657 3300049592 Unclassified 1334
378 Ga0501076_0625547 3300049592 Bacteria 888
379 Ga0501076_1128145 3300049592 Unclassified 646
380 Ga0501076_1266685 3300049592 Unclassified 606
381 Ga0501077_0063494 3300049593 Bacteria 2343
382 Ga0501077_0216852 3300049593 Bacteria 1216
383 Ga0501077_0542597 3300049593 Bacteria 746
384 Ga0501077_0593961 3300049593 Bacteria 711
385 Ga0501077_0775626 3300049593 Unclassified 616
386 Ga0501079_0079480 3300049741 Unclassified 2536
387 Ga0501079_0175866 3300049741 Bacteria 1669
388 Ga0501079_0269965 3300049741 Unclassified 1330
389 Ga0501079_0381944 3300049741 Unclassified 1104
390 Ga0501079_0547467 3300049741 Bacteria 910
391 Ga0501080_0262832 3300049742 Unclassified 1572
392 Ga0501080_0487013 3300049742 Bacteria 1103
393 Ga0501080_1242420 3300049742 Unclassified 639
394 Ga0501081_0021758 3300049743 Bacteria 4282
395 Ga0501081_0039921 3300049743 Bacteria 3213
396 Ga0501081_0042426 3300049743 Bacteria 3117
397 Ga0501081_0112043 3300049743 Unclassified 1937
398 Ga0501081_1442168 3300049743 Bacteria 523
399 Ga0501083_0289698 3300049744 Unclassified 1065
400 Ga0501035_0320123 3300049822 Unclassified 1303
401 Ga0501045_0046436 3300049824 Bacteria 3163
402 Ga0501045_0995105 3300049824 Unclassified 615
403 nmdc:mga03n38_345437_c1 3300050490 Bacteria 809
404 nmdc:mga00v17_45435_c1 3300050491 Bacteria 2654
405 nmdc:mga0yw44_62058_c1 3300050492 Bacteria 2294
406 nmdc:mga07m45_162223_c1 3300050496 Bacteria 1298
407 nmdc:mga05p37_22922_c1 3300050507 Bacteria 7573
408 nmdc:mga05p37_295615_c1 3300050507 Unclassified 1926
409 nmdc:mga05p37_400934_c1 3300050507 Unclassified 1602
410 nmdc:mga05p37_840067_c1 3300050507 Bacteria 999
411 nmdc:mga09592_101046_c1 3300050508 Bacteria 2470
412 nmdc:mga09592_141037_c1 3300050508 Bacteria 2077
413 nmdc:mga09592_192653_c1 3300050508 Unclassified 1765
414 nmdc:mga09592_369767_c1 3300050508 Bacteria 1240
415 nmdc:mga09592_718895_c1 3300050508 Bacteria 849
416 nmdc:mga0qj67_74225_c1 3300050509 Bacteria 2718
417 nmdc:mga0qj67_967832_c1 3300050509 Bacteria 669
418 nmdc:mga06r32_142727_c1 3300050510 Bacteria 2372
419 nmdc:mga06r32_692083_c1 3300050510 Unclassified 986
420 nmdc:mga06r32_772197_c1 3300050510 Unclassified 923
421 nmdc:mga06r32_80901_c1 3300050510 Bacteria 3162
422 nmdc:mga08y16_1789424_c1 3300050511 Bacteria 568
423 nmdc:mga08y16_439388_c1 3300050511 Bacteria 1332
424 nmdc:mga0n895_201406_c1 3300050512 Bacteria 2021
425 nmdc:mga0rr50_5761_c1 3300050513 Bacteria 7435
426 Ga0495601_0022220 3300053077 Bacteria 3893
427 Ga0495601_0102195 3300053077 Bacteria 1852
428 Ga0495601_0130802 3300053077 Bacteria 1634
429 Ga0495601_0306453 3300053077 Bacteria 1034
430 Ga0495612_0005448 3300053078 Bacteria 5260
431 Ga0495612_0022228 3300053078 Bacteria 2543
432 Ga0495612_0039719 3300053078 Bacteria 1915
433 Ga0495595_0002772 3300053084 Bacteria 6881
434 Ga0495619_0061328 3300053085 Bacteria 2502
435 Ga0500644_0066794 3300053088 Bacteria 1284
436 Ga0500573_0023405 3300053140 Bacteria 3548
437 Ga0501084_0038505 3300054114 Bacteria 3997
438 Ga0501084_0237801 3300054114 Bacteria 1537
439 Ga0501084_0239332 3300054114 Bacteria 1532
440 Ga0501084_0508368 3300054114 Bacteria 1018
441 Ga0501084_0529834 3300054114 Unclassified 996
442 Ga0501084_0892988 3300054114 Bacteria 747
443 Ga0501084_1109852 3300054114 Unclassified 664
444 Ga0501084_1679406 3300054114 Unclassified 531
445 Ga0501082_0050482 3300060353 Unclassified 3587
446 Ga0501082_0100502 3300060353 Unclassified 2502
447 Ga0501082_0248644 3300060353 Unclassified 1548
448 Ga0501082_1393559 3300060353 Unclassified 612
449 Ga0501082_1527036 3300060353 Unclassified 583
450 Ga0530510_0053796 3300061734 Unclassified 2909
451 Ga0530510_0077850 3300061734 Bacteria 2410
452 Ga0530510_0136185 3300061734 Unclassified 1808
453 Ga0530510_0269312 3300061734 Bacteria 1271
454 Ga0530510_0404754 3300061734 Bacteria 1029
455 Ga0530510_0626898 3300061734 Unclassified 818
456 2891400881 2891395885 Bacteria 9251614
457 2891561270 2891554331 Bacteria 8812224
458 Ga0070669_100574782
459 Ga0006759J45824_1055496
460 Ga0070658_10002486
461 Ga0070660_100294591
462 Ga0070673_101800733
463 Ga0070709_10000438
464 Ga0070709_10631647
465 Ga0070714_100001365
466 Ga0070714_100050085
467 Ga0070714_100343072
468 Ga0070713_100033291
469 Ga0070713_100041175
470 Ga0070713_100074270
471 Ga0070713_100120538
472 Ga0070710_10001816
473 Ga0070710_10015481
474 Ga0070711_100001243
475 Ga0070711_100018970
476 Ga0070708_100006642
477 Ga0070663_100258440
478 Ga0070681_11547336
479 Ga0070685_10119686
480 Ga0070706_100001948
481 Ga0070706_100092037
482 Ga0070706_100121548
483 Ga0070706_100327797
484 Ga0070706_100550897
485 Ga0070706_100892176
486 Ga0070707_100000261
487 Ga0070707_100184873
488 Ga0070707_100473024
489 Ga0070698_100000396
490 Ga0070698_100000553
491 Ga0070698_100000859
492 Ga0070698_100011546
493 Ga0070698_100682081
494 Ga0070699_100075298
495 Ga0070699_100184329
496 Ga0070699_100293623
497 Ga0070679_100141582
498 Ga0070697_100084676
499 Ga0068853_100258068
500 Ga0070686_100091531
501 Ga0070665_100025145
502 Ga0070665_100208612
503 Ga0070665_101396240
504 Ga0068855_100015526
505 Ga0068855_100110424
506 Ga0068855_100771034
507 Ga0068854_100026929
508 Ga0068856_100059286
509 Ga0068856_101394523
510 Ga0070702_100189437
511 Ga0068852_100011988
512 Ga0068864_100346353
513 Ga0068861_100058022
514 Ga0081455_10017491
515 Ga0081455_10330464
516 Ga0081538_10116667
517 Ga0070717_10024059
518 Ga0070717_10045940
519 Ga0070717_10052915
520 Ga0070717_10118181
521 Ga0070717_11955216
522 Ga0075365_10063446
523 Ga0075363_100823323
524 Ga0075364_10006877
525 Ga0070715_10042417
526 Ga0070715_10075432
527 Ga0070716_100000223
528 Ga0070716_100000969
529 Ga0070712_100006855
530 Ga0070712_100044063
531 Ga0070712_100090522
532 Ga0070712_100106354
533 Ga0070712_100109327
534 Ga0070712_100424581
535 Ga0075367_10035403
536 Ga0075370_10006357
537 Ga0068871_100423418
538 Ga0075428_100087640
539 Ga0075428_100093413
540 Ga0075428_100247799
541 Ga0075428_100275817
542 Ga0075428_100300953
543 Ga0075428_100653502
544 Ga0075430_100141596
545 Ga0075430_100198690
546 Ga0075430_100516782
547 Ga0075431_100032600
548 Ga0075431_100137977
549 Ga0075431_100271725
550 Ga0075431_100752263
551 Ga0075431_102053656
552 Ga0075429_100192696
553 Ga0075429_100207982
554 Ga0075429_100650493
555 Ga0068865_100480062
556 Ga0075435_100016951
557 Ga0105240_10003352
558 Ga0105240_10296767
559 Ga0105240_10999616
560 Ga0111539_10140135
561 Ga0111539_10394200
562 Ga0111539_10601794
563 Ga0111539_10720255
564 Ga0114129_10034162
565 Ga0114129_10379751
566 Ga0114129_10438065
567 Ga0114129_10929855
568 Ga0105243_10027558
569 Ga0105241_10006695
570 Ga0105248_10091715
571 Ga0105237_10044278
572 Ga0105238_10003550
573 Ga0105249_11617239
574 Ga0105028_102935
575 Ga0105239_10073152
576 Ga0157370_10002635
577 Ga0157369_10002638
578 Ga0157374_10623263
579 Ga0157378_11291400
580 Ga0157372_10170730
581 Ga0157375_10040747
582 Ga0163163_10029943
583 Ga0157380_10085981
584 Ga0157380_10815879
585 Ga0157376_10559223
586 Ga0163161_10046236
587 Ga0197907_11505317
588 Ga0206356_10319309
589 Ga0206353_11053120
590 Ga0154015_1622925
591 Ga0224712_10006101
592 Ga0224712_10006800
593 Ga0207692_10000109
594 Ga0207692_10004438
595 Ga0207647_10014338
596 Ga0207685_10027957
597 Ga0207699_10000535
598 Ga0207699_10023134
599 Ga0207699_10742994
600 Ga0207684_10008959
601 Ga0207684_10134743
602 Ga0207684_10253843
603 Ga0207684_10436675
604 Ga0207684_10512391
605 Ga0207684_10606756
606 Ga0207654_10006988
607 Ga0207695_10006639
608 Ga0207671_10000170
609 Ga0207693_10001183
610 Ga0207693_10010726
611 Ga0207693_10178069
612 Ga0207693_10237943
613 Ga0207693_10359394
614 Ga0207693_10586269
615 Ga0207663_10000794
616 Ga0207663_10162205
617 Ga0207663_10826711
618 Ga0207657_10250703
619 Ga0207652_10156333
620 Ga0207646_10001025
621 Ga0207646_10013904
622 Ga0207646_10376800
623 Ga0207694_10033516
624 Ga0207700_10000610
625 Ga0207700_10006837
626 Ga0207700_10167211
627 Ga0207700_10183519
628 Ga0207700_10644602
629 Ga0207664_10000597
630 Ga0207664_10007708
631 Ga0207664_10054482
632 Ga0207664_10083296
633 Ga0207664_10120899
634 Ga0207665_10000406
635 Ga0207665_10000804
636 Ga0207711_10134140
637 Ga0207667_10078207
638 Ga0207640_10031284
639 Ga0207678_10450658
640 Ga0207702_10055543
641 Ga0207676_10226783
642 Ga0207675_100064748
643 Ga0207698_10080917
644 Ga0207428_10254957
645 Ga0207428_10270775
646 Ga0268266_10058409
647 Ga0268266_11144339
648 Ga0307515_10000486
649 Ga0265340_10008503
650 Ga0265339_10024513
651 Ga0307408_100641039
652 Ga0307516_10020455
653 Ga0307407_10255294
654 Ga0307409_100086232
655 Ga0307416_100010228
656 Ga0307416_100712466
657 Ga0307414_10666666
658 Ga0307411_11462208
659 Ga0307415_100240286
660 Ga0307415_100357583
661 Ga0373934_0005945
662 Ga0373923_0005971
663 Ga0373936_0005165
664 Ga0373945_0255983
665 Ga0373953_0004520
666 Ga0373954_0144209
667 Ga0373954_0306419
668 Ga0373956_0009089
669 Ga0373957_0005407
670 Ga0373943_0156246
671 Ga0373946_0095684
672 Ga0373955_0006146
673 Ga0373924_0113672
674 Ga0373935_0051837
675 Ga0373935_0254658
676 Ga0373935_0423825
677 Ga0373927_0325547
678 Ga0373933_0012064
679 Ga0373947_0059647
680 Ga0373937_0123231
681 Ga0373925_0016378
682 Ga0395899_0921165
683 Ga0395900_0593001
684 Ga0395898_0031954
685 Ga0395905_1367729
686 Ga0436364_1269731
687 Ga0395901_0095984
688 Ga0395901_0260317
689 Ga0395901_0489299
690 Ga0436363_0889464
691 Ga0451833_0111291
692 Ga0451837_0903752
693 Ga0451845_0072238
694 Ga0451851_1251420
695 Ga0451853_1654412
696 Ga0439448_0199742
697 Ga0439450_011494
698 Ga0450912_022859
699 Ga0439435_0118516
700 Ga0439460_0034002
701 Ga0439460_0037307
702 Ga0439440_0000035
703 Ga0439440_0026208
704 Ga0466969_0015451
705 Ga0466961_0059828
706 Ga0466961_0117316
707 Ga0466963_0600723
708 Ga0466963_0786207
709 Ga0466967_0254678
710 Ga0495592_0048834
711 Ga0495592_0801488
712 Ga0495629_0002010
713 Ga0495641_0005518
714 Ga0495651_0002359
715 Ga0495651_0005194
716 Ga0495651_0463195
717 Ga0495653_0012891
718 Ga0495582_0001323
719 Ga0495639_0006243
720 Ga0495662_0009975
721 Ga0495664_0014787
722 Ga0495664_0085182
723 Ga0495664_0167670
724 Ga0495664_0779652
725 Ga0495608_0048095
726 Ga0495618_0005767
727 Ga0495618_0182274
728 Ga0495628_0034243
729 Ga0495628_0188553
730 Ga0495628_0241554
731 Ga0495630_0042595
732 Ga0495630_0462429
733 Ga0495630_0924534
734 Ga0495630_1035354
735 Ga0495666_0538143
736 Ga0495652_0003381
737 Ga0495652_0109309
738 Ga0495652_0134282
739 Ga0495665_0001462
740 Ga0495640_0008374
741 Ga0495586_0030824
742 Ga0495586_0280024
743 Ga0495587_0157013
744 Ga0495645_0075902
745 Ga0495645_0109422
746 Ga0495645_0436323
747 Ga0495622_0028453
748 Ga0495667_0110988
749 Ga0495634_0122897
750 Ga0495634_0205716
751 Ga0495635_0036790
752 Ga0495657_0417930
753 Ga0495599_0015209
754 Ga0495599_0123467
755 Ga0495599_0345797
756 Ga0495623_0018112
757 Ga0495646_0040487
758 Ga0495658_0005224
759 Ga0495613_0005692
760 Ga0495624_0001703
761 Ga0495600_0029118
762 Ga0495600_0633536
763 Ga0495581_0030637
764 Ga0495604_0005775
765 Ga0495604_0016092
766 Ga0495674_0012774
767 Ga0495674_0261591
768 Ga0495680_0004789
769 Ga0495675_0007367
770 Ga0495684_0085570
771 Ga0495593_0001210
772 Ga0495602_0138291
773 Ga0496101_0089976
774 Ga0496107_0214529
775 Ga0496114_0397279
776 Ga0501031_0023644
777 Ga0501031_0375575
778 Ga0501031_0772319
779 Ga0501032_0182684
780 Ga0501032_0266278
781 Ga0501033_0491332
782 Ga0501036_0036034
783 Ga0501036_0178879
784 Ga0501038_0627681
785 Ga0501038_1104311
786 Ga0501039_0034439
787 Ga0501039_0359874
788 Ga0501039_0548374
789 Ga0501039_1455386
790 Ga0501039_1474660
791 Ga0501040_0024425
792 Ga0501040_0044140
793 Ga0501040_0096081
794 Ga0501040_0197145
795 Ga0501040_0261071
796 Ga0501040_0280946
797 Ga0501041_0426354
798 Ga0501042_0102082
799 Ga0501042_0139898
800 Ga0501042_0156880
801 Ga0501042_0355510
802 Ga0501042_1027364
803 Ga0501048_0058337
804 Ga0501048_0210027
805 Ga0501048_1412359
806 Ga0501068_0703276
807 Ga0501069_0172105
808 Ga0501070_0447646
809 Ga0501071_0010897
810 Ga0501071_0142632
811 Ga0501071_0173138
812 Ga0501071_0319526
813 Ga0501071_0423718
814 Ga0501072_0020780
815 Ga0501072_0068439
816 Ga0501072_0069381
817 Ga0501072_0182067
818 Ga0501072_0273036
819 Ga0501072_0278686
820 Ga0501072_0455837
821 Ga0501073_0025081
822 Ga0501074_0208159
823 Ga0501074_0357322
824 Ga0501074_0503241
825 Ga0501075_0008916
826 Ga0501075_0010306
827 Ga0501075_0068899
828 Ga0501075_0132429
829 Ga0501075_0142148
830 Ga0501075_0207744
831 Ga0501075_0522100
832 Ga0501076_0217741
833 Ga0501076_0235478
834 Ga0501076_0292657
835 Ga0501076_0625547
836 Ga0501076_1128145
837 Ga0501076_1266685
838 Ga0501077_0063494
839 Ga0501077_0216852
840 Ga0501077_0542597
841 Ga0501077_0593961
842 Ga0501077_0775626
843 Ga0501079_0079480
844 Ga0501079_0175866
845 Ga0501079_0269965
846 Ga0501079_0381944
847 Ga0501079_0547467
848 Ga0501080_0262832
849 Ga0501080_0487013
850 Ga0501080_1242420
851 Ga0501081_0021758
852 Ga0501081_0039921
853 Ga0501081_0042426
854 Ga0501081_0112043
855 Ga0501081_1442168
856 Ga0501083_0289698
857 Ga0501035_0320123
858 Ga0501045_0046436
859 Ga0501045_0995105
860 nmdc:mga03n38_345437_c1
861 nmdc:mga00v17_45435_c1
862 nmdc:mga0yw44_62058_c1
863 nmdc:mga07m45_162223_c1
864 nmdc:mga05p37_22922_c1
865 nmdc:mga05p37_295615_c1
866 nmdc:mga05p37_400934_c1
867 nmdc:mga05p37_840067_c1
868 nmdc:mga09592_101046_c1
869 nmdc:mga09592_141037_c1
870 nmdc:mga09592_192653_c1
871 nmdc:mga09592_369767_c1
872 nmdc:mga09592_718895_c1
873 nmdc:mga0qj67_74225_c1
874 nmdc:mga0qj67_967832_c1
875 nmdc:mga06r32_142727_c1
876 nmdc:mga06r32_692083_c1
877 nmdc:mga06r32_772197_c1
878 nmdc:mga06r32_80901_c1
879 nmdc:mga08y16_1789424_c1
880 nmdc:mga08y16_439388_c1
881 nmdc:mga0n895_201406_c1
882 nmdc:mga0rr50_5761_c1
883 Ga0495601_0022220
884 Ga0495601_0102195
885 Ga0495601_0130802
886 Ga0495601_0306453
887 Ga0495612_0005448
888 Ga0495612_0022228
889 Ga0495612_0039719
890 Ga0495595_0002772
891 Ga0495619_0061328
892 Ga0500644_0066794
893 Ga0500573_0023405
894 Ga0501084_0038505
895 Ga0501084_0237801
896 Ga0501084_0239332
897 Ga0501084_0508368
898 Ga0501084_0529834
899 Ga0501084_0892988
900 Ga0501084_1109852
901 Ga0501084_1679406
902 Ga0501082_0050482
903 Ga0501082_0100502
904 Ga0501082_0248644
905 Ga0501082_1393559
906 Ga0501082_1527036
907 Ga0530510_0053796
908 Ga0530510_0077850
909 Ga0530510_0136185
910 Ga0530510_0269312
911 Ga0530510_0404754
912 Ga0530510_0626898
913 2891400881
914 2891561270

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wpy-assembly1.cif.gz_A-2 racemic crystal structure of rv1738 from mycobacterium tuberculosis (form-ii) 0.7553 70 99
4u3s-assembly1.cif.gz_B crystal structure of coh3scab-xdoc_m1scaa complex: a n-terminal interface mutant of type ii cohesin-x-dockerin complex from acetivibrio cellulolyticus 0.7437 107 155
4wi0-assembly1.cif.gz_B crystal structure of coh3scab-xdoc_m2scaa complex: a c-terminal interface mutant of type ii cohesin-x-dockerin complex from acetivibrio cellulolyticus 0.7426 107 155
2yn3-assembly1.cif.gz_A structural insight into the giant calcium-binding adhesin siie: implications for the adhesion of salmonella enterica to polarized epithelial cells 0.7194 72 147
2yn3-assembly1.cif.gz_C structural insight into the giant calcium-binding adhesin siie: implications for the adhesion of salmonella enterica to polarized epithelial cells 0.7132 72 147
ID Description Score Start End Superfamily
af_Q5AAP7_3_152_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8013 106 143 2.60.40.10
af_I1JV26_333_420_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.772 91 153 2.60.40.1120
af_A5Z2X0_1224_1448_2.170.210.20 Mainly Beta;Beta Complex;Dna Repair Protein Xrcc4; Chain: A, domain 1;Spindle assembly abnormal protein 6, N-terminal domain 0.7611 68 100 2.170.210.20
af_O07325_1_80_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7536 66 102 3.30.420.40
4wi0B01 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.7426 107 155 2.60.40.1120
ID Description Score Start End GO Terms
AF-A0A2W6C1P4-F1-model_v4 Bacterial Ig domain-containing protein 0.927 67 155
AF-A0A2W6C1P4-F1-model_v4 Bacterial Ig domain-containing protein 0.8798 67 155
AF-A0A7J2Z1A1-F1-model_v4 Transglutaminase-like domain-containing protein 0.8689 103 153
AF-A0A7X9Q7W2-F1-model_v4 deleted 0.8626 103 155
AF-A0A0H5CGY1-F1-model_v4 SD-repeat containing protein B domain-containing protein 0.8605 103 143 GO:0005576
GO:0005975

Map