F447924

General Info

Members Datasets Scaffolds Average Seq Length
457 289 398 256

Family's Representative Sequence

Representative Sequence 3300003775|Ga0055524_1016189|Ga0055524_10161892
Length 310
Sequence VRVGPEWCWGFADAMPPAPWSARARPPEVTACSTLLQSRVLLILRGLNARRTGMNTAVLPDSSSILNISCYLFVAIDAPDVLRGVLHEHAQALGLKGTVLIAEEGINLFLAGSADAVRAWVEALRGDSRFAGLAPKESWSDVVPFRKLLVKVKPEIIRMNHPTIRPDRAPAATLRRWLDQGHDDEGRPVVTLDTRNAFEVDVGAFDGAIDWRIAKFSEFPEAVQAHRAELDGKTVVSYCTGGIRCEKAALYLEQEAVRHGLDAKVYQLEGGILKYFEEVGGAHYHGTCFVFDERRAVDPELAPSPDSVVE

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2547132374 Acidovorax radicis N35 Isolate Unclassified
3 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
4 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
5 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
6 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
7 2643221570 Acidovorax sp. Root568 Isolate Unclassified
8 2643221596 Acidovorax sp. Root70 Isolate Unclassified
9 2643221609 Acidovorax sp. Root217 Isolate Unclassified
10 2643221611 Acidovorax sp. Root219 Isolate Unclassified
11 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
12 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
13 2643221658 Variovorax sp. Root411 Isolate Unclassified
14 2643221672 Variovorax sp. Root434 Isolate Unclassified
15 2643221683 Variovorax sp. Root473 Isolate Unclassified
16 2643221717 Acidovorax sp. Root267 Isolate Unclassified
17 2721755523 Delftia sp. HK171 Isolate Unclassified
18 2738541277 Variovorax sp. GV051 Isolate Unclassified
19 2738541307 Variovorax sp. GV008 Isolate Unclassified
20 2738543012 Acidovorax sp. CF301 Isolate Unclassified
21 2738543013 Variovorax sp. BT01 Isolate Unclassified
22 2738543019 Variovorax sp. GV040 Isolate Unclassified
23 2816332133 Acidovorax radicis 2721A Isolate Unclassified
24 2818991446 Variovorax sp. 1180 Isolate Unclassified
25 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
26 2831864461 Roseateles noduli HZ7 Isolate Nodule
27 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
28 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
29 2842677519 Variovorax sp. R-72495 Isolate Unclassified
30 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
31 2842733646 Variovorax sp. R-72446 Isolate Unclassified
32 2842747753 Variovorax sp. R-72060 Isolate Unclassified
33 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
34 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
35 2885198086 Variovorax sp. 679 Isolate Unclassified
36 2885211737 Variovorax sp. 553 Isolate Unclassified
37 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
38 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
39 2899924645 Variovorax sp. 369 Isolate Unclassified
40 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
41 2904456579 Variovorax sp. 2002 Isolate Unclassified
42 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
43 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
44 2928037797 Variovorax sp. 1126 Isolate Unclassified
45 2928044640 Variovorax sp. 1128 Isolate Unclassified
46 2928051484 Variovorax sp. 1133 Isolate Unclassified
47 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
48 2928070936 Variovorax gossypii 1167 Isolate Unclassified
49 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
50 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
51 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
52 2929520902 Variovorax beijingensis 502 Isolate Unclassified
53 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
54 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
55 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
56 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
57 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
58 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
59 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
60 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
61 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
62 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
63 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
64 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
65 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
66 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
67 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
68 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
69 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
70 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
71 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
72 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
73 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
74 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
75 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
76 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
77 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
78 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
79 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
80 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
81 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
82 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
83 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
84 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
85 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
86 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
87 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
88 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
89 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
90 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
91 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
92 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
93 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
94 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
95 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
96 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
97 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
98 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
99 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
100 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
101 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
102 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
103 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
104 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
105 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
106 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
107 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
108 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
109 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
112 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
126 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
131 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
133 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
136 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
139 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
141 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
144 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
166 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
167 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
168 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
169 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
173 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
174 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
175 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
176 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
177 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
178 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
179 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
180 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
181 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
184 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
189 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
190 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
191 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
192 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
193 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
194 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
195 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
196 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
197 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
198 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
199 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
200 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
201 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
202 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
203 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
204 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
205 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
206 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
207 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
208 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
209 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
210 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
211 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
212 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
213 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
214 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
215 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
216 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
217 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
218 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
219 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
220 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
221 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
222 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
223 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
224 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
225 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
226 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
227 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
228 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
229 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
230 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
231 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
232 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
233 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
234 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
235 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
236 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
237 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
238 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
239 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
240 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
241 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
242 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
243 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
244 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
247 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
248 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
249 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
250 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
251 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
252 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
253 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
254 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
255 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
256 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
257 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
258 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
259 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
260 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
261 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
262 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
263 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
264 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
265 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
266 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
267 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
268 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
269 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
270 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
271 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
272 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
273 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
274 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
275 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
276 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
277 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
278 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
279 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
280 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
281 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
282 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
283 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
284 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
285 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
286 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
287 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
288 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
289 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.65
Metatranscriptomes 0.22
Isolates 13.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 40.26
Nodule 2.41
Rhizoplane 2.41
Rhizosphere 40.48
Stem 0
Stem Tuber 0
Unclassified 14.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10005208 3300001979 Bacteria 5521
2 JGI25152J39213_1003000 3300002773 Bacteria 5977
3 JGI25150J39212_1002576 3300002774 Bacteria 4458
4 JGI25150J39212_1013022 3300002774 Bacteria 1453
5 JGI25151J46595_10001321 3300003187 Bacteria 17340
6 JGI25151J46595_10002423 3300003187 Bacteria 11247
7 JGI25153J46596_10010262 3300003215 Bacteria 4254
8 rootH1_10001028 3300003316 Bacteria 11892
9 rootH1_10048904 3300003316 Bacteria 2343
10 rootL2_10001519 3300003322 Bacteria 91967
11 rootH1_10013771 3300003316 Bacteria 3106
12 rootH1_10013771 3300003323 Bacteria 14908
13 Ga0006562J51391_1044395 3300003578 Bacteria 2120
14 Ga0055535_1000415 3300003761 Bacteria 40129
15 Ga0055542_1000004 3300003762 Bacteria 553532
16 Ga0055526_1001599 3300003771 Bacteria 15892
17 Ga0055526_1005531 3300003771 Bacteria 7227
18 Ga0055526_1023602 3300003771 Bacteria 2047
19 Ga0055537_1000620 3300003773 Bacteria 19417
20 Ga0055537_1004447 3300003773 Bacteria 4010
21 Ga0055524_1000045 3300003775 Bacteria 151148
22 Ga0055524_1001433 3300003775 Bacteria 13696
23 Ga0055524_1016189 3300003775 Bacteria 2686
24 Ga0055536_1005465 3300003781 Bacteria 6203
25 Ga0055536_1006541 3300003781 Bacteria 5411
26 Ga0055536_1012920 3300003781 Bacteria 3055
27 Ga0055536_1023785 3300003781 Bacteria 1792
28 Ga0055534_1001640 3300003784 Bacteria 8641
29 Ga0055534_1005219 3300003784 Bacteria 3536
30 Ga0055534_1024669 3300003784 Bacteria 972
31 Ga0055528_1003747 3300003790 Bacteria 7504
32 Ga0055528_1017834 3300003790 Bacteria 2440
33 Ga0055530_10005921 3300003791 Bacteria 5639
34 Ga0055530_10006293 3300003791 Bacteria 5337
35 Ga0055530_10007077 3300003791 Bacteria 4815
36 Ga0055540_1000002 3300003792 Bacteria 436954
37 Ga0055540_1004204 3300003792 Bacteria 6624
38 Ga0055540_1005141 3300003792 Bacteria 5619
39 Ga0055540_1008795 3300003792 Bacteria 3582
40 Ga0055531_10002486 3300003794 Bacteria 12290
41 Ga0055531_10006204 3300003794 Bacteria 6825
42 Ga0055531_10008075 3300003794 Bacteria 5619
43 Ga0055531_10008645 3300003794 Bacteria 5329
44 Ga0055543_1006630 3300004625 Bacteria 2767
45 Ga0065165_1000411 3300005262 Bacteria 68430
46 Ga0065165_1000678 3300005262 Bacteria 49056
47 Ga0065165_1002672 3300005262 Bacteria 14396
48 Ga0065165_1020325 3300005262 Bacteria 2340
49 Ga0070658_10004146 3300005327 Bacteria 11869
50 Ga0070666_10000079 3300005335 Bacteria 69879
51 Ga0070666_10121973 3300005335 Bacteria 1808
52 Ga0070660_100102728 3300005339 Bacteria 2266
53 Ga0070661_100001073 3300005344 Bacteria 19371
54 Ga0070661_100035108 3300005344 Bacteria 3640
55 Ga0070668_100213671 3300005347 Bacteria 1588
56 Ga0070669_100037277 3300005353 Bacteria 3527
57 Ga0070659_100003401 3300005366 Bacteria 11334
58 Ga0070667_100023751 3300005367 Bacteria 5090
59 Ga0070667_100108167 3300005367 Bacteria 2408
60 Ga0068853_100083341 3300005539 Bacteria 2801
61 Ga0068853_100363821 3300005539 Bacteria 1348
62 Ga0070665_100078077 3300005548 Bacteria 3317
63 Ga0070665_100235242 3300005548 Bacteria 1832
64 Ga0070665_100831151 3300005548 Bacteria 937
65 Ga0068855_100201921 3300005563 Bacteria 2238
66 Ga0070664_100012577 3300005564 Bacteria 6886
67 Ga0068854_100469956 3300005578 Bacteria 1054
68 Ga0068852_100381032 3300005616 Bacteria 1384
69 Ga0075365_10000946 3300006038 Bacteria 12302
70 Ga0075365_10036956 3300006038 Bacteria 3168
71 Ga0075365_10442614 3300006038 Bacteria 918
72 Ga0075368_10036180 3300006042 Bacteria 1928
73 Ga0075363_100001972 3300006048 Bacteria 8160
74 Ga0075363_100007111 3300006048 Bacteria 5122
75 Ga0075364_10006992 3300006051 Bacteria 6665
76 Ga0075364_10015699 3300006051 Bacteria 4700
77 Ga0075362_10011789 3300006177 Bacteria 3451
78 Ga0075362_10014866 3300006177 Bacteria 3153
79 Ga0075362_10049360 3300006177 Bacteria 1879
80 Ga0075367_10030942 3300006178 Bacteria 3072
81 Ga0075367_10092652 3300006178 Bacteria 1840
82 Ga0075369_10167205 3300006186 Bacteria 1009
83 Ga0075370_10000213 3300006353 Bacteria 20632
84 Ga0075370_10007965 3300006353 Bacteria 5429
85 Ga0075370_10016261 3300006353 Bacteria 4001
86 Ga0075370_10018685 3300006353 Bacteria 3762
87 Ga0075370_10019300 3300006353 Bacteria 3712
88 Ga0099823_1001509 3300006944 Bacteria 19439
89 Ga0079104_1000007 3300006946 Bacteria 390531
90 Ga0079104_1000970 3300006946 Bacteria 22460
91 Ga0099826_10002990 3300006948 Bacteria 11256
92 Ga0105244_10016159 3300009036 Bacteria 4259
93 Ga0105244_10088650 3300009036 Bacteria 1523
94 Ga0105250_10008095 3300009092 Bacteria 4479
95 Ga0105240_10240757 3300009093 Bacteria 2097
96 Ga0105245_10446131 3300009098 Bacteria 1301
97 Ga0105243_10000435 3300009148 Bacteria 43795
98 Ga0105243_10016953 3300009148 Bacteria 5508
99 Ga0105242_10012028 3300009176 Bacteria 6661
100 Ga0105242_10266537 3300009176 Bacteria 1549
101 Ga0105237_10122874 3300009545 Bacteria 2590
102 Ga0105238_10000145 3300009551 Bacteria 77797
103 Ga0105246_10293535 3300011119 Bacteria 1309
104 Ga0157319_1000001 3300012497 Bacteria 423237
105 Ga0157373_10149271 3300013100 Bacteria 1644
106 Ga0157370_10068512 3300013104 Bacteria 3353
107 Ga0163162_10001472 3300013306 Bacteria 21907
108 Ga0157372_10027907 3300013307 Bacteria 6153
109 Ga0157375_10383331 3300013308 Bacteria 1572
110 Ga0182008_10000325 3300014497 Bacteria 37641
111 Ga0182008_10006300 3300014497 Bacteria 6655
112 Ga0182008_10009856 3300014497 Bacteria 5136
113 Ga0182008_10016588 3300014497 Bacteria 3827
114 Ga0182008_10133612 3300014497 Bacteria 1238
115 Ga0157376_10263482 3300014969 Bacteria 1616
116 Ga0182006_1004384 3300015261 Bacteria 6972
117 Ga0182007_10005576 3300015262 Bacteria 5506
118 Ga0182007_10008200 3300015262 Bacteria 4306
119 Ga0163161_10000112 3300017792 Bacteria 77235
120 Ga0163161_10140374 3300017792 Bacteria 1829
121 Ga0209147_101797 3300025229 Bacteria 6724
122 Ga0209258_100022 3300025242 Bacteria 553584
123 Ga0207425_1000138 3300025245 Bacteria 65477
124 Ga0207425_1000226 3300025245 Bacteria 44291
125 Ga0207425_1005121 3300025245 Bacteria 3793
126 Ga0209148_1000034 3300025254 Bacteria 553584
127 Ga0209129_1000012 3300025258 Bacteria 541516
128 Ga0209129_1000023 3300025258 Bacteria 420646
129 Ga0209129_1000558 3300025258 Bacteria 25653
130 Ga0209129_1004570 3300025258 Bacteria 5330
131 Ga0209565_1000040 3300025263 Bacteria 266543
132 Ga0209565_1015175 3300025263 Bacteria 1744
133 Ga0209565_1040263 3300025263 Bacteria 873
134 Ga0209673_1000109 3300025273 Bacteria 183000
135 Ga0209673_1000673 3300025273 Bacteria 49581
136 Ga0209673_1004856 3300025273 Bacteria 7023
137 Ga0209673_1006626 3300025273 Bacteria 5539
138 Ga0209673_1011388 3300025273 Bacteria 3672
139 Ga0209673_1012799 3300025273 Bacteria 3354
140 Ga0209673_1021968 3300025273 Bacteria 2215
141 Ga0209130_1000222 3300025284 Bacteria 74607
142 Ga0209130_1001738 3300025284 Bacteria 13008
143 Ga0209130_1005769 3300025284 Bacteria 4192
144 Ga0209675_1000024 3300025291 Bacteria 312615
145 Ga0209675_1000774 3300025291 Bacteria 21382
146 Ga0209675_1001282 3300025291 Bacteria 14952
147 Ga0209675_1003428 3300025291 Bacteria 7544
148 Ga0209675_1007678 3300025291 Bacteria 4088
149 Ga0209675_1008986 3300025291 Bacteria 3590
150 Ga0209676_1000005 3300025292 Bacteria 1076001
151 Ga0209676_1000437 3300025292 Bacteria 71544
152 Ga0209676_1000595 3300025292 Bacteria 53773
153 Ga0209676_1009345 3300025292 Bacteria 4239
154 Ga0209676_1031388 3300025292 Bacteria 1611
155 Ga0209025_1000157 3300025294 Bacteria 168790
156 Ga0209025_1000476 3300025294 Bacteria 77754
157 Ga0209025_1001078 3300025294 Bacteria 39551
158 Ga0209025_1013875 3300025294 Bacteria 5019
159 Ga0209025_1014231 3300025294 Bacteria 4918
160 Ga0209025_1091356 3300025294 Bacteria 994
161 Ga0209564_1000005 3300025295 Bacteria 1147192
162 Ga0209564_1000022 3300025295 Bacteria 555109
163 Ga0209564_1000400 3300025295 Bacteria 77039
164 Ga0209564_1000898 3300025295 Bacteria 39109
165 Ga0209758_1000064 3300025297 Bacteria 311812
166 Ga0209758_1000099 3300025297 Bacteria 230054
167 Ga0209758_1005231 3300025297 Bacteria 10167
168 Ga0209050_1000007 3300025298 Bacteria 1187891
169 Ga0209050_1000997 3300025298 Bacteria 35684
170 Ga0209050_1003666 3300025298 Bacteria 11084
171 Ga0209050_1007371 3300025298 Bacteria 6181
172 Ga0209050_1015861 3300025298 Bacteria 3127
173 Ga0209050_1019252 3300025298 Bacteria 2603
174 Ga0209256_1000038 3300025299 Bacteria 375225
175 Ga0209256_1000115 3300025299 Bacteria 173607
176 Ga0209256_1000143 3300025299 Bacteria 151331
177 Ga0209256_1002220 3300025299 Bacteria 16591
178 Ga0209256_1002624 3300025299 Bacteria 14196
179 Ga0209256_1009961 3300025299 Bacteria 4068
180 Ga0207426_1000001 3300025302 Bacteria 1341301
181 Ga0207426_1000785 3300025302 Bacteria 34741
182 Ga0209051_1000009 3300025303 Bacteria 706778
183 Ga0209051_1000024 3300025303 Bacteria 437007
184 Ga0209051_1000312 3300025303 Bacteria 75251
185 Ga0209051_1000787 3300025303 Bacteria 33471
186 Ga0209051_1001013 3300025303 Bacteria 26927
187 Ga0209051_1002002 3300025303 Bacteria 15550
188 Ga0209051_1005651 3300025303 Bacteria 7238
189 Ga0209257_1000011 3300025304 Bacteria 1112630
190 Ga0209257_1000079 3300025304 Bacteria 316420
191 Ga0209257_1000508 3300025304 Bacteria 68156
192 Ga0209257_1002900 3300025304 Bacteria 15886
193 Ga0209257_1003449 3300025304 Bacteria 13551
194 Ga0209257_1006730 3300025304 Bacteria 7262
195 Ga0209257_1007332 3300025304 Bacteria 6690
196 Ga0209257_1020959 3300025304 Bacteria 2393
197 Ga0209257_1038125 3300025304 Bacteria 1459
198 Ga0207696_1008524 3300025711 Bacteria 3907
199 Ga0207655_1005294 3300025728 Bacteria 8839
200 Ga0207680_10000001 3300025903 Bacteria 1091453
201 Ga0207680_10159574 3300025903 Bacteria 1511
202 Ga0207705_10001387 3300025909 Bacteria 19303
203 Ga0207695_10148045 3300025913 Bacteria 2289
204 Ga0207671_10022491 3300025914 Bacteria 4767
205 Ga0207657_10118904 3300025919 Bacteria 2175
206 Ga0207649_10001812 3300025920 Bacteria 12218
207 Ga0207649_10036658 3300025920 Bacteria 2956
208 Ga0207649_10246753 3300025920 Bacteria 1284
209 Ga0207694_10000828 3300025924 Bacteria 27515
210 Ga0207690_10004966 3300025932 Bacteria 7852
211 Ga0207690_10038816 3300025932 Bacteria 3102
212 Ga0207706_10022612 3300025933 Bacteria 5643
213 Ga0207686_10239350 3300025934 Bacteria 1320
214 Ga0207709_10000193 3300025935 Bacteria 81025
215 Ga0207709_10000768 3300025935 Bacteria 25259
216 Ga0207709_10005685 3300025935 Bacteria 7043
217 Ga0207679_10000351 3300025945 Bacteria 33566
218 Ga0207679_10004812 3300025945 Bacteria 8413
219 Ga0207658_10018531 3300025986 Bacteria 4808
220 Ga0207639_10171379 3300026041 Bacteria 1838
221 Ga0207674_10123214 3300026116 Bacteria 2558
222 Ga0207683_10161438 3300026121 Bacteria 2026
223 Ga0207698_10180377 3300026142 Bacteria 1870
224 Ga0209281_1000020 3300027111 Bacteria 575972
225 Ga0209281_1000993 3300027111 Bacteria 22417
226 Ga0209389_1010744 3300027296 Bacteria 8266
227 Ga0209282_1000979 3300027666 Bacteria 14932
228 Ga0209813_10036555 3300027866 Bacteria 1476
229 Ga0207428_10111222 3300027907 Bacteria 2108
230 Ga0268266_10000067 3300028379 Bacteria 241577
231 Ga0268266_10044152 3300028379 Bacteria 3809
232 Ga0268266_10495353 3300028379 Bacteria 1166
233 Ga0268265_10039531 3300028380 Bacteria 3478
234 Ga0307517_10080756 3300028786 Bacteria 2781
235 Ga0307515_10000028 3300028794 Bacteria 368467
236 Ga0307515_10321074 3300028794 Bacteria 1215
237 Ga0314311_1231870 3300030733 Bacteria 3899
238 Ga0316178_1120970 3300030735 Bacteria 2504
239 Ga0316180_1166561 3300030736 Bacteria 2306
240 Ga0316183_1113318 3300030742 Bacteria 3639
241 Ga0316181_1096116 3300030744 Bacteria 9086
242 Ga0316182_1097164 3300030745 Bacteria 3418
243 Ga0316182_1409870 3300030745 Bacteria 2400
244 Ga0265327_10000465 3300031251 Bacteria 72062
245 Ga0307513_10138097 3300031456 Bacteria 2369
246 Ga0307408_100020724 3300031548 Bacteria 4440
247 Ga0307408_100055882 3300031548 Bacteria 2860
248 Ga0307408_100095405 3300031548 Bacteria 2254
249 Ga0307408_100476876 3300031548 Bacteria 1087
250 Ga0307405_10119411 3300031731 Bacteria 1801
251 Ga0307405_10318810 3300031731 Bacteria 1186
252 Ga0307406_10129562 3300031901 Bacteria 1769
253 Ga0307412_10011508 3300031911 Bacteria 5128
254 Ga0307412_10250229 3300031911 Bacteria 1375
255 Ga0307416_100707055 3300032002 Bacteria 1097
256 Ga0307414_10059630 3300032004 Bacteria 2695
257 Ga0307510_10011241 3300033180 Bacteria 10642
258 Ga0439436_0003545 3300041404 Bacteria 4743
259 Ga0439436_0037846 3300041404 Bacteria 1388
260 Ga0439438_078237 3300041405 Bacteria 813
261 Ga0439466_0009825 3300041411 Bacteria 3564
262 Ga0439465_0003231 3300041413 Bacteria 5317
263 Ga0439465_0028535 3300041413 Bacteria 1770
264 Ga0451837_0482874 3300041494 Bacteria 1729
265 Ga0439431_0003929 3300041997 Bacteria 3280
266 Ga0439433_0003432 3300041999 Bacteria 3401
267 Ga0439442_026813 3300042002 Bacteria 1200
268 Ga0439445_0000484 3300042004 Bacteria 8084
269 Ga0439432_006219 3300042006 Bacteria 4275
270 Ga0439432_016158 3300042006 Bacteria 2514
271 Ga0439449_0002815 3300042007 Bacteria 6762
272 Ga0439449_0066354 3300042007 Bacteria 1331
273 Ga0439452_003357 3300042010 Bacteria 5624
274 Ga0439457_004303 3300042014 Bacteria 3739
275 Ga0439462_0005502 3300042015 Bacteria 3122
276 Ga0450919_000146 3300042121 Bacteria 7295
277 Ga0450923_013140 3300042125 Bacteria 1518
278 Ga0450923_013286 3300042125 Bacteria 1512
279 Ga0450890_000224 3300042127 Bacteria 8536
280 Ga0450907_004448 3300042146 Bacteria 2417
281 Ga0439446_0002854 3300042156 Bacteria 4209
282 Ga0439446_0063693 3300042156 Bacteria 1118
283 Ga0450908_009589 3300042184 Bacteria 1797
284 Ga0450909_005033 3300042185 Bacteria 1897
285 Ga0439434_0001194 3300042435 Bacteria 7476
286 Ga0439459_0003865 3300042438 Bacteria 2394
287 Ga0450918_000032 3300042531 Bacteria 28506
288 Ga0450918_003051 3300042531 Bacteria 3131
289 Ga0466965_0009230 3300044683 Bacteria 4582
290 Ga0466963_0076007 3300044694 Bacteria 2267
291 Ga0466963_0159900 3300044694 Bacteria 1567
292 Ga0451576_0367537 3300045051 Bacteria 1507
293 Ga0495627_028819 3300046453 Bacteria 1771
294 Ga0495638_0059636 3300046460 Bacteria 2362
295 Ga0495650_0001430 3300046471 Bacteria 23153
296 Ga0495639_0025315 3300046475 Bacteria 2616
297 Ga0495607_0000329 3300046501 Bacteria 49139
298 Ga0495606_0013159 3300046507 Bacteria 6566
299 Ga0495610_0055481 3300046512 Bacteria 1909
300 Ga0495616_0008704 3300046513 Bacteria 5987
301 Ga0495618_0173002 3300046514 Bacteria 1374
302 Ga0495620_0047250 3300046515 Bacteria 1853
303 Ga0495630_0131003 3300046517 Bacteria 1905
304 Ga0495631_0001178 3300046518 Bacteria 16164
305 Ga0495637_0005753 3300046520 Bacteria 6285
306 Ga0495654_0026083 3300046530 Bacteria 3008
307 Ga0495609_0171783 3300046538 Bacteria 915
308 Ga0495621_0015668 3300046539 Bacteria 2420
309 Ga0495597_0000879 3300046542 Bacteria 23385
310 Ga0495633_0001060 3300046558 Bacteria 22379
311 Ga0495656_0000542 3300046615 Bacteria 12321
312 Ga0495668_0137446 3300046616 Bacteria 1338
313 Ga0495625_0000572 3300046660 Bacteria 53759
314 Ga0495625_0004747 3300046660 Bacteria 12718
315 Ga0495625_0025827 3300046660 Bacteria 4447
316 Ga0495625_0228248 3300046660 Bacteria 1217
317 Ga0495588_0026670 3300046674 Bacteria 2886
318 Ga0495670_0021648 3300046691 Bacteria 3172
319 Ga0495671_0006076 3300046692 Bacteria 7013
320 Ga0495660_0073182 3300046810 Bacteria 1813
321 Ga0495581_0162416 3300047315 Bacteria 1306
322 Ga0495676_0044129 3300047321 Bacteria 3642
323 Ga0495626_0067187 3300048091 Bacteria 1620
324 Ga0496101_0297006 3300048904 Bacteria 1265
325 Ga0496102_0004209 3300048905 Bacteria 12173
326 Ga0496103_0110325 3300048906 Bacteria 1747
327 Ga0496107_0408800 3300048910 Bacteria 1009
328 Ga0496109_0091763 3300048912 Bacteria 2809
329 Ga0496111_0095089 3300048914 Bacteria 2186
330 Ga0496114_0136239 3300048917 Bacteria 2123
331 Ga0496114_0138972 3300048917 Bacteria 2102
332 Ga0496116_0020790 3300048919 Bacteria 4972
333 Ga0496116_0058937 3300048919 Bacteria 2500
334 Ga0496117_0028359 3300048920 Bacteria 4338
335 Ga0496117_0075329 3300048920 Bacteria 2242
336 Ga0496117_0187788 3300048920 Bacteria 1181
337 Ga0496118_0018200 3300048921 Bacteria 6346
338 Ga0496118_0136507 3300048921 Bacteria 1564
339 Ga0496119_0053780 3300048922 Bacteria 2457
340 Ga0496121_0080557 3300048924 Bacteria 2580
341 Ga0496122_0002198 3300048925 Bacteria 28484
342 Ga0496122_0097477 3300048925 Bacteria 1979
343 Ga0496122_0140821 3300048925 Bacteria 1509
344 Ga0496123_0000314 3300048926 Bacteria 92927
345 Ga0496123_0148788 3300048926 Bacteria 1267
346 Ga0496124_0018975 3300048927 Bacteria 6419
347 Ga0496124_0031381 3300048927 Bacteria 4704
348 Ga0496124_0063909 3300048927 Bacteria 3073
349 Ga0496125_0073286 3300048928 Bacteria 2663
350 Ga0496125_0094485 3300048928 Bacteria 2227
351 Ga0501223_018646 3300049663 Bacteria 1365
352 Ga0501262_000747 3300049759 Bacteria 3756
353 Ga0501266_000629 3300049763 Bacteria 4593
354 nmdc:mga03683_10738_c1 3300050489 Bacteria 3291
355 nmdc:mga03n38_4114_c1 3300050490 Bacteria 4777
356 nmdc:mga03n38_7266_c1 3300050490 Bacteria 3911
357 nmdc:mga03n38_80577_c1 3300050490 Bacteria 1529
358 nmdc:mga00v17_17387_c1 3300050491 Bacteria 4070
359 nmdc:mga00v17_56633_c1 3300050491 Bacteria 2397
360 nmdc:mga00v17_60700_c1 3300050491 Bacteria 2323
361 nmdc:mga0yw44_12462_c1 3300050492 Bacteria 4434
362 nmdc:mga0yw44_27438_c1 3300050492 Bacteria 3261
363 nmdc:mga0yw44_416719_c1 3300050492 Bacteria 909
364 nmdc:mga0k408_17997_c1 3300050493 Bacteria 3939
365 nmdc:mga0k408_273065_c1 3300050493 Bacteria 1009
366 nmdc:mga06z11_131634_c1 3300050494 Bacteria 1405
367 nmdc:mga06z11_138276_c1 3300050494 Bacteria 1374
368 nmdc:mga07m45_16246_c1 3300050496 Bacteria 3984
369 nmdc:mga07m45_29315_c1 3300050496 Bacteria 3042
370 nmdc:mga07m45_30261_c1 3300050496 Bacteria 2997
371 nmdc:mga07m45_43139_c1 3300050496 Bacteria 2529
372 nmdc:mga07m45_432_c1 3300050496 Bacteria 17386
373 nmdc:mga07m45_8752_c1 3300050496 Bacteria 5217
374 nmdc:mga0sz30_106392_c1 3300050516 Bacteria 1227
375 Ga0500610_0024518 3300053079 Bacteria 2999
376 Ga0500610_0031891 3300053079 Bacteria 2680
377 Ga0500610_0146678 3300053079 Bacteria 1186
378 Ga0500646_0011901 3300053090 Bacteria 2242
379 Ga0500651_0000241 3300053093 Bacteria 33596
380 Ga0500571_000069 3300053110 Bacteria 32297
381 Ga0500592_003579 3300053116 Bacteria 2479
382 Ga0500593_032867 3300053117 Bacteria 2321
383 Ga0500594_0012587 3300053118 Bacteria 1997
384 Ga0500607_036907 3300053121 Bacteria 2666
385 Ga0500607_038246 3300053121 Bacteria 2611
386 Ga0500608_010729 3300053122 Bacteria 3944
387 Ga0500618_037729 3300053125 Bacteria 1116
388 Ga0500658_0002458 3300053134 Bacteria 7164
389 Ga0500658_0005974 3300053134 Bacteria 4526
390 Ga0500559_0001438 3300053136 Bacteria 13507
391 Ga0500559_0014314 3300053136 Bacteria 3352
392 Ga0500561_0025150 3300053137 Bacteria 1445
393 Ga0500564_040369 3300053138 Bacteria 2149
394 Ga0500616_0028437 3300053153 Bacteria 3080
395 Ga0500622_0044121 3300053156 Bacteria 2310
396 Ga0500627_0013443 3300053158 Bacteria 3104
397 Ga0500634_0095168 3300053161 Bacteria 1503
398 Ga0500636_0161860 3300053177 Bacteria 1219

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046691 Ga0495670_0021648 Ga0495670_0021648_2456_3151 218
2 3300032004 Ga0307414_10059630 Ga0307414_100596302 230
3 3300003773 Ga0055537_1000620 Ga0055537_100062021 231
4 3300003790 Ga0055528_1003747 Ga0055528_10037472 231
5 3300006038 Ga0075365_10000946 Ga0075365_1000094611 231
6 3300006048 Ga0075363_100001972 Ga0075363_1000019722 231
7 3300006051 Ga0075364_10006992 Ga0075364_100069928 231
8 3300006178 Ga0075367_10092652 Ga0075367_100926522 231
9 3300006353 Ga0075370_10000213 Ga0075370_1000021320 231
10 3300006948 Ga0099826_10002990 Ga0099826_100029908 231
11 3300011119 Ga0105246_10293535 Ga0105246_102935352 231
12 3300025263 Ga0209565_1000040 Ga0209565_1000040161 231
13 3300025273 Ga0209673_1000109 Ga0209673_10001092 231
14 3300025291 Ga0209675_1000024 Ga0209675_1000024107 231
15 3300025292 Ga0209676_1031388 Ga0209676_10313881 231
16 3300025294 Ga0209025_1091356 Ga0209025_10913561 231
17 3300027666 Ga0209282_1000979 Ga0209282_100097915 231
18 3300027907 Ga0207428_10111222 Ga0207428_101112222 231
19 3300031548 Ga0307408_100055882 Ga0307408_1000558822 231
20 3300031548 Ga0307408_100095405 Ga0307408_1000954053 231
21 3300031911 Ga0307412_10250229 Ga0307412_102502292 231
22 3300050490 nmdc:mga03n38_7266_c1 nmdc:mga03n38_7266_c1_653_1453 231
23 3300050491 nmdc:mga00v17_17387_c1 nmdc:mga00v17_17387_c1_3054_3854 231
24 3300050492 nmdc:mga0yw44_12462_c1 nmdc:mga0yw44_12462_c1_2460_3251 231
25 3300050493 nmdc:mga0k408_17997_c1 nmdc:mga0k408_17997_c1_1994_2785 231
26 3300050494 nmdc:mga06z11_131634_c1 nmdc:mga06z11_131634_c1_524_1324 231
27 3300050494 nmdc:mga06z11_138276_c1 nmdc:mga06z11_138276_c1_322_1107 231
28 3300050496 nmdc:mga07m45_29315_c1 nmdc:mga07m45_29315_c1_1996_2781 231
29 3300003792 Ga0055540_1004204 Ga0055540_10042047 232
30 3300006038 Ga0075365_10442614 Ga0075365_104426141 232
31 3300025303 Ga0209051_1001013 Ga0209051_100101328 232
32 3300031548 Ga0307408_100020724 Ga0307408_1000207242 232
33 3300041413 Ga0439465_0028535 Ga0439465_0028535_462_1253 232
34 3300042146 Ga0450907_004448 Ga0450907_004448_613_1404 232
35 3300042435 Ga0439434_0001194 Ga0439434_0001194_1192_1983 232
36 3300050492 nmdc:mga0yw44_416719_c1 nmdc:mga0yw44_416719_c1_32_823 232
37 3300031731 Ga0307405_10318810 Ga0307405_103188102 235
38 3300006177 Ga0075362_10049360 Ga0075362_100493602 236
39 3300041404 Ga0439436_0037846 Ga0439436_0037846_434_1225 236
40 3300042007 Ga0439449_0066354 Ga0439449_0066354_145_936 236
41 3300042156 Ga0439446_0063693 Ga0439446_0063693_14_805 236
42 3300042531 Ga0450918_003051 Ga0450918_003051_1612_2403 236
43 3300050490 nmdc:mga03n38_80577_c1 nmdc:mga03n38_80577_c1_18_803 236
44 iso_pu_bacteria 2513020051 2513231451 239
45 iso_pu_bacteria 2643221658 2644328172 239
46 iso_pu_bacteria 2738541277 2738720086 239
47 iso_pu_bacteria 2738543019 2739279285 239
48 iso_pu_bacteria 2818991446 2819596034 239
49 3300005327 Ga0070658_10004146 Ga0070658_1000414611 240
50 3300005335 Ga0070666_10000079 Ga0070666_1000007925 240
51 3300005344 Ga0070661_100035108 Ga0070661_1000351083 240
52 3300005367 Ga0070667_100023751 Ga0070667_1000237512 240
53 3300005539 Ga0068853_100363821 Ga0068853_1003638212 240
54 3300005548 Ga0070665_100078077 Ga0070665_1000780774 240
55 3300009551 Ga0105238_10000145 Ga0105238_1000014512 240
56 3300013306 Ga0163162_10001472 Ga0163162_1000147213 240
57 3300025903 Ga0207680_10000001 Ga0207680_100000011004 240
58 3300025909 Ga0207705_10001387 Ga0207705_100013872 240
59 3300025920 Ga0207649_10036658 Ga0207649_100366582 240
60 3300025924 Ga0207694_10000828 Ga0207694_100008284 240
61 3300025986 Ga0207658_10018531 Ga0207658_100185312 240
62 3300028379 Ga0268266_10000067 Ga0268266_1000006727 240
63 3300028786 Ga0307517_10080756 Ga0307517_100807562 240
64 3300033180 Ga0307510_10011241 Ga0307510_1001124110 240
65 3300046471 Ga0495650_0001430 Ga0495650_0001430_9968_10705 240
66 3300046507 Ga0495606_0013159 Ga0495606_0013159_2818_3555 240
67 3300046660 Ga0495625_0004747 Ga0495625_0004747_9772_10509 240
68 iso_pu_bacteria 2643221609 2644061324 240
69 iso_pu_bacteria 2643221611 2644076636 240
70 iso_pu_bacteria 2738543012 2739243652 240
71 iso_pu_bacteria 2816332133 2816474133 240
72 iso_pu_bacteria 2842718218 2842719191 240
73 iso_pu_bacteria 2974320154 2974323666 240
74 3300003323 rootH1_10013771 rootH1_100137713 241
75 3300003578 Ga0006562J51391_1044395 Ga0006562J51391_10443952 241
76 3300003775 Ga0055524_1016189 Ga0055524_10161892 241
77 3300003781 Ga0055536_1005465 Ga0055536_10054652 241
78 3300003792 Ga0055540_1008795 Ga0055540_10087952 241
79 3300003794 Ga0055531_10006204 Ga0055531_100062045 241
80 3300005563 Ga0068855_100201921 Ga0068855_1002019213 241
81 3300005616 Ga0068852_100381032 Ga0068852_1003810322 241
82 3300006038 Ga0075365_10036956 Ga0075365_100369562 241
83 3300006042 Ga0075368_10036180 Ga0075368_100361802 241
84 3300006048 Ga0075363_100007111 Ga0075363_1000071112 241
85 3300006051 Ga0075364_10015699 Ga0075364_100156995 241
86 3300006177 Ga0075362_10014866 Ga0075362_100148662 241
87 3300006178 Ga0075367_10030942 Ga0075367_100309422 241
88 3300006353 Ga0075370_10018685 Ga0075370_100186852 241
89 3300006944 Ga0099823_1001509 Ga0099823_100150922 241
90 3300009036 Ga0105244_10088650 Ga0105244_100886502 241
91 3300009093 Ga0105240_10240757 Ga0105240_102407572 241
92 3300009148 Ga0105243_10016953 Ga0105243_100169532 241
93 3300009176 Ga0105242_10012028 Ga0105242_100120283 241
94 3300009545 Ga0105237_10122874 Ga0105237_101228742 241
95 3300013100 Ga0157373_10149271 Ga0157373_101492712 241
96 3300025273 Ga0209673_1011388 Ga0209673_10113882 241
97 3300025292 Ga0209676_1000595 Ga0209676_100059536 241
98 3300025298 Ga0209050_1003666 Ga0209050_10036665 241
99 3300025299 Ga0209256_1002220 Ga0209256_100222015 241
100 3300025303 Ga0209051_1000787 Ga0209051_10007872 241
101 3300025303 Ga0209051_1002002 Ga0209051_100200211 241
102 3300025304 Ga0209257_1002900 Ga0209257_100290012 241
103 3300025304 Ga0209257_1020959 Ga0209257_10209592 241
104 3300025913 Ga0207695_10148045 Ga0207695_101480451 241
105 3300025914 Ga0207671_10022491 Ga0207671_100224912 241
106 3300025934 Ga0207686_10239350 Ga0207686_102393502 241
107 3300025935 Ga0207709_10000768 Ga0207709_100007682 241
108 3300026116 Ga0207674_10123214 Ga0207674_101232142 241
109 3300026142 Ga0207698_10180377 Ga0207698_101803772 241
110 3300027296 Ga0209389_1010744 Ga0209389_10107443 241
111 3300027866 Ga0209813_10036555 Ga0209813_100365551 241
112 3300030735 Ga0316178_1120970 Ga0316178_11209702 241
113 3300030742 Ga0316183_1113318 Ga0316183_11133185 241
114 3300031548 Ga0307408_100476876 Ga0307408_1004768762 241
115 3300031731 Ga0307405_10119411 Ga0307405_101194112 241
116 3300031911 Ga0307412_10011508 Ga0307412_100115082 241
117 3300032002 Ga0307416_100707055 Ga0307416_1007070552 241
118 3300044694 Ga0466963_0076007 Ga0466963_0076007_1298_2128 241
119 3300045051 Ga0451576_0367537 Ga0451576_0367537_13_750 241
120 3300048920 Ga0496117_0187788 Ga0496117_0187788_181_972 241
121 3300048921 Ga0496118_0136507 Ga0496118_0136507_521_1312 241
122 3300048925 Ga0496122_0140821 Ga0496122_0140821_55_846 241
123 3300048927 Ga0496124_0018975 Ga0496124_0018975_4278_5069 241
124 3300048927 Ga0496124_0063909 Ga0496124_0063909_1156_1947 241
125 3300050489 nmdc:mga03683_10738_c1 nmdc:mga03683_10738_c1_366_1106 241
126 3300050490 nmdc:mga03n38_4114_c1 nmdc:mga03n38_4114_c1_2360_3100 241
127 3300050491 nmdc:mga00v17_60700_c1 nmdc:mga00v17_60700_c1_1039_1779 241
128 3300050492 nmdc:mga0yw44_27438_c1 nmdc:mga0yw44_27438_c1_1586_2326 241
129 3300050496 nmdc:mga07m45_432_c1 nmdc:mga07m45_432_c1_5729_6469 241
130 3300003784 Ga0055534_1005219 Ga0055534_10052195 242
131 3300046453 Ga0495627_028819 Ga0495627_028819_323_1114 242
132 3300046515 Ga0495620_0047250 Ga0495620_0047250_728_1519 242
133 3300046616 Ga0495668_0137446 Ga0495668_0137446_420_1211 242
134 3300046660 Ga0495625_0000572 Ga0495625_0000572_24952_25737 242
135 3300046692 Ga0495671_0006076 Ga0495671_0006076_4595_5386 242
136 3300049759 Ga0501262_000747 Ga0501262_000747_924_1709 242
137 3300053117 Ga0500593_032867 Ga0500593_032867_1347_2138 242
138 3300053158 Ga0500627_0013443 Ga0500627_0013443_1155_1946 242
139 3300053161 Ga0500634_0095168 Ga0500634_0095168_660_1451 242
140 iso_pu_bacteria 2857576091 2857577524 242
141 iso_pu_bacteria 2894023352 2894025765 242
142 3300003187 JGI25151J46595_10002423 JGI25151J46595_100024232 243
143 3300009148 Ga0105243_10000435 Ga0105243_1000043536 243
144 3300013104 Ga0157370_10068512 Ga0157370_100685123 243
145 3300014497 Ga0182008_10009856 Ga0182008_100098565 243
146 3300017792 Ga0163161_10000112 Ga0163161_100001128 243
147 3300025291 Ga0209675_1007678 Ga0209675_10076783 243
148 3300025298 Ga0209050_1015861 Ga0209050_10158612 243
149 3300025935 Ga0207709_10000193 Ga0207709_1000019352 243
150 3300030733 Ga0314311_1231870 Ga0314311_12318704 243
151 3300030736 Ga0316180_1166561 Ga0316180_11665612 243
152 3300030744 Ga0316181_1096116 Ga0316181_10961162 243
153 3300030745 Ga0316182_1409870 Ga0316182_14098702 243
154 3300046501 Ga0495607_0000329 Ga0495607_0000329_9385_10158 243
155 3300048091 Ga0495626_0067187 Ga0495626_0067187_777_1550 243
156 3300048919 Ga0496116_0020790 Ga0496116_0020790_3808_4599 243
157 3300048920 Ga0496117_0028359 Ga0496117_0028359_3114_3905 243
158 3300048925 Ga0496122_0097477 Ga0496122_0097477_413_1204 243
159 3300053121 Ga0500607_036907 Ga0500607_036907_296_1087 243
160 iso_pu_bacteria 2599185214 2599624637 243
161 iso_pu_bacteria 2599185226 2599672501 243
162 iso_pu_bacteria 2599185227 2599683501 243
163 iso_pu_bacteria 2599185229 2599694110 243
164 iso_pu_bacteria 2643221628 2644163081 243
165 iso_pu_bacteria 2643221672 2644398512 243
166 iso_pu_bacteria 2643221683 2644468740 243
167 iso_pu_bacteria 2721755523 2722883408 243
168 iso_pu_bacteria 2738543013 2739249287 243
169 iso_pu_bacteria 2831265667 2831266816 243
170 iso_pu_bacteria 2838054893 2838056873 243
171 iso_pu_bacteria 2839138175 2839139184 243
172 iso_pu_bacteria 2842677519 2842682834 243
173 iso_pu_bacteria 2842733646 2842736879 243
174 iso_pu_bacteria 2842747753 2842747943 243
175 iso_pu_bacteria 2885192300 2885192947 243
176 iso_pu_bacteria 2885198086 2885201373 243
177 iso_pu_bacteria 2885211737 2885215047 243
178 iso_pu_bacteria 2899924645 2899925384 243
179 iso_pu_bacteria 2904449895 2904455384 243
180 iso_pu_bacteria 2904456579 2904460552 243
181 iso_pu_bacteria 2919462493 2919464340 243
182 iso_pu_bacteria 2928037797 2928038494 243
183 iso_pu_bacteria 2928044640 2928045901 243
184 iso_pu_bacteria 2928051484 2928053576 243
185 iso_pu_bacteria 2928064002 2928067123 243
186 iso_pu_bacteria 2928070936 2928070972 243
187 iso_pu_bacteria 2928084124 2928085076 243
188 iso_pu_bacteria 2929520902 2929524761 243
189 iso_pu_bacteria 2932422444 2932425117 243
190 iso_pu_bacteria 2945909444 2945912596 243
191 iso_pu_bacteria 2945945610 2945947175 243
192 iso_pu_bacteria 2945972063 2945976863 243
193 iso_pu_bacteria 2945984333 2945985118 243
194 3300006946 Ga0079104_1000007 Ga0079104_1000007308 244
195 3300009092 Ga0105250_10008095 Ga0105250_100080955 244
196 3300025711 Ga0207696_1008524 Ga0207696_10085245 244
197 3300027111 Ga0209281_1000020 Ga0209281_1000020190 244
198 3300050491 nmdc:mga00v17_56633_c1 nmdc:mga00v17_56633_c1_510_1289 244
199 iso_pu_bacteria 2547132374 2548497300 244
200 iso_pu_bacteria 2643221570 2643865694 244
201 iso_pu_bacteria 2643221596 2643992988 244
202 iso_pu_bacteria 2643221644 2644246061 244
203 iso_pu_bacteria 2643221717 2644647627 244
204 iso_pu_bacteria 2928115317 2928115918 244
205 iso_pu_bacteria 2954767861 2954771888 244
206 iso_pu_bacteria 2990710928 2990712589 244
207 3300005548 Ga0070665_100235242 Ga0070665_1002352422 245
208 3300028379 Ga0268266_10044152 Ga0268266_100441522 245
209 3300041494 Ga0451837_0482874 Ga0451837_0482874_470_1261 245
210 3300042125 Ga0450923_013140 Ga0450923_013140_667_1443 245
211 3300049663 Ga0501223_018646 Ga0501223_018646_520_1296 245
212 3300003316 rootH1_10001028 rootH1_1000102815 246
213 3300003322 rootL2_10001519 rootL2_1000151924 246
214 3300003771 Ga0055526_1001599 Ga0055526_10015997 246
215 3300003775 Ga0055524_1001433 Ga0055524_100143314 246
216 3300003794 Ga0055531_10002486 Ga0055531_1000248612 246
217 3300003794 Ga0055531_10008645 Ga0055531_100086453 246
218 3300005262 Ga0065165_1000411 Ga0065165_100041117 246
219 3300005262 Ga0065165_1000678 Ga0065165_100067821 246
220 3300006353 Ga0075370_10007965 Ga0075370_100079653 246
221 3300012497 Ga0157319_1000001 Ga0157319_1000001142 246
222 3300025273 Ga0209673_1004856 Ga0209673_10048563 246
223 3300025273 Ga0209673_1012799 Ga0209673_10127993 246
224 3300025295 Ga0209564_1000005 Ga0209564_1000005345 246
225 3300025299 Ga0209256_1002624 Ga0209256_10026243 246
226 3300025304 Ga0209257_1003449 Ga0209257_10034493 246
227 3300042127 Ga0450890_000224 Ga0450890_000224_6473_7264 246
228 3300042438 Ga0439459_0003865 Ga0439459_0003865_434_1225 246
229 3300044694 Ga0466963_0159900 Ga0466963_0159900_685_1476 246
230 3300048926 Ga0496123_0148788 Ga0496123_0148788_263_1069 246
231 3300049763 Ga0501266_000629 Ga0501266_000629_463_1263 246
232 3300050496 nmdc:mga07m45_43139_c1 nmdc:mga07m45_43139_c1_35_826 246
233 3300053156 Ga0500622_0044121 Ga0500622_0044121_398_1195 246
234 iso_pu_bacteria 2831864461 2831866656 246
235 iso_pu_bacteria 2886848708 2886854227 246
236 iso_pu_bacteria 2904541872 2904548488 246
237 iso_pu_bacteria 2929160207 2929163886 246
238 3300002774 JGI25150J39212_1002576 JGI25150J39212_10025762 247
239 3300003187 JGI25151J46595_10001321 JGI25151J46595_100013212 247
240 3300003316 rootH1_10048904 rootH1_100489042 247
241 3300003761 Ga0055535_1000415 Ga0055535_100041514 247
242 3300003762 Ga0055542_1000004 Ga0055542_1000004241 247
243 3300003771 Ga0055526_1023602 Ga0055526_10236022 247
244 3300003773 Ga0055537_1004447 Ga0055537_10044472 247
245 3300003781 Ga0055536_1006541 Ga0055536_10065415 247
246 3300003781 Ga0055536_1012920 Ga0055536_10129202 247
247 3300003781 Ga0055536_1023785 Ga0055536_10237852 247
248 3300003784 Ga0055534_1001640 Ga0055534_10016403 247
249 3300003784 Ga0055534_1024669 Ga0055534_10246691 247
250 3300003790 Ga0055528_1017834 Ga0055528_10178343 247
251 3300003791 Ga0055530_10005921 Ga0055530_100059215 247
252 3300003791 Ga0055530_10007077 Ga0055530_100070775 247
253 3300003792 Ga0055540_1005141 Ga0055540_10051415 247
254 3300003794 Ga0055531_10008075 Ga0055531_100080755 247
255 3300004625 Ga0055543_1006630 Ga0055543_10066302 247
256 3300005262 Ga0065165_1002672 Ga0065165_100267215 247
257 3300005262 Ga0065165_1020325 Ga0065165_10203252 247
258 3300005335 Ga0070666_10121973 Ga0070666_101219732 247
259 3300005347 Ga0070668_100213671 Ga0070668_1002136711 247
260 3300005353 Ga0070669_100037277 Ga0070669_1000372773 247
261 3300005367 Ga0070667_100108167 Ga0070667_1001081672 247
262 3300005539 Ga0068853_100083341 Ga0068853_1000833412 247
263 3300005548 Ga0070665_100831151 Ga0070665_1008311511 247
264 3300005578 Ga0068854_100469956 Ga0068854_1004699562 247
265 3300006177 Ga0075362_10011789 Ga0075362_100117892 247
266 3300006186 Ga0075369_10167205 Ga0075369_101672051 247
267 3300006353 Ga0075370_10016261 Ga0075370_100162612 247
268 3300006353 Ga0075370_10019300 Ga0075370_100193003 247
269 3300009036 Ga0105244_10016159 Ga0105244_100161592 247
270 3300009098 Ga0105245_10446131 Ga0105245_104461311 247
271 3300009176 Ga0105242_10266537 Ga0105242_102665372 247
272 3300013307 Ga0157372_10027907 Ga0157372_100279073 247
273 3300013308 Ga0157375_10383331 Ga0157375_103833312 247
274 3300014497 Ga0182008_10000325 Ga0182008_1000032539 247
275 3300014497 Ga0182008_10006300 Ga0182008_100063002 247
276 3300014497 Ga0182008_10016588 Ga0182008_100165882 247
277 3300014497 Ga0182008_10133612 Ga0182008_101336122 247
278 3300014969 Ga0157376_10263482 Ga0157376_102634822 247
279 3300015261 Ga0182006_1004384 Ga0182006_10043845 247
280 3300015262 Ga0182007_10005576 Ga0182007_100055762 247
281 3300015262 Ga0182007_10008200 Ga0182007_100082002 247
282 3300017792 Ga0163161_10140374 Ga0163161_101403743 247
283 3300025229 Ga0209147_101797 Ga0209147_1017974 247
284 3300025242 Ga0209258_100022 Ga0209258_100022241 247
285 3300025245 Ga0207425_1000138 Ga0207425_100013861 247
286 3300025245 Ga0207425_1005121 Ga0207425_10051212 247
287 3300025254 Ga0209148_1000034 Ga0209148_1000034241 247
288 3300025258 Ga0209129_1000023 Ga0209129_1000023322 247
289 3300025258 Ga0209129_1000558 Ga0209129_10005582 247
290 3300025258 Ga0209129_1004570 Ga0209129_10045705 247
291 3300025273 Ga0209673_1000673 Ga0209673_10006732 247
292 3300025273 Ga0209673_1021968 Ga0209673_10219682 247
293 3300025284 Ga0209130_1000222 Ga0209130_10002222 247
294 3300025284 Ga0209130_1001738 Ga0209130_100173811 247
295 3300025284 Ga0209130_1005769 Ga0209130_10057693 247
296 3300025291 Ga0209675_1000774 Ga0209675_10007743 247
297 3300025291 Ga0209675_1001282 Ga0209675_100128216 247
298 3300025291 Ga0209675_1003428 Ga0209675_10034281 247
299 3300025292 Ga0209676_1000005 Ga0209676_1000005479 247
300 3300025292 Ga0209676_1000437 Ga0209676_100043756 247
301 3300025292 Ga0209676_1009345 Ga0209676_10093454 247
302 3300025294 Ga0209025_1000157 Ga0209025_1000157156 247
303 3300025294 Ga0209025_1000476 Ga0209025_100047674 247
304 3300025294 Ga0209025_1001078 Ga0209025_100107812 247
305 3300025294 Ga0209025_1013875 Ga0209025_10138752 247
306 3300025294 Ga0209025_1014231 Ga0209025_10142313 247
307 3300025295 Ga0209564_1000400 Ga0209564_100040072 247
308 3300025295 Ga0209564_1000898 Ga0209564_100089838 247
309 3300025297 Ga0209758_1000064 Ga0209758_1000064223 247
310 3300025297 Ga0209758_1005231 Ga0209758_10052312 247
311 3300025298 Ga0209050_1000007 Ga0209050_1000007618 247
312 3300025298 Ga0209050_1007371 Ga0209050_10073715 247
313 3300025299 Ga0209256_1000038 Ga0209256_1000038344 247
314 3300025299 Ga0209256_1000115 Ga0209256_100011574 247
315 3300025302 Ga0207426_1000001 Ga0207426_10000011229 247
316 3300025302 Ga0207426_1000785 Ga0207426_100078533 247
317 3300025303 Ga0209051_1000009 Ga0209051_1000009479 247
318 3300025303 Ga0209051_1000312 Ga0209051_10003125 247
319 3300025303 Ga0209051_1005651 Ga0209051_10056513 247
320 3300025304 Ga0209257_1000011 Ga0209257_1000011453 247
321 3300025304 Ga0209257_1000508 Ga0209257_10005087 247
322 3300025304 Ga0209257_1006730 Ga0209257_10067305 247
323 3300025304 Ga0209257_1038125 Ga0209257_10381252 247
324 3300025728 Ga0207655_1005294 Ga0207655_10052943 247
325 3300025903 Ga0207680_10159574 Ga0207680_101595742 247
326 3300025920 Ga0207649_10246753 Ga0207649_102467532 247
327 3300025932 Ga0207690_10038816 Ga0207690_100388162 247
328 3300025933 Ga0207706_10022612 Ga0207706_100226122 247
329 3300025935 Ga0207709_10005685 Ga0207709_100056855 247
330 3300025945 Ga0207679_10004812 Ga0207679_100048122 247
331 3300026041 Ga0207639_10171379 Ga0207639_101713792 247
332 3300026121 Ga0207683_10161438 Ga0207683_101614382 247
333 3300028379 Ga0268266_10495353 Ga0268266_104953532 247
334 3300028380 Ga0268265_10039531 Ga0268265_100395312 247
335 3300028794 Ga0307515_10000028 Ga0307515_10000028207 247
336 3300028794 Ga0307515_10321074 Ga0307515_103210742 247
337 3300030745 Ga0316182_1097164 Ga0316182_10971645 247
338 3300031251 Ga0265327_10000465 Ga0265327_1000046516 247
339 3300031456 Ga0307513_10138097 Ga0307513_101380972 247
340 3300031901 Ga0307406_10129562 Ga0307406_101295622 247
341 3300041404 Ga0439436_0003545 Ga0439436_0003545_1752_2537 247
342 3300041405 Ga0439438_078237 Ga0439438_078237_10_795 247
343 3300041411 Ga0439466_0009825 Ga0439466_0009825_1534_2319 247
344 3300041413 Ga0439465_0003231 Ga0439465_0003231_4212_4997 247
345 3300041997 Ga0439431_0003929 Ga0439431_0003929_790_1575 247
346 3300041999 Ga0439433_0003432 Ga0439433_0003432_954_1739 247
347 3300042002 Ga0439442_026813 Ga0439442_026813_327_1112 247
348 3300042004 Ga0439445_0000484 Ga0439445_0000484_2382_3167 247
349 3300042006 Ga0439432_006219 Ga0439432_006219_1887_2672 247
350 3300042006 Ga0439432_016158 Ga0439432_016158_1526_2320 247
351 3300042007 Ga0439449_0002815 Ga0439449_0002815_1600_2385 247
352 3300042010 Ga0439452_003357 Ga0439452_003357_2513_3298 247
353 3300042014 Ga0439457_004303 Ga0439457_004303_1740_2525 247
354 3300042015 Ga0439462_0005502 Ga0439462_0005502_108_893 247
355 3300042125 Ga0450923_013286 Ga0450923_013286_390_1175 247
356 3300042156 Ga0439446_0002854 Ga0439446_0002854_25_810 247
357 3300042184 Ga0450908_009589 Ga0450908_009589_766_1551 247
358 3300042185 Ga0450909_005033 Ga0450909_005033_1025_1810 247
359 3300044683 Ga0466965_0009230 Ga0466965_0009230_1228_2013 247
360 3300046460 Ga0495638_0059636 Ga0495638_0059636_590_1375 247
361 3300046475 Ga0495639_0025315 Ga0495639_0025315_1240_2025 247
362 3300046512 Ga0495610_0055481 Ga0495610_0055481_993_1778 247
363 3300046513 Ga0495616_0008704 Ga0495616_0008704_949_1734 247
364 3300046514 Ga0495618_0173002 Ga0495618_0173002_239_1024 247
365 3300046517 Ga0495630_0131003 Ga0495630_0131003_867_1652 247
366 3300046518 Ga0495631_0001178 Ga0495631_0001178_13868_14653 247
367 3300046520 Ga0495637_0005753 Ga0495637_0005753_3984_4769 247
368 3300046530 Ga0495654_0026083 Ga0495654_0026083_364_1149 247
369 3300046538 Ga0495609_0171783 Ga0495609_0171783_64_849 247
370 3300046539 Ga0495621_0015668 Ga0495621_0015668_44_829 247
371 3300046542 Ga0495597_0000879 Ga0495597_0000879_11485_12246 247
372 3300046558 Ga0495633_0001060 Ga0495633_0001060_9903_10667 247
373 3300046615 Ga0495656_0000542 Ga0495656_0000542_2376_3161 247
374 3300046660 Ga0495625_0025827 Ga0495625_0025827_2370_3155 247
375 3300046660 Ga0495625_0228248 Ga0495625_0228248_187_972 247
376 3300046674 Ga0495588_0026670 Ga0495588_0026670_1736_2521 247
377 3300046810 Ga0495660_0073182 Ga0495660_0073182_222_1007 247
378 3300047315 Ga0495581_0162416 Ga0495581_0162416_237_1022 247
379 3300047321 Ga0495676_0044129 Ga0495676_0044129_30_815 247
380 3300048905 Ga0496102_0004209 Ga0496102_0004209_69_854 247
381 3300048906 Ga0496103_0110325 Ga0496103_0110325_817_1602 247
382 3300048910 Ga0496107_0408800 Ga0496107_0408800_36_821 247
383 3300048912 Ga0496109_0091763 Ga0496109_0091763_793_1578 247
384 3300048914 Ga0496111_0095089 Ga0496111_0095089_1341_2126 247
385 3300048917 Ga0496114_0138972 Ga0496114_0138972_785_1570 247
386 3300048919 Ga0496116_0058937 Ga0496116_0058937_1403_2188 247
387 3300048920 Ga0496117_0075329 Ga0496117_0075329_798_1583 247
388 3300048921 Ga0496118_0018200 Ga0496118_0018200_4257_5042 247
389 3300048922 Ga0496119_0053780 Ga0496119_0053780_836_1621 247
390 3300048924 Ga0496121_0080557 Ga0496121_0080557_1019_1804 247
391 3300048925 Ga0496122_0002198 Ga0496122_0002198_9073_9858 247
392 3300048926 Ga0496123_0000314 Ga0496123_0000314_22016_22801 247
393 3300048927 Ga0496124_0031381 Ga0496124_0031381_3218_4003 247
394 3300048928 Ga0496125_0073286 Ga0496125_0073286_1234_2019 247
395 3300048928 Ga0496125_0094485 Ga0496125_0094485_59_844 247
396 3300050493 nmdc:mga0k408_273065_c1 nmdc:mga0k408_273065_c1_196_981 247
397 3300050496 nmdc:mga07m45_16246_c1 nmdc:mga07m45_16246_c1_195_980 247
398 3300050496 nmdc:mga07m45_30261_c1 nmdc:mga07m45_30261_c1_1681_2466 247
399 3300050496 nmdc:mga07m45_8752_c1 nmdc:mga07m45_8752_c1_341_1126 247
400 3300050516 nmdc:mga0sz30_106392_c1 nmdc:mga0sz30_106392_c1_155_940 247
401 3300053079 Ga0500610_0024518 Ga0500610_0024518_142_927 247
402 3300053079 Ga0500610_0031891 Ga0500610_0031891_1840_2625 247
403 3300053079 Ga0500610_0146678 Ga0500610_0146678_64_849 247
404 3300053090 Ga0500646_0011901 Ga0500646_0011901_557_1342 247
405 3300053093 Ga0500651_0000241 Ga0500651_0000241_14699_15484 247
406 3300053110 Ga0500571_000069 Ga0500571_000069_30227_31012 247
407 3300053116 Ga0500592_003579 Ga0500592_003579_714_1499 247
408 3300053118 Ga0500594_0012587 Ga0500594_0012587_831_1616 247
409 3300053121 Ga0500607_038246 Ga0500607_038246_614_1399 247
410 3300053122 Ga0500608_010729 Ga0500608_010729_1604_2389 247
411 3300053125 Ga0500618_037729 Ga0500618_037729_148_933 247
412 3300053134 Ga0500658_0002458 Ga0500658_0002458_250_1035 247
413 3300053134 Ga0500658_0005974 Ga0500658_0005974_1240_2025 247
414 3300053136 Ga0500559_0001438 Ga0500559_0001438_4518_5303 247
415 3300053136 Ga0500559_0014314 Ga0500559_0014314_2343_3128 247
416 3300053137 Ga0500561_0025150 Ga0500561_0025150_386_1171 247
417 3300053138 Ga0500564_040369 Ga0500564_040369_256_1041 247
418 3300053153 Ga0500616_0028437 Ga0500616_0028437_1161_1946 247
419 3300053177 Ga0500636_0161860 Ga0500636_0161860_368_1153 247
420 iso_pu_bacteria 2738541307 2738881628 247
421 3300005339 Ga0070660_100102728 Ga0070660_1001027282 248
422 3300005344 Ga0070661_100001073 Ga0070661_10000107316 248
423 3300005366 Ga0070659_100003401 Ga0070659_1000034018 248
424 3300005564 Ga0070664_100012577 Ga0070664_1000125772 248
425 3300025919 Ga0207657_10118904 Ga0207657_101189042 248
426 3300025920 Ga0207649_10001812 Ga0207649_100018123 248
427 3300025932 Ga0207690_10004966 Ga0207690_100049668 248
428 3300025945 Ga0207679_10000351 Ga0207679_1000035116 248
429 3300042121 Ga0450919_000146 Ga0450919_000146_5867_6613 248
430 3300042531 Ga0450918_000032 Ga0450918_000032_9317_10063 248
431 3300048904 Ga0496101_0297006 Ga0496101_0297006_149_1018 248
432 3300003775 Ga0055524_1000045 Ga0055524_10000452 249
433 3300003791 Ga0055530_10006293 Ga0055530_100062932 249
434 3300003792 Ga0055540_1000002 Ga0055540_100000279 249
435 3300006946 Ga0079104_1000970 Ga0079104_100097018 249
436 3300025263 Ga0209565_1040263 Ga0209565_10402631 249
437 3300025291 Ga0209675_1008986 Ga0209675_10089864 249
438 3300025298 Ga0209050_1000997 Ga0209050_100099720 249
439 3300025298 Ga0209050_1019252 Ga0209050_10192523 249
440 3300025299 Ga0209256_1000143 Ga0209256_1000143149 249
441 3300025303 Ga0209051_1000024 Ga0209051_100002480 249
442 3300025304 Ga0209257_1000079 Ga0209257_100007980 249
443 3300027111 Ga0209281_1000993 Ga0209281_100099318 249
444 3300048917 Ga0496114_0136239 Ga0496114_0136239_1341_2099 249
445 3300002773 JGI25152J39213_1003000 JGI25152J39213_10030002 250
446 3300002774 JGI25150J39212_1013022 JGI25150J39212_10130222 250
447 3300003215 JGI25153J46596_10010262 JGI25153J46596_100102622 250
448 3300003771 Ga0055526_1005531 Ga0055526_10055312 250
449 3300025245 Ga0207425_1000226 Ga0207425_100022631 250
450 3300025258 Ga0209129_1000012 Ga0209129_1000012391 250
451 3300025263 Ga0209565_1015175 Ga0209565_10151752 250
452 3300025273 Ga0209673_1006626 Ga0209673_10066262 250
453 3300025295 Ga0209564_1000022 Ga0209564_1000022123 250
454 3300025297 Ga0209758_1000099 Ga0209758_1000099126 250
455 3300025299 Ga0209256_1009961 Ga0209256_10099612 250
456 3300025304 Ga0209257_1007332 Ga0209257_10073323 250
457 3300001979 JGI24740J21852_10005208 JGI24740J21852_100052082 252

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17773

UPF0176_N

UPF0176 acylphosphatase like domain

65

156

0.98

PF00581

Rhodanese

Rhodanese-like domain

171

278

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4f67-assembly1.cif.gz_A three dimensional structure of the double mutant of upf0176 protein lpg2838 from legionella pneumophila at the resolution 1.8a, northeast structural genomics consortium (nesg) target lgr82 0.8959 1 252
4f67-assembly1.cif.gz_A three dimensional structure of the double mutant of upf0176 protein lpg2838 from legionella pneumophila at the resolution 1.8a, northeast structural genomics consortium (nesg) target lgr82 0.8791 1 252
5ve4-assembly1.cif.gz_A crystal structure of persulfide dioxygenase-rhodanese fusion protein with rhodanese domain inactivating mutation (c314s) from burkholderia phytofirmans 0.8415 116 221
5ve5-assembly3.cif.gz_C crystal structure of persulfide dioxygenase rhodanese fusion protein with rhodanese domain inactivating mutation (c314s) from burkholderia phytofirmans in complex with glutathione 0.8192 116 221
3tp9-assembly1.cif.gz_B crystal structure of alicyclobacillus acidocaldarius protein with beta-lactamase and rhodanese domains 0.8185 114 223
ID Description Score Start End Superfamily
af_Q2FUS7_1_95_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.975 8 100 3.30.70.100
af_Q2FUS7_1_95_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9452 8 100 3.30.70.100
af_F4I933_72_176_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9245 1 100 3.30.70.100
4f67A01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9191 1 100 3.30.70.100
af_Q2FUS7_100_247_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.914 109 242 3.40.250.10
ID Description Score Start End GO Terms
AF-A0A2E2BUE8-F1-model_v4 tRNA uridine(34) hydroxylase N-terminal domain-containing protein 0.9817 6 96
AF-A0A6P0S8X5-F1-model_v4 tRNA uridine(34) hydroxylase N-terminal domain-containing protein 0.9769 7 100
AF-A0A352RTD6-F1-model_v4 Sulfurtransferase 0.9757 7 183 GO:0008033
GO:0016740
AF-A0A359E2M1-F1-model_v4 Rhodanese domain-containing protein 0.9755 8 101
AF-A0A258TLS1-F1-model_v4 deleted 0.9716 6 83

Feature Viewer

pLDDT pTM Quality
87.01 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map