F447856

General Info

Members Datasets Scaffolds Average Seq Length
456 385 266 276

Family's Representative Sequence

Representative Sequence 3300046524|Ga0495648_0004419|Ga0495648_0004419_1816_2724
Length 273
Sequence MKPIDMAIAPAAGVAAKPAPAPREATPAQRAWRRLARRRGAMVGLCIVLLFIAVALCAPWLSSHDPLETSWSAVRKAPSLEFLFGTDELGRDVLSRVLWGSRASLLVGFLSVCIMLAVPFLILAIALAAFLGPNLTNVMIALGVSATPVFIRLTRAQVLAVKVEDFIEAARAIGNPHWRIALRHVLPNILPPLIVQSTLAIAAAIIAEASLSFLGLGQQPPAPSWGSMLNTAKNYVDTAPWMAIWPGLSIFLLVVSLNLLGDGLRDAFDPRHK

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
6 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
9 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
10 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
11 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
12 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
13 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
14 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
15 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
16 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
17 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
18 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
19 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
20 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
21 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
22 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
23 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
24 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
25 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
26 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
27 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
28 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
29 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
30 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
31 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
32 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
33 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
34 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
35 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
36 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
37 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
38 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
39 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
40 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
41 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
42 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
43 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
44 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
45 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
46 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
47 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
48 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
49 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
50 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
51 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
52 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
53 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
54 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
55 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
56 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
57 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
58 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
59 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
60 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
61 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
62 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
63 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
64 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
65 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
66 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
67 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
68 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
69 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
70 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
71 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
72 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
73 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
74 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
75 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
76 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
77 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
78 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
79 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
80 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
81 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
82 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
83 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
84 2904699407
85 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
86 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
87 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
88 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
89 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
90 2922368715
91 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
92 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
93 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
94 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
95 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
96 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
97 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
98 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
99 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
100 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
101 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
102 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
103 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
104 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
105 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
106 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
107 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
108 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
109 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
110 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
111 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
112 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
113 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
114 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
115 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
116 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
117 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
118 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
119 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
120 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
121 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
122 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
123 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
124 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
125 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
126 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
127 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
128 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
129 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
130 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
131 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
132 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
133 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
134 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
135 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
136 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
137 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
138 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
139 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
140 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
141 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
142 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
143 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
144 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
145 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
146 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
147 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
148 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
149 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
150 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
151 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
152 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
153 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
154 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
155 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
156 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
157 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
158 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
159 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
160 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
161 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
162 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
163 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
164 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
165 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
166 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
167 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
168 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
169 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
170 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
171 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
172 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
173 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
174 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
175 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
176 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
177 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
178 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
179 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
180 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
181 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
182 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
183 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
184 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
185 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
186 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
187 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
188 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
189 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
190 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
191 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
192 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
193 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
194 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
195 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
196 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
197 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
198 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
199 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
200 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
201 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
202 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
203 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
204 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
205 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
206 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
207 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
208 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
209 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
210 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
211 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
212 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
213 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
214 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
215 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
216 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
217 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
218 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
219 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
220 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
221 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
222 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
223 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
224 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
225 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
226 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
227 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
228 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
256 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
257 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
260 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
261 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
262 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
263 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
264 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
265 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
266 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
267 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
268 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
269 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
270 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
271 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
272 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
273 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
274 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
275 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
276 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
277 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
278 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
279 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
280 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
281 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
282 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
283 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
284 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
285 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
286 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
287 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
288 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
289 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
290 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
291 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
292 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
293 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
294 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
295 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
296 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
297 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
298 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
299 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
300 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
301 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
302 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
303 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
304 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
305 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
306 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
307 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
308 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
309 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
310 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
311 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
312 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
313 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
314 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
315 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
316 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
317 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
318 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
319 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
323 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
324 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
325 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
326 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
327 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
328 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
329 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
330 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
331 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
332 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
333 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
334 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
335 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
336 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
337 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
338 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
339 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
340 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
341 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
342 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
343 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
344 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
345 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
346 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
347 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
348 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
349 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
350 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
351 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
352 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
353 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
354 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
355 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
356 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
357 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
358 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
359 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
360 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
361 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
362 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
363 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
364 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
365 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
366 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
367 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
368 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
369 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
370 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
371 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
372 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
373 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
374 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
375 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
376 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
377 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
378 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
379 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
380 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
381 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
382 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
383 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
384 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
385 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 58.37
Metatranscriptomes 0.22
Isolates 41.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.5
Nodule 31.8
Rhizoplane 2.41
Rhizosphere 40.35
Stem 0
Stem Tuber 0
Unclassified 12.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000760 3300003215 Bacteria 19717
2 JGI25153J46596_10000877 3300003215 Bacteria 18294
3 JGI25153J46596_10019594 3300003215 Bacteria 2585
4 JGI25153J46596_10051299 3300003215 Bacteria 1182
5 Ga0055526_1043102 3300003771 Bacteria 1103
6 Ga0055531_10008482 3300003794 Bacteria 5406
7 Ga0055543_1003596 3300004625 Bacteria 4486
8 Ga0065165_1001109 3300005262 Bacteria 31984
9 Ga0065165_1003331 3300005262 Bacteria 11467
10 Ga0070680_100019044 3300005336 Bacteria 5434
11 Ga0070660_100091175 3300005339 Bacteria 2403
12 Ga0070668_100181863 3300005347 Bacteria 1718
13 Ga0070675_100004724 3300005354 Bacteria 10399
14 Ga0070673_100081857 3300005364 Bacteria 2619
15 Ga0070688_100207448 3300005365 Bacteria 1374
16 Ga0070709_10039581 3300005434 Bacteria 2893
17 Ga0070714_100015922 3300005435 Bacteria 6062
18 Ga0070713_100046776 3300005436 Bacteria 3552
19 Ga0070713_100119724 3300005436 Bacteria 2307
20 Ga0070713_100390706 3300005436 Bacteria 1298
21 Ga0070710_10000563 3300005437 Bacteria 17589
22 Ga0070710_10002066 3300005437 Bacteria 9519
23 Ga0070711_100003535 3300005439 Bacteria 9118
24 Ga0070711_100008566 3300005439 Bacteria 6270
25 Ga0070711_100021774 3300005439 Bacteria 4148
26 Ga0070694_100278309 3300005444 Bacteria 1275
27 Ga0070663_100012711 3300005455 Bacteria 5335
28 Ga0070681_10100010 3300005458 Bacteria 2846
29 Ga0070681_10243081 3300005458 Bacteria 1713
30 Ga0068867_100230778 3300005459 Bacteria 1496
31 Ga0070706_100104449 3300005467 Bacteria 2635
32 Ga0070706_100135302 3300005467 Bacteria 2300
33 Ga0070706_100171887 3300005467 Bacteria 2023
34 Ga0070707_100276324 3300005468 Bacteria 1633
35 Ga0070698_100007157 3300005471 Bacteria 12085
36 Ga0070698_100200715 3300005471 Bacteria 1930
37 Ga0070699_100059929 3300005518 Bacteria 3297
38 Ga0070699_100088369 3300005518 Bacteria 2707
39 Ga0070679_100012943 3300005530 Bacteria 7990
40 Ga0070697_100064313 3300005536 Bacteria 2996
41 Ga0070672_100308052 3300005543 Bacteria 1344
42 Ga0070696_100006222 3300005546 Bacteria 7986
43 Ga0070704_100001415 3300005549 Bacteria 12797
44 Ga0070704_100251893 3300005549 Bacteria 1451
45 Ga0068854_100075579 3300005578 Bacteria 2474
46 Ga0068852_100030016 3300005616 Bacteria 4471
47 Ga0068859_100113446 3300005617 Bacteria 2774
48 Ga0068860_100011848 3300005843 Bacteria 8596
49 Ga0081455_10005455 3300005937 Bacteria 13944
50 Ga0081455_10022971 3300005937 Bacteria 5815
51 Ga0081455_10061217 3300005937 Bacteria 3168
52 Ga0081455_10080137 3300005937 Bacteria 2678
53 Ga0081540_1007318 3300005983 Bacteria 7895
54 Ga0081540_1022502 3300005983 Bacteria 3722
55 Ga0081540_1026695 3300005983 Bacteria 3289
56 Ga0081540_1030953 3300005983 Bacteria 2954
57 Ga0081540_1039406 3300005983 Bacteria 2477
58 Ga0081539_10015887 3300005985 Bacteria 5428
59 Ga0081539_10114956 3300005985 Bacteria 1347
60 Ga0070717_10015121 3300006028 Bacteria 5952
61 Ga0070717_10350013 3300006028 Bacteria 1321
62 Ga0075365_10079657 3300006038 Bacteria 2216
63 Ga0075363_100000758 3300006048 Bacteria 11048
64 Ga0075363_100007464 3300006048 Bacteria 5029
65 Ga0070715_10036170 3300006163 Bacteria 2035
66 Ga0070716_100037973 3300006173 Bacteria 2664
67 Ga0070716_100125743 3300006173 Bacteria 1612
68 Ga0070716_100274008 3300006173 Bacteria 1161
69 Ga0070712_100115143 3300006175 Bacteria 2014
70 Ga0075367_10004010 3300006178 Bacteria 7116
71 Ga0075367_10006544 3300006178 Bacteria 5896
72 Ga0075370_10106295 3300006353 Bacteria 1627
73 Ga0075428_100109381 3300006844 Bacteria 3011
74 Ga0075428_100299956 3300006844 Bacteria 1727
75 Ga0075430_100205546 3300006846 Bacteria 1634
76 Ga0075436_100017070 3300006914 Bacteria 4968
77 Ga0075436_100270852 3300006914 Bacteria 1213
78 Ga0097620_100113446 3300006931 Bacteria 2774
79 Ga0099824_1008285 3300006942 Bacteria 13360
80 Ga0075435_100432535 3300007076 Bacteria 1134
81 Ga0105240_10363191 3300009093 Bacteria 1639
82 Ga0105241_10051818 3300009174 Bacteria 3131
83 Ga0105248_10672932 3300009177 Bacteria 1168
84 Ga0157370_10175258 3300013104 Bacteria 1993
85 Ga0157376_10008801 3300014969 Bacteria 7305
86 Ga0157376_10046807 3300014969 Bacteria 3569
87 Ga0206353_10073811 3300020082 Bacteria 1833
88 Ga0214544_1000001 3300021320 Bacteria 783667
89 Ga0214542_1000037 3300021321 Bacteria 159256
90 Ga0214545_1000003 3300021324 Bacteria 720274
91 Ga0214543_1000002 3300021327 Bacteria 712733
92 Ga0213876_10001415 3300021384 Bacteria 14934
93 Ga0213875_10000863 3300021388 Bacteria 22384
94 Ga0209563_105270 3300025230 Bacteria 2367
95 Ga0209677_101767 3300025253 Bacteria 8941
96 Ga0209564_1023123 3300025295 Bacteria 2170
97 Ga0209758_1000011 3300025297 Bacteria 1049685
98 Ga0209758_1000133 3300025297 Bacteria 182442
99 Ga0209758_1020930 3300025297 Bacteria 3070
100 Ga0209758_1031141 3300025297 Bacteria 2194
101 Ga0209758_1074197 3300025297 Bacteria 1056
102 Ga0209256_1013198 3300025299 Bacteria 3084
103 Ga0207426_1000292 3300025302 Bacteria 99342
104 Ga0209257_1001242 3300025304 Bacteria 31529
105 Ga0207692_10002769 3300025898 Bacteria 6761
106 Ga0207692_10004847 3300025898 Bacteria 5354
107 Ga0207685_10052332 3300025905 Bacteria 1582
108 Ga0207685_10056706 3300025905 Bacteria 1534
109 Ga0207699_10000503 3300025906 Bacteria 19503
110 Ga0207684_10113320 3300025910 Bacteria 2321
111 Ga0207654_10013638 3300025911 Bacteria 4183
112 Ga0207707_10100017 3300025912 Bacteria 2534
113 Ga0207707_10148315 3300025912 Bacteria 2051
114 Ga0207695_10255079 3300025913 Bacteria 1653
115 Ga0207693_10147523 3300025915 Bacteria 1850
116 Ga0207663_10000145 3300025916 Bacteria 32751
117 Ga0207663_10001800 3300025916 Bacteria 10116
118 Ga0207660_10353806 3300025917 Bacteria 1177
119 Ga0207657_10198537 3300025919 Bacteria 1615
120 Ga0207650_10107204 3300025925 Bacteria 2158
121 Ga0207659_10057130 3300025926 Bacteria 2797
122 Ga0207700_10014825 3300025928 Bacteria 5119
123 Ga0207700_10023976 3300025928 Bacteria 4217
124 Ga0207700_10033782 3300025928 Bacteria 3663
125 Ga0207700_10214057 3300025928 Bacteria 1631
126 Ga0207664_10007702 3300025929 Bacteria 7473
127 Ga0207664_10152029 3300025929 Bacteria 1967
128 Ga0207690_10057852 3300025932 Bacteria 2621
129 Ga0207709_10379886 3300025935 Bacteria 1075
130 Ga0207704_10356388 3300025938 Bacteria 1141
131 Ga0207665_10000339 3300025939 Bacteria 32422
132 Ga0207665_10004748 3300025939 Bacteria 9032
133 Ga0207665_10086432 3300025939 Bacteria 2166
134 Ga0207667_10409920 3300025949 Bacteria 1379
135 Ga0207668_10131560 3300025972 Bacteria 1911
136 Ga0207668_10344537 3300025972 Bacteria 1244
137 Ga0207640_10064642 3300025981 Bacteria 2437
138 Ga0207703_10104525 3300026035 Bacteria 2406
139 Ga0207678_10005195 3300026067 Bacteria 11665
140 Ga0207648_10135879 3300026089 Bacteria 2166
141 Ga0207674_10118892 3300026116 Bacteria 2612
142 Ga0207698_10050935 3300026142 Bacteria 3163
143 Ga0209999_1004898 3300027543 Bacteria 2407
144 Ga0209983_1020988 3300027665 Bacteria 1364
145 Ga0268266_10001272 3300028379 Bacteria 30802
146 Ga0268266_10193209 3300028379 Bacteria 1859
147 Ga0268264_10079168 3300028381 Bacteria 2803
148 Ga0265337_1015065 3300028556 Bacteria 2543
149 Ga0265334_10001453 3300028573 Bacteria 11387
150 Ga0265318_10006369 3300028577 Bacteria 5444
151 Ga0265323_10000660 3300028653 Bacteria 18837
152 Ga0265336_10000251 3300028666 Bacteria 38092
153 Ga0265338_10000582 3300028800 Bacteria 64301
154 Ga0265340_10032171 3300031247 Bacteria 2620
155 Ga0265339_10001676 3300031249 Bacteria 16377
156 Ga0307416_100036950 3300032002 Bacteria 3753
157 Ga0373937_0050843 3300036401 Bacteria 3798
158 Ga0373937_0126111 3300036401 Bacteria 2388
159 Ga0373925_0046572 3300037068 Bacteria 3225
160 Ga0395899_0182213 3300037312 Bacteria 1474
161 Ga0395898_0028503 3300037466 Bacteria 5594
162 Ga0395898_0203182 3300037466 Bacteria 1891
163 Ga0395905_0006970 3300037471 Bacteria 11299
164 Ga0436364_0067731 3300037853 Bacteria 42277
165 Ga0436364_0607465 3300037853 Bacteria 39411
166 Ga0436364_1345479 3300037853 Bacteria 2525
167 Ga0395901_0001685 3300038443 Bacteria 22813
168 Ga0395901_0057151 3300038443 Bacteria 4058
169 Ga0395901_0109738 3300038443 Bacteria 2897
170 Ga0395901_0146691 3300038443 Bacteria 2480
171 Ga0436365_1033619 3300039437 Bacteria 1487
172 Ga0436365_1268687 3300039437 Bacteria 27308
173 Ga0436361_0694707 3300039447 Bacteria 2533
174 Ga0436361_0894493 3300039447 Bacteria 4870
175 Ga0436363_0193758 3300039450 Bacteria 2104
176 Ga0436363_1193646 3300039450 Bacteria 2142
177 Ga0436363_1369604 3300039450 Bacteria 1028
178 Ga0439444_0014587 3300042437 Bacteria 1316
179 Ga0451577_0130494 3300042876 Bacteria 2254
180 Ga0466969_0054232 3300044656 Bacteria 1964
181 Ga0466972_0000134 3300044658 Bacteria 61802
182 Ga0466977_0001021 3300044666 Bacteria 10804
183 Ga0466968_0005831 3300044735 Bacteria 4623
184 Ga0466970_0033330 3300044765 Bacteria 2723
185 Ga0466960_0049705 3300044901 Bacteria 2019
186 Ga0451576_0031006 3300045051 Bacteria 5703
187 Ga0451576_0128140 3300045051 Bacteria 2645
188 Ga0495603_0018342 3300046455 Bacteria 4233
189 Ga0495603_0054268 3300046455 Bacteria 2376
190 Ga0495638_0025069 3300046460 Bacteria 3881
191 Ga0495651_0000998 3300046462 Bacteria 21934
192 Ga0495628_0005175 3300046516 Bacteria 11465
193 Ga0495632_0002439 3300046519 Bacteria 14152
194 Ga0495648_0001886 3300046524 Bacteria 20051
195 Ga0495648_0004419 3300046524 Bacteria 12013
196 Ga0495652_0004620 3300046529 Bacteria 13125
197 Ga0495587_0006032 3300046536 Bacteria 7901
198 Ga0495645_0064118 3300046543 Bacteria 2659
199 Ga0495667_0011108 3300046559 Bacteria 6091
200 Ga0495656_0017709 3300046615 Bacteria 2723
201 Ga0495635_0014679 3300046663 Bacteria 5480
202 Ga0495659_0029355 3300046664 Bacteria 1909
203 Ga0495657_0014031 3300046675 Bacteria 5885
204 Ga0495599_0049293 3300046678 Bacteria 2640
205 Ga0495623_0001347 3300046679 Bacteria 16654
206 Ga0495600_0000687 3300046809 Bacteria 17682
207 Ga0495604_0001854 3300047317 Bacteria 17233
208 Ga0495636_0053850 3300047318 Bacteria 1690
209 Ga0495674_0013469 3300047319 Bacteria 7691
210 Ga0495680_0003079 3300047322 Bacteria 16606
211 Ga0495675_0010128 3300047444 Bacteria 5881
212 Ga0495684_0264662 3300047471 Bacteria 1246
213 Ga0495602_0020844 3300048088 Bacteria 6469
214 Ga0496101_0252167 3300048904 Bacteria 1375
215 Ga0496109_0047887 3300048912 Bacteria 3888
216 Ga0496110_0168799 3300048913 Bacteria 1985
217 Ga0496110_0257096 3300048913 Bacteria 1590
218 Ga0496112_0019321 3300048915 Bacteria 6429
219 Ga0496112_0103143 3300048915 Bacteria 2822
220 Ga0496113_0014530 3300048916 Bacteria 5375
221 Ga0496113_0056824 3300048916 Bacteria 2939
222 Ga0496115_0145897 3300048918 Bacteria 1953
223 Ga0496115_0225180 3300048918 Bacteria 1547
224 Ga0496121_0001183 3300048924 Bacteria 45653
225 Ga0496126_0141399 3300048929 Bacteria 2071
226 Ga0501041_0086116 3300049577 Bacteria 1938
227 Ga0501042_0029249 3300049578 Bacteria 3886
228 Ga0501042_0107005 3300049578 Bacteria 2013
229 Ga0501046_0140995 3300049580 Bacteria 1824
230 Ga0501067_0043562 3300049583 Bacteria 2493
231 Ga0501075_0264986 3300049591 Bacteria 1310
232 Ga0501045_0314293 3300049824 Bacteria 1166
233 nmdc:mga03n38_183_c1 3300050490 Bacteria 14091
234 nmdc:mga0yw44_34894_c1 3300050492 Bacteria 2951
235 nmdc:mga06z11_1814_c2 3300050494 Bacteria 5926
236 nmdc:mga06z11_2153_c1 3300050494 Bacteria 7477
237 nmdc:mga07m45_4511_c1 3300050496 Bacteria 6816
238 nmdc:mga0rr50_191332_c1 3300050513 Bacteria 1677
239 nmdc:mga0rr50_238076_c1 3300050513 Bacteria 1508
240 nmdc:mga08x19_325959_c1 3300050514 Bacteria 1069
241 Ga0500581_174495 3300053089 Bacteria 983
242 Ga0500651_0186650 3300053093 Bacteria 1229
243 Ga0500566_0000354 3300053094 Bacteria 24973
244 Ga0500640_000915 3300053095 Bacteria 8261
245 Ga0500557_000003 3300053105 Bacteria 228429
246 Ga0500572_000481 3300053111 Bacteria 13815
247 Ga0500595_003774 3300053119 Bacteria 6972
248 Ga0500608_002109 3300053122 Bacteria 7135
249 Ga0500614_003256 3300053123 Bacteria 3514
250 Ga0500628_000502 3300053129 Bacteria 7278
251 Ga0500642_0000051 3300053130 Bacteria 77123
252 Ga0500642_0010051 3300053130 Bacteria 3319
253 Ga0500652_000095 3300053131 Bacteria 36952
254 Ga0500658_0074032 3300053134 Bacteria 1443
255 Ga0500559_0058327 3300053136 Bacteria 1716
256 Ga0500568_0000847 3300053139 Bacteria 21511
257 Ga0500568_0010884 3300053139 Bacteria 4242
258 Ga0500568_0059307 3300053139 Bacteria 1485
259 Ga0500590_010285 3300053148 Bacteria 4723
260 Ga0500603_000314 3300053150 Bacteria 12721
261 Ga0500622_0000139 3300053156 Bacteria 77751
262 Ga0500630_038407 3300053159 Bacteria 2338
263 Ga0500638_051437 3300053162 Bacteria 1992
264 Ga0500639_000357 3300053163 Bacteria 22540
265 Ga0500625_001859 3300053729 Bacteria 7563
266 Ga0500601_000035 3300053737 Bacteria 28001

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038443 Ga0395901_0001685 Ga0395901_0001685_1085_1972 225
2 3300037853 Ga0436364_1345479 Ga0436364_1345479_599_1384 229
3 3300039437 Ga0436365_1033619 Ga0436365_1033619_16_801 229
4 3300045051 Ga0451576_0128140 Ga0451576_0128140_1411_2292 237
5 3300005339 Ga0070660_100091175 Ga0070660_1000911751 239
6 3300005616 Ga0068852_100030016 Ga0068852_1000300164 239
7 3300006173 Ga0070716_100125743 Ga0070716_1001257432 239
8 3300025919 Ga0207657_10198537 Ga0207657_101985372 239
9 3300025932 Ga0207690_10057852 Ga0207690_100578523 239
10 3300025949 Ga0207667_10409920 Ga0207667_104099202 239
11 3300026142 Ga0207698_10050935 Ga0207698_100509353 239
12 3300044656 Ga0466969_0054232 Ga0466969_0054232_816_1736 239
13 3300044666 Ga0466977_0001021 Ga0466977_0001021_8772_9692 239
14 3300048913 Ga0496110_0257096 Ga0496110_0257096_235_1119 239
15 3300048915 Ga0496112_0103143 Ga0496112_0103143_119_1003 239
16 3300048916 Ga0496113_0056824 Ga0496113_0056824_675_1559 239
17 3300005444 Ga0070694_100278309 Ga0070694_1002783092 240
18 3300005468 Ga0070707_100276324 Ga0070707_1002763243 240
19 3300005518 Ga0070699_100088369 Ga0070699_1000883692 240
20 3300005536 Ga0070697_100064313 Ga0070697_1000643133 240
21 3300005546 Ga0070696_100006222 Ga0070696_1000062223 240
22 3300006173 Ga0070716_100274008 Ga0070716_1002740082 240
23 3300006914 Ga0075436_100017070 Ga0075436_1000170702 240
24 3300049577 Ga0501041_0086116 Ga0501041_0086116_795_1661 241
25 3300049578 Ga0501042_0107005 Ga0501042_0107005_1029_1895 241
26 3300049580 Ga0501046_0140995 Ga0501046_0140995_750_1616 241
27 3300006178 Ga0075367_10004010 Ga0075367_100040102 244
28 3300050494 nmdc:mga06z11_2153_c1 nmdc:mga06z11_2153_c1_1157_2044 244
29 3300006844 Ga0075428_100109381 Ga0075428_1001093814 246
30 3300049591 Ga0501075_0264986 Ga0501075_0264986_14_931 247
31 3300005467 Ga0070706_100135302 Ga0070706_1001353023 248
32 3300005471 Ga0070698_100007157 Ga0070698_1000071579 248
33 3300025910 Ga0207684_10113320 Ga0207684_101133203 248
34 3300038443 Ga0395901_0146691 Ga0395901_0146691_1474_2349 248
35 3300037068 Ga0373925_0046572 Ga0373925_0046572_1346_2218 249
36 3300046460 Ga0495638_0025069 Ga0495638_0025069_1861_2739 249
37 3300046519 Ga0495632_0002439 Ga0495632_0002439_1609_2487 249
38 3300049578 Ga0501042_0029249 Ga0501042_0029249_240_1112 249
39 3300049824 Ga0501045_0314293 Ga0501045_0314293_48_920 249
40 3300053129 Ga0500628_000502 Ga0500628_000502_5973_6851 249
41 3300053130 Ga0500642_0010051 Ga0500642_0010051_973_1851 249
42 3300053131 Ga0500652_000095 Ga0500652_000095_22820_23698 249
43 3300053139 Ga0500568_0010884 Ga0500568_0010884_1882_2760 249
44 3300053156 Ga0500622_0000139 Ga0500622_0000139_22845_23723 249
45 3300005937 Ga0081455_10005455 Ga0081455_100054557 251
46 3300021388 Ga0213875_10000863 Ga0213875_100008634 251
47 3300028556 Ga0265337_1015065 Ga0265337_10150652 251
48 3300028573 Ga0265334_10001453 Ga0265334_100014534 251
49 3300028577 Ga0265318_10006369 Ga0265318_100063692 251
50 3300028653 Ga0265323_10000660 Ga0265323_100006605 251
51 3300028666 Ga0265336_10000251 Ga0265336_1000025118 251
52 3300028800 Ga0265338_10000582 Ga0265338_1000058218 251
53 3300037853 Ga0436364_0607465 Ga0436364_0607465_17130_18023 251
54 3300045051 Ga0451576_0031006 Ga0451576_0031006_3783_4664 251
55 3300005617 Ga0068859_100113446 Ga0068859_1001134463 252
56 3300005843 Ga0068860_100011848 Ga0068860_1000118483 252
57 3300006931 Ga0097620_100113446 Ga0097620_1001134462 252
58 3300025972 Ga0207668_10344537 Ga0207668_103445371 252
59 3300026089 Ga0207648_10135879 Ga0207648_101358792 252
60 3300028381 Ga0268264_10079168 Ga0268264_100791682 252
61 3300039450 Ga0436363_1193646 Ga0436363_1193646_987_1868 252
62 3300005336 Ga0070680_100019044 Ga0070680_1000190444 253
63 3300005467 Ga0070706_100171887 Ga0070706_1001718872 253
64 3300005471 Ga0070698_100200715 Ga0070698_1002007151 253
65 3300005518 Ga0070699_100059929 Ga0070699_1000599291 253
66 3300005549 Ga0070704_100001415 Ga0070704_1000014155 253
67 3300006844 Ga0075428_100299956 Ga0075428_1002999561 253
68 3300006846 Ga0075430_100205546 Ga0075430_1002055462 253
69 3300009174 Ga0105241_10051818 Ga0105241_100518183 253
70 3300014969 Ga0157376_10008801 Ga0157376_100088015 253
71 3300020082 Ga0206353_10073811 Ga0206353_100738112 253
72 3300025911 Ga0207654_10013638 Ga0207654_100136381 253
73 3300027543 Ga0209999_1004898 Ga0209999_10048983 253
74 3300027665 Ga0209983_1020988 Ga0209983_10209882 253
75 3300032002 Ga0307416_100036950 Ga0307416_1000369502 253
76 3300039447 Ga0436361_0894493 Ga0436361_0894493_1041_1925 253
77 3300039450 Ga0436363_0193758 Ga0436363_0193758_1041_1937 253
78 3300046615 Ga0495656_0017709 Ga0495656_0017709_1084_1971 253
79 3300053089 Ga0500581_174495 Ga0500581_174495_64_951 253
80 3300005467 Ga0070706_100104449 Ga0070706_1001044492 254
81 3300005549 Ga0070704_100251893 Ga0070704_1002518931 254
82 3300005578 Ga0068854_100075579 Ga0068854_1000755792 254
83 3300006048 Ga0075363_100007464 Ga0075363_1000074645 254
84 3300025981 Ga0207640_10064642 Ga0207640_100646422 254
85 3300039447 Ga0436361_0694707 Ga0436361_0694707_540_1430 254
86 3300047318 Ga0495636_0053850 Ga0495636_0053850_508_1389 254
87 iso_pu_bacteria 2883577096 2883578421 254
88 iso_pu_bacteria 2894772417 2894772707 254
89 3300005347 Ga0070668_100181863 Ga0070668_1001818632 255
90 3300005354 Ga0070675_100004724 Ga0070675_1000047242 255
91 3300005364 Ga0070673_100081857 Ga0070673_1000818573 255
92 3300005937 Ga0081455_10061217 Ga0081455_100612173 255
93 3300006914 Ga0075436_100270852 Ga0075436_1002708522 255
94 3300007076 Ga0075435_100432535 Ga0075435_1004325351 255
95 3300025915 Ga0207693_10147523 Ga0207693_101475231 255
96 3300025925 Ga0207650_10107204 Ga0207650_101072044 255
97 3300025926 Ga0207659_10057130 Ga0207659_100571302 255
98 3300025972 Ga0207668_10131560 Ga0207668_101315601 255
99 3300026035 Ga0207703_10104525 Ga0207703_101045252 255
100 3300028379 Ga0268266_10193209 Ga0268266_101932092 255
101 3300036401 Ga0373937_0126111 Ga0373937_0126111_463_1335 255
102 3300037853 Ga0436364_0067731 Ga0436364_0067731_9022_9900 255
103 3300042437 Ga0439444_0014587 Ga0439444_0014587_294_1184 255
104 3300049583 Ga0501067_0043562 Ga0501067_0043562_818_1705 255
105 3300050513 nmdc:mga0rr50_191332_c1 nmdc:mga0rr50_191332_c1_76_954 255
106 3300053139 Ga0500568_0059307 Ga0500568_0059307_579_1466 255
107 iso_pu_bacteria 2842922631 2842925319 255
108 3300005434 Ga0070709_10039581 Ga0070709_100395811 256
109 3300005435 Ga0070714_100015922 Ga0070714_1000159225 256
110 3300005436 Ga0070713_100119724 Ga0070713_1001197243 256
111 3300005437 Ga0070710_10002066 Ga0070710_100020663 256
112 3300005439 Ga0070711_100008566 Ga0070711_1000085663 256
113 3300005983 Ga0081540_1030953 Ga0081540_10309532 256
114 3300006028 Ga0070717_10015121 Ga0070717_100151214 256
115 3300006163 Ga0070715_10036170 Ga0070715_100361701 256
116 3300006175 Ga0070712_100115143 Ga0070712_1001151432 256
117 3300014969 Ga0157376_10046807 Ga0157376_100468074 256
118 3300025898 Ga0207692_10004847 Ga0207692_100048475 256
119 3300025905 Ga0207685_10052332 Ga0207685_100523321 256
120 3300025916 Ga0207663_10000145 Ga0207663_1000014526 256
121 3300025928 Ga0207700_10033782 Ga0207700_100337822 256
122 3300025929 Ga0207664_10007702 Ga0207664_100077025 256
123 3300025939 Ga0207665_10000339 Ga0207665_1000033929 256
124 3300026116 Ga0207674_10118892 Ga0207674_101188923 256
125 3300046524 Ga0495648_0004419 Ga0495648_0004419_1816_2724 256
126 iso_pu_bacteria 2524023205 2524436194 256
127 iso_pu_bacteria 2744054633 2745080850 256
128 iso_pu_bacteria 8019629233 8019633213 256
129 3300005436 Ga0070713_100046776 Ga0070713_1000467763 257
130 3300005437 Ga0070710_10000563 Ga0070710_100005635 257
131 3300005439 Ga0070711_100003535 Ga0070711_1000035357 257
132 3300005459 Ga0068867_100230778 Ga0068867_1002307782 257
133 3300006028 Ga0070717_10350013 Ga0070717_103500132 257
134 3300006173 Ga0070716_100037973 Ga0070716_1000379733 257
135 3300021384 Ga0213876_10001415 Ga0213876_1000141510 257
136 3300025898 Ga0207692_10002769 Ga0207692_100027692 257
137 3300025905 Ga0207685_10056706 Ga0207685_100567062 257
138 3300025906 Ga0207699_10000503 Ga0207699_1000050316 257
139 3300025916 Ga0207663_10001800 Ga0207663_100018008 257
140 3300025928 Ga0207700_10014825 Ga0207700_100148253 257
141 3300025939 Ga0207665_10004748 Ga0207665_100047482 257
142 3300039437 Ga0436365_1268687 Ga0436365_1268687_13726_14616 257
143 3300046455 Ga0495603_0018342 Ga0495603_0018342_2314_3201 257
144 iso_pu_bacteria 2513237094 2513636779 257
145 iso_pu_bacteria 2824600985 2824605179 257
146 iso_pu_bacteria 2824609381 2824615499 257
147 iso_pu_bacteria 2824653114 2824656386 257
148 iso_pu_bacteria 2844315083 2844320112 257
149 iso_pu_bacteria 2847930680 2847937406 257
150 iso_pu_bacteria 2857509624 2857512692 257
151 iso_pu_bacteria 2874612657 2874614487 257
152 iso_pu_bacteria 2879083081 2879086707 257
153 iso_pu_bacteria 2881364244 2881371378 257
154 iso_pu_bacteria 2888419890 2888425668 257
155 iso_pu_bacteria 2903727486 2903730214 257
156 iso_pu_bacteria 2904699407 2904701157 257
157 iso_pu_bacteria 2906602504 2906609937 257
158 iso_pu_bacteria 2906643746 2906647377 257
159 iso_pu_bacteria 3005594810 3005600398 257
160 iso_pu_bacteria 3005718088 3005723247 257
161 iso_pu_bacteria 8019648815 8019649451 257
162 3300005458 Ga0070681_10100010 Ga0070681_101000105 258
163 3300025912 Ga0207707_10148315 Ga0207707_101483151 258
164 3300042876 Ga0451577_0130494 Ga0451577_0130494_183_1067 258
165 3300044735 Ga0466968_0005831 Ga0466968_0005831_2695_3579 258
166 3300044901 Ga0466960_0049705 Ga0466960_0049705_860_1744 258
167 3300050513 nmdc:mga0rr50_238076_c1 nmdc:mga0rr50_238076_c1_255_1145 258
168 3300050514 nmdc:mga08x19_325959_c1 nmdc:mga08x19_325959_c1_64_954 258
169 iso_pu_bacteria 2507262055 2507507577 258
170 iso_pu_bacteria 2508501009 2508541696 258
171 iso_pu_bacteria 2508501128 2509152973 258
172 iso_pu_bacteria 2511231028 2511398554 258
173 iso_pu_bacteria 2513237092 2513621778 258
174 iso_pu_bacteria 2513237095 2513647600 258
175 iso_pu_bacteria 2513237102 2513701401 258
176 iso_pu_bacteria 2513237104 2513720756 258
177 iso_pu_bacteria 2513237139 2513878727 258
178 iso_pu_bacteria 2513237141 2513891173 258
179 iso_pu_bacteria 2513237145 2513918513 258
180 iso_pu_bacteria 2513237161 2514009345 258
181 iso_pu_bacteria 2515154112 2515626159 258
182 iso_pu_bacteria 2517093001 2517104244 258
183 iso_pu_bacteria 2524023228 2524533554 258
184 iso_pu_bacteria 2528768022 2528848894 258
185 iso_pu_bacteria 2617270735 2617346882 258
186 iso_pu_bacteria 2617270741 2617372813 258
187 iso_pu_bacteria 2667528175 2671123782 258
188 iso_pu_bacteria 2728368998 2728749949 258
189 iso_pu_bacteria 2791355196 2793060960 258
190 iso_pu_bacteria 2791355197 2793066606 258
191 iso_pu_bacteria 2802429603 2805921376 258
192 iso_pu_bacteria 2816332527 2818236636 258
193 iso_pu_bacteria 2824617872 2824620504 258
194 iso_pu_bacteria 2824626560 2824628448 258
195 iso_pu_bacteria 2824635225 2824637148 258
196 iso_pu_bacteria 2824661429 2824669927 258
197 iso_pu_bacteria 2824671348 2824673686 258
198 iso_pu_bacteria 2824679649 2824685150 258
199 iso_pu_bacteria 2824687955 2824690653 258
200 iso_pu_bacteria 2824696289 2824700836 258
201 iso_pu_bacteria 2824704595 2824709910 258
202 iso_pu_bacteria 2824732956 2824738151 258
203 iso_pu_bacteria 2824746037 2824748779 258
204 iso_pu_bacteria 2824753945 2824756067 258
205 iso_pu_bacteria 2824763712 2824767605 258
206 iso_pu_bacteria 2824773399 2824775041 258
207 iso_pu_bacteria 2838122688 2838129304 258
208 iso_pu_bacteria 2841941048 2841948039 258
209 iso_pu_bacteria 2841949485 2841953563 258
210 iso_pu_bacteria 2841957949 2841962839 258
211 iso_pu_bacteria 2841966195 2841973032 258
212 iso_pu_bacteria 2841974524 2841978291 258
213 iso_pu_bacteria 2841983080 2841990510 258
214 iso_pu_bacteria 2842038055 2842040734 258
215 iso_pu_bacteria 2842045827 2842046320 258
216 iso_pu_bacteria 2847939898 2847947830 258
217 iso_pu_bacteria 2849076700 2849078312 258
218 iso_pu_bacteria 2874590934 2874598693 258
219 iso_pu_bacteria 2874620515 2874628162 258
220 iso_pu_bacteria 2874628541 2874634921 258
221 iso_pu_bacteria 2874645413 2874652148 258
222 iso_pu_bacteria 2876761206 2876768172 258
223 iso_pu_bacteria 2876771140 2876778732 258
224 iso_pu_bacteria 2876818435 2876824373 258
225 iso_pu_bacteria 2879074833 2879082525 258
226 iso_pu_bacteria 2879099564 2879107796 258
227 iso_pu_bacteria 2879127579 2879131442 258
228 iso_pu_bacteria 2879142872 2879147888 258
229 iso_pu_bacteria 2881665667 2881666668 258
230 iso_pu_bacteria 2885366525 2885370049 258
231 iso_pu_bacteria 2885374607 2885382858 258
232 iso_pu_bacteria 2885409591 2885415648 258
233 iso_pu_bacteria 2888378607 2888385537 258
234 iso_pu_bacteria 2904666416 2904674220 258
235 iso_pu_bacteria 2904711408 2904711888 258
236 iso_pu_bacteria 2908739725 2908741581 258
237 iso_pu_bacteria 2908775508 2908781258 258
238 iso_pu_bacteria 2922368715 2922372318 258
239 iso_pu_bacteria 2922393267 2922396993 258
240 iso_pu_bacteria 2929615660 2929621110 258
241 iso_pu_bacteria 2929624759 2929626059 258
242 iso_pu_bacteria 2932784394 2932785067 258
243 iso_pu_bacteria 2932809354 2932810095 258
244 iso_pu_bacteria 2932818245 2932821669 258
245 iso_pu_bacteria 2932828146 2932828903 258
246 iso_pu_bacteria 2933577622 2933583020 258
247 iso_pu_bacteria 2935608549 2935609915 258
248 iso_pu_bacteria 2935616580 2935619677 258
249 iso_pu_bacteria 2935630451 2935636139 258
250 iso_pu_bacteria 2935638405 2935638657 258
251 iso_pu_bacteria 2935648319 2935652055 258
252 iso_pu_bacteria 2935656913 2935659972 258
253 iso_pu_bacteria 2935665750 2935666491 258
254 iso_pu_bacteria 2935675223 2935676466 258
255 iso_pu_bacteria 2935684952 2935691018 258
256 iso_pu_bacteria 2935694250 2935694548 258
257 iso_pu_bacteria 2935703347 2935703663 258
258 iso_pu_bacteria 2935713505 2935718399 258
259 iso_pu_bacteria 2935722832 2935727621 258
260 iso_pu_bacteria 2935732158 2935736324 258
261 iso_pu_bacteria 2935741537 2935745704 258
262 iso_pu_bacteria 2935750917 2935756085 258
263 iso_pu_bacteria 2935760218 2935760655 258
264 iso_pu_bacteria 2935769743 2935776074 258
265 iso_pu_bacteria 2935777560 2935783467 258
266 iso_pu_bacteria 2935785616 2935791913 258
267 iso_pu_bacteria 2935793552 2935800277 258
268 iso_pu_bacteria 2935801545 2935801801 258
269 iso_pu_bacteria 2935810662 2935814784 258
270 iso_pu_bacteria 2935819856 2935823075 258
271 iso_pu_bacteria 2935827899 2935828151 258
272 iso_pu_bacteria 2935837841 2935842356 258
273 iso_pu_bacteria 2935847175 2935848657 258
274 iso_pu_bacteria 2935855204 2935858008 258
275 iso_pu_bacteria 2935864058 2935867912 258
276 iso_pu_bacteria 2935873716 2935874064 258
277 iso_pu_bacteria 2935908558 2935909537 258
278 iso_pu_bacteria 2935916978 2935917261 258
279 iso_pu_bacteria 2935926038 2935927018 258
280 iso_pu_bacteria 2935934488 2935937138 258
281 iso_pu_bacteria 2935942939 2935944559 258
282 iso_pu_bacteria 2935951376 2935952996 258
283 iso_pu_bacteria 2935959822 2935962801 258
284 iso_pu_bacteria 2935967501 2935969836 258
285 iso_pu_bacteria 2935975950 2935976433 258
286 iso_pu_bacteria 2935984226 2935987117 258
287 iso_pu_bacteria 2935992306 2935993011 258
288 iso_pu_bacteria 2936002035 2936002923 258
289 iso_pu_bacteria 2936011229 2936014388 258
290 iso_pu_bacteria 2936019824 2936023772 258
291 iso_pu_bacteria 2936028420 2936031415 258
292 iso_pu_bacteria 2936037263 2936040573 258
293 iso_pu_bacteria 2936046547 2936049494 258
294 iso_pu_bacteria 2936055302 2936062244 258
295 iso_pu_bacteria 2940556831 2940561940 258
296 iso_pu_bacteria 2941507105 2941512770 258
297 iso_pu_bacteria 2941515067 2941520663 258
298 iso_pu_bacteria 2941523033 2941528677 258
299 iso_pu_bacteria 2941531003 2941531294 258
300 iso_pu_bacteria 2941538514 2941542405 258
301 iso_pu_bacteria 3005474847 3005481352 258
302 iso_pu_bacteria 3005483717 3005485487 258
303 iso_pu_bacteria 3005587118 3005588146 258
304 iso_pu_bacteria 3005710791 3005715890 258
305 iso_pu_bacteria 8006926726 8006928919 258
306 iso_pu_bacteria 8006933436 8006939357 258
307 iso_pu_bacteria 8006973647 8006979013 258
308 iso_pu_bacteria 8016511872 8016520562 258
309 iso_pu_bacteria 8016522445 8016528599 258
310 iso_pu_bacteria 8016530956 8016533768 258
311 iso_pu_bacteria 8016539877 8016546986 258
312 iso_pu_bacteria 8016548790 8016555127 258
313 iso_pu_bacteria 8016557553 8016563490 258
314 iso_pu_bacteria 8016566248 8016572101 258
315 iso_pu_bacteria 8016575299 8016576300 258
316 iso_pu_bacteria 8016595262 8016601237 258
317 iso_pu_bacteria 8016603502 8016609202 258
318 iso_pu_bacteria 8016613128 8016615701 258
319 iso_pu_bacteria 8016622563 8016625523 258
320 iso_pu_bacteria 8017057580 8017065015 258
321 iso_pu_bacteria 8019530166 8019533542 258
322 iso_pu_bacteria 8019538911 8019546133 258
323 iso_pu_bacteria 8019547302 8019552576 258
324 iso_pu_bacteria 8019555841 8019565227 258
325 iso_pu_bacteria 8019576017 8019584395 258
326 iso_pu_bacteria 8019586578 8019592166 258
327 iso_pu_bacteria 8019597564 8019599112 258
328 iso_pu_bacteria 8019608314 8019609244 258
329 iso_pu_bacteria 8019619141 8019619902 258
330 iso_pu_bacteria 8019668869 8019670643 258
331 iso_pu_bacteria 8019678201 8019685589 258
332 iso_pu_bacteria 8019687851 8019691158 258
333 iso_pu_bacteria 8055742211 8055745027 258
334 iso_pu_bacteria 8056967851 8056974982 258
335 3300005436 Ga0070713_100390706 Ga0070713_1003907061 259
336 3300005543 Ga0070672_100308052 Ga0070672_1003080521 259
337 3300025928 Ga0207700_10214057 Ga0207700_102140571 259
338 3300025929 Ga0207664_10152029 Ga0207664_101520292 259
339 3300025935 Ga0207709_10379886 Ga0207709_103798861 259
340 3300037312 Ga0395899_0182213 Ga0395899_0182213_396_1283 259
341 3300037466 Ga0395898_0028503 Ga0395898_0028503_88_975 259
342 3300037471 Ga0395905_0006970 Ga0395905_0006970_4031_4915 259
343 3300038443 Ga0395901_0057151 Ga0395901_0057151_847_1734 259
344 3300038443 Ga0395901_0109738 Ga0395901_0109738_1872_2756 259
345 3300048912 Ga0496109_0047887 Ga0496109_0047887_1197_2084 259
346 3300048913 Ga0496110_0168799 Ga0496110_0168799_310_1197 259
347 3300048915 Ga0496112_0019321 Ga0496112_0019321_5252_6139 259
348 3300048916 Ga0496113_0014530 Ga0496113_0014530_3566_4453 259
349 3300003215 JGI25153J46596_10000877 JGI25153J46596_1000087711 260
350 3300003215 JGI25153J46596_10019594 JGI25153J46596_100195941 260
351 3300003771 Ga0055526_1043102 Ga0055526_10431021 260
352 3300003794 Ga0055531_10008482 Ga0055531_100084823 260
353 3300005262 Ga0065165_1003331 Ga0065165_10033315 260
354 3300005937 Ga0081455_10080137 Ga0081455_100801373 260
355 3300005983 Ga0081540_1026695 Ga0081540_10266953 260
356 3300025253 Ga0209677_101767 Ga0209677_1017673 260
357 3300025295 Ga0209564_1023123 Ga0209564_10231232 260
358 3300025297 Ga0209758_1000011 Ga0209758_1000011411 260
359 3300025297 Ga0209758_1031141 Ga0209758_10311412 260
360 3300025299 Ga0209256_1013198 Ga0209256_10131981 260
361 3300025302 Ga0207426_1000292 Ga0207426_100029282 260
362 3300025304 Ga0209257_1001242 Ga0209257_100124225 260
363 3300044658 Ga0466972_0000134 Ga0466972_0000134_46179_47066 260
364 3300044765 Ga0466970_0033330 Ga0466970_0033330_11_898 260
365 3300048929 Ga0496126_0141399 Ga0496126_0141399_889_1776 260
366 3300053093 Ga0500651_0186650 Ga0500651_0186650_232_1119 260
367 3300053737 Ga0500601_000035 Ga0500601_000035_20888_21775 260
368 3300005455 Ga0070663_100012711 Ga0070663_1000127113 261
369 3300005937 Ga0081455_10022971 Ga0081455_100229714 261
370 3300005983 Ga0081540_1007318 Ga0081540_10073183 261
371 3300005983 Ga0081540_1022502 Ga0081540_10225023 261
372 3300005983 Ga0081540_1039406 Ga0081540_10394063 261
373 3300006048 Ga0075363_100000758 Ga0075363_1000007583 261
374 3300006178 Ga0075367_10006544 Ga0075367_100065443 261
375 3300006353 Ga0075370_10106295 Ga0075370_101062952 261
376 3300006942 Ga0099824_1008285 Ga0099824_10082859 261
377 3300013104 Ga0157370_10175258 Ga0157370_101752582 261
378 3300025297 Ga0209758_1074197 Ga0209758_10741972 261
379 3300025928 Ga0207700_10023976 Ga0207700_100239761 261
380 3300026067 Ga0207678_10005195 Ga0207678_100051957 261
381 3300028379 Ga0268266_10001272 Ga0268266_1000127225 261
382 3300036401 Ga0373937_0050843 Ga0373937_0050843_1317_2204 261
383 3300037466 Ga0395898_0203182 Ga0395898_0203182_878_1768 261
384 3300046664 Ga0495659_0029355 Ga0495659_0029355_354_1241 261
385 3300048924 Ga0496121_0001183 Ga0496121_0001183_28680_29567 261
386 3300050490 nmdc:mga03n38_183_c1 nmdc:mga03n38_183_c1_9176_10063 261
387 3300050494 nmdc:mga06z11_1814_c2 nmdc:mga06z11_1814_c2_2790_3677 261
388 3300050496 nmdc:mga07m45_4511_c1 nmdc:mga07m45_4511_c1_5619_6506 261
389 3300053105 Ga0500557_000003 Ga0500557_000003_126266_127153 261
390 3300053119 Ga0500595_003774 Ga0500595_003774_31_918 261
391 3300053130 Ga0500642_0000051 Ga0500642_0000051_53201_54088 261
392 3300053729 Ga0500625_001859 Ga0500625_001859_4761_5648 261
393 3300003215 JGI25153J46596_10000760 JGI25153J46596_100007609 262
394 3300003215 JGI25153J46596_10051299 JGI25153J46596_100512991 262
395 3300004625 Ga0055543_1003596 Ga0055543_10035964 262
396 3300005262 Ga0065165_1001109 Ga0065165_100110910 262
397 3300005365 Ga0070688_100207448 Ga0070688_1002074482 262
398 3300005439 Ga0070711_100021774 Ga0070711_1000217742 262
399 3300005458 Ga0070681_10243081 Ga0070681_102430812 262
400 3300005530 Ga0070679_100012943 Ga0070679_1000129436 262
401 3300005985 Ga0081539_10015887 Ga0081539_100158874 262
402 3300005985 Ga0081539_10114956 Ga0081539_101149562 262
403 3300006038 Ga0075365_10079657 Ga0075365_100796572 262
404 3300009093 Ga0105240_10363191 Ga0105240_103631912 262
405 3300009177 Ga0105248_10672932 Ga0105248_106729321 262
406 3300021320 Ga0214544_1000001 Ga0214544_1000001677 262
407 3300021321 Ga0214542_1000037 Ga0214542_100003762 262
408 3300021324 Ga0214545_1000003 Ga0214545_100000383 262
409 3300021327 Ga0214543_1000002 Ga0214543_1000002682 262
410 3300025230 Ga0209563_105270 Ga0209563_1052702 262
411 3300025297 Ga0209758_1000133 Ga0209758_1000133141 262
412 3300025297 Ga0209758_1020930 Ga0209758_10209303 262
413 3300025912 Ga0207707_10100017 Ga0207707_101000172 262
414 3300025913 Ga0207695_10255079 Ga0207695_102550792 262
415 3300025917 Ga0207660_10353806 Ga0207660_103538061 262
416 3300025938 Ga0207704_10356388 Ga0207704_103563881 262
417 3300025939 Ga0207665_10086432 Ga0207665_100864322 262
418 3300031247 Ga0265340_10032171 Ga0265340_100321712 262
419 3300031249 Ga0265339_10001676 Ga0265339_100016763 262
420 3300039450 Ga0436363_1369604 Ga0436363_1369604_122_1015 262
421 3300046455 Ga0495603_0054268 Ga0495603_0054268_356_1243 262
422 3300046462 Ga0495651_0000998 Ga0495651_0000998_7318_8205 262
423 3300046516 Ga0495628_0005175 Ga0495628_0005175_35_922 262
424 3300046524 Ga0495648_0001886 Ga0495648_0001886_11732_12628 262
425 3300046529 Ga0495652_0004620 Ga0495652_0004620_1715_2602 262
426 3300046536 Ga0495587_0006032 Ga0495587_0006032_6381_7268 262
427 3300046543 Ga0495645_0064118 Ga0495645_0064118_650_1537 262
428 3300046559 Ga0495667_0011108 Ga0495667_0011108_2176_3063 262
429 3300046663 Ga0495635_0014679 Ga0495635_0014679_3408_4295 262
430 3300046675 Ga0495657_0014031 Ga0495657_0014031_719_1606 262
431 3300046678 Ga0495599_0049293 Ga0495599_0049293_241_1128 262
432 3300046679 Ga0495623_0001347 Ga0495623_0001347_3552_4439 262
433 3300046809 Ga0495600_0000687 Ga0495600_0000687_11729_12616 262
434 3300047317 Ga0495604_0001854 Ga0495604_0001854_12207_13094 262
435 3300047319 Ga0495674_0013469 Ga0495674_0013469_696_1583 262
436 3300047322 Ga0495680_0003079 Ga0495680_0003079_1734_2621 262
437 3300047444 Ga0495675_0010128 Ga0495675_0010128_4413_5300 262
438 3300047471 Ga0495684_0264662 Ga0495684_0264662_316_1203 262
439 3300048088 Ga0495602_0020844 Ga0495602_0020844_1749_2636 262
440 3300048904 Ga0496101_0252167 Ga0496101_0252167_311_1198 262
441 3300048918 Ga0496115_0145897 Ga0496115_0145897_588_1475 262
442 3300048918 Ga0496115_0225180 Ga0496115_0225180_18_911 262
443 3300050492 nmdc:mga0yw44_34894_c1 nmdc:mga0yw44_34894_c1_267_1154 262
444 3300053094 Ga0500566_0000354 Ga0500566_0000354_280_1170 262
445 3300053095 Ga0500640_000915 Ga0500640_000915_4269_5159 262
446 3300053111 Ga0500572_000481 Ga0500572_000481_5397_6287 262
447 3300053122 Ga0500608_002109 Ga0500608_002109_3107_3997 262
448 3300053123 Ga0500614_003256 Ga0500614_003256_2352_3242 262
449 3300053134 Ga0500658_0074032 Ga0500658_0074032_17_907 262
450 3300053136 Ga0500559_0058327 Ga0500559_0058327_417_1307 262
451 3300053139 Ga0500568_0000847 Ga0500568_0000847_750_1640 262
452 3300053148 Ga0500590_010285 Ga0500590_010285_2383_3273 262
453 3300053150 Ga0500603_000314 Ga0500603_000314_10631_11521 262
454 3300053159 Ga0500630_038407 Ga0500630_038407_155_1045 262
455 3300053162 Ga0500638_051437 Ga0500638_051437_433_1323 262
456 3300053163 Ga0500639_000357 Ga0500639_000357_11020_11910 262

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12911

OppC_N

N-terminal TM domain of oligopeptide transport permease C

26

78

0.94

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

73

273

0.93

Feature Viewer

pLDDT pTM Quality
69.47 0.4 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map