F447772

General Info

Members Datasets Scaffolds Average Seq Length
456 217 912 279

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10055412|Ga0157370_100554124
Length 331
Sequence LLAALALRNEETPEVGHIRLGKFSAEAIEPALMKPDLLAHAPSLADTLRHFYGRGMDSLVSTDWLAQHLGEPHLAVVDSTWFMPASGRNGRQEYLQAHIPGARFLDIDELSDHSNPAPHMLPTAAEFGSAMGRLGIDRDDRIVVYDNSPIHTAARGWFTLRHFGASKVAVLDGGLPKWIAEGRPTESGEAPQRPARFEANESRDVVDKQQILGGPGCALVDARGKGRFEASEPEPRPEVAGGHIPGARNLPFGQLYNEDGTFKSRAELRRLFGEVGIDPSQPFIASCGSGVTATSLIFAAHLLGSDAGRLYDGSWTEWGSDPATPKATGPA

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
78 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
79 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
128 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
129 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
137 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
138 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
139 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
140 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
141 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
142 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
143 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
148 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
149 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
150 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
151 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
152 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
153 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
154 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
164 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
165 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
166 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
167 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
183 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
184 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
185 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
186 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
187 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
188 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
189 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
190 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
191 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
192 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
195 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
202 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
203 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
204 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
205 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
208 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
209 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
210 2534681786 Brucella suis 92/29 Isolate Unclassified
211 2751185800 Brucella pituitosa AA2 Isolate Unclassified
212 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
213 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
214 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
215 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
216 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
217 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.03
Metatranscriptomes 0.22
Isolates 1.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.88
Nodule 0.22
Rhizoplane 2.19
Rhizosphere 93.42
Stem 0
Stem Tuber 0
Unclassified 1.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10055412 3300013104 Bacteria 3777
2 JGI24741J21665_1011303 3300001915 Bacteria 1564
3 JGI24740J21852_10047530 3300001979 Bacteria 1252
4 JGI24740J21852_10053956 3300001979 Bacteria 1137
5 JGI24739J22299_10003381 3300001989 Bacteria 6090
6 JGI24737J22298_10004992 3300001990 Bacteria 4599
7 JGI24735J21928_10018688 3300002067 Bacteria 2136
8 JGI24735J21928_10052122 3300002067 Bacteria 1180
9 JGI24738J21930_10002673 3300002075 Bacteria 4593
10 Ga0070658_10000405 3300005327 Bacteria 37355
11 Ga0070658_10001600 3300005327 Bacteria 19143
12 Ga0070658_10021747 3300005327 Bacteria 5141
13 Ga0070658_10051374 3300005327 Bacteria 3341
14 Ga0070658_10059774 3300005327 Bacteria 3104
15 Ga0070658_10068747 3300005327 Bacteria 2896
16 Ga0070676_10023968 3300005328 Bacteria 3434
17 Ga0070683_100002224 3300005329 Bacteria 15369
18 Ga0070683_100048226 3300005329 Bacteria 3937
19 Ga0070683_100461764 3300005329 Bacteria 1212
20 Ga0070670_100011322 3300005331 Bacteria 7623
21 Ga0070670_100013086 3300005331 Bacteria 7107
22 Ga0068869_100036241 3300005334 Bacteria 3502
23 Ga0070666_10003536 3300005335 Bacteria 9473
24 Ga0070680_100028742 3300005336 Bacteria 4461
25 Ga0070682_100024645 3300005337 Bacteria 3583
26 Ga0070682_100133878 3300005337 Bacteria 1681
27 Ga0068868_100315428 3300005338 Bacteria 1331
28 Ga0070660_100000194 3300005339 Bacteria 40512
29 Ga0070660_100001048 3300005339 Bacteria 18599
30 Ga0070660_100275109 3300005339 Bacteria 1377
31 Ga0070660_100448062 3300005339 Bacteria 1071
32 Ga0070691_10115360 3300005341 Bacteria 1347
33 Ga0070661_100000157 3300005344 Bacteria 55418
34 Ga0070661_100064080 3300005344 Bacteria 2701
35 Ga0070661_100100359 3300005344 Bacteria 2152
36 Ga0070661_100253618 3300005344 Bacteria 1358
37 Ga0070661_100315993 3300005344 Unclassified 1219
38 Ga0070668_100023575 3300005347 Bacteria 4656
39 Ga0070668_100336752 3300005347 Bacteria 1274
40 Ga0070669_100075270 3300005353 Bacteria 2503
41 Ga0070671_100017860 3300005355 Bacteria 5751
42 Ga0070671_100018970 3300005355 Bacteria 5593
43 Ga0070671_100044776 3300005355 Bacteria 3677
44 Ga0070671_100068727 3300005355 Bacteria 2955
45 Ga0070674_100164837 3300005356 Bacteria 1685
46 Ga0070673_100113785 3300005364 Bacteria 2247
47 Ga0070659_100000086 3300005366 Bacteria 70060
48 Ga0070659_100011858 3300005366 Bacteria 6451
49 Ga0070659_100017336 3300005366 Bacteria 5417
50 Ga0070659_100078064 3300005366 Bacteria 2641
51 Ga0070659_100387789 3300005366 Bacteria 1177
52 Ga0070659_100660692 3300005366 Bacteria 902
53 Ga0070667_100010080 3300005367 Bacteria 7823
54 Ga0070667_100017151 3300005367 Bacteria 5997
55 Ga0070667_100130886 3300005367 Bacteria 2190
56 Ga0070667_100606757 3300005367 Bacteria 1008
57 Ga0070713_100031108 3300005436 Bacteria 4247
58 Ga0070708_100004430 3300005445 Bacteria 11034
59 Ga0070708_100061118 3300005445 Bacteria 3364
60 Ga0070663_100053553 3300005455 Bacteria 2881
61 Ga0070663_100128672 3300005455 Bacteria 1920
62 Ga0070678_100185527 3300005456 Bacteria 1706
63 Ga0070678_100225816 3300005456 Bacteria 1559
64 Ga0070662_100000640 3300005457 Bacteria 21171
65 Ga0070662_100014749 3300005457 Bacteria 5223
66 Ga0068867_100221945 3300005459 Bacteria 1524
67 Ga0070679_100083970 3300005530 Bacteria 3173
68 Ga0070679_100099289 3300005530 Bacteria 2898
69 Ga0070679_100189627 3300005530 Bacteria 2025
70 Ga0070684_100013895 3300005535 Bacteria 6504
71 Ga0070684_100066115 3300005535 Bacteria 3174
72 Ga0070684_100451147 3300005535 Bacteria 1189
73 Ga0068853_100002366 3300005539 Bacteria 14099
74 Ga0068853_100023829 3300005539 Bacteria 5128
75 Ga0068853_100039018 3300005539 Bacteria 4049
76 Ga0068853_100068438 3300005539 Bacteria 3087
77 Ga0070672_100075538 3300005543 Bacteria 2690
78 Ga0070672_100098666 3300005543 Bacteria 2366
79 Ga0070693_100010206 3300005547 Bacteria 4697
80 Ga0070665_100005304 3300005548 Bacteria 13314
81 Ga0070665_100028812 3300005548 Bacteria 5590
82 Ga0068855_100001534 3300005563 Bacteria 29001
83 Ga0068855_100016873 3300005563 Bacteria 8781
84 Ga0068855_100068513 3300005563 Bacteria 4131
85 Ga0068855_100170723 3300005563 Bacteria 2463
86 Ga0068855_100296182 3300005563 Bacteria 1792
87 Ga0068855_100357164 3300005563 Bacteria 1608
88 Ga0070664_100000888 3300005564 Bacteria 23240
89 Ga0070664_100001052 3300005564 Bacteria 21695
90 Ga0070664_100100286 3300005564 Bacteria 2517
91 Ga0070664_100104537 3300005564 Bacteria 2466
92 Ga0068854_100031433 3300005578 Bacteria 3689
93 Ga0068854_100050927 3300005578 Bacteria 2965
94 Ga0068854_100061898 3300005578 Bacteria 2711
95 Ga0068854_100240463 3300005578 Bacteria 1441
96 Ga0068856_100000159 3300005614 Bacteria 70023
97 Ga0068856_100042622 3300005614 Bacteria 4465
98 Ga0068856_100092255 3300005614 Bacteria 3013
99 Ga0068856_100484660 3300005614 Bacteria 1258
100 Ga0068856_100683330 3300005614 Bacteria 1047
101 Ga0068852_100001069 3300005616 Bacteria 18099
102 Ga0068852_100005858 3300005616 Bacteria 8830
103 Ga0068852_100018129 3300005616 Bacteria 5540
104 Ga0068852_100041440 3300005616 Bacteria 3892
105 Ga0068852_100213343 3300005616 Bacteria 1832
106 Ga0068852_100349834 3300005616 Bacteria 1443
107 Ga0068864_100004743 3300005618 Bacteria 11134
108 Ga0068864_100011233 3300005618 Bacteria 7399
109 Ga0068864_100177902 3300005618 Bacteria 1943
110 Ga0068864_100191798 3300005618 Bacteria 1874
111 Ga0068861_100255054 3300005719 Bacteria 1499
112 Ga0068863_100017839 3300005841 Bacteria 6793
113 Ga0068863_100085351 3300005841 Bacteria 2992
114 Ga0068858_100040959 3300005842 Bacteria 4297
115 Ga0068858_100223743 3300005842 Bacteria 1783
116 Ga0068860_100026189 3300005843 Bacteria 5623
117 Ga0081540_1033228 3300005983 Bacteria 2804
118 Ga0070717_10003438 3300006028 Bacteria 11329
119 Ga0075365_10114087 3300006038 Bacteria 1859
120 Ga0075365_10384349 3300006038 Bacteria 990
121 Ga0070716_100236054 3300006173 Unclassified 1237
122 Ga0097621_100188829 3300006237 Bacteria 1783
123 Ga0068871_100104267 3300006358 Bacteria 2379
124 Ga0068871_100138743 3300006358 Bacteria 2066
125 Ga0075431_100143367 3300006847 Bacteria 2462
126 Ga0075433_10000479 3300006852 Bacteria 26051
127 Ga0075434_100050913 3300006871 Bacteria 4114
128 Ga0075436_100003906 3300006914 Bacteria 10214
129 Ga0075435_100017185 3300007076 Bacteria 5468
130 Ga0105240_10100385 3300009093 Bacteria 3522
131 Ga0114129_10000847 3300009147 Bacteria 39608
132 Ga0105241_10076594 3300009174 Bacteria 2609
133 Ga0105248_10000213 3300009177 Bacteria 66972
134 Ga0105248_10003106 3300009177 Bacteria 18389
135 Ga0105248_10097293 3300009177 Bacteria 3316
136 Ga0105237_10104221 3300009545 Bacteria 2828
137 Ga0105238_10016800 3300009551 Bacteria 7418
138 Ga0105238_10038277 3300009551 Bacteria 4870
139 Ga0105238_10548841 3300009551 Bacteria 1160
140 Ga0105239_10034800 3300010375 Bacteria 5532
141 Ga0157373_10111362 3300013100 Bacteria 1924
142 Ga0157373_10155015 3300013100 Bacteria 1612
143 Ga0157373_10187092 3300013100 Bacteria 1459
144 Ga0157371_10000915 3300013102 Bacteria 33246
145 Ga0157371_10033094 3300013102 Bacteria 3716
146 Ga0157371_10071884 3300013102 Bacteria 2449
147 Ga0157371_10154099 3300013102 Bacteria 1639
148 Ga0157369_10007383 3300013105 Bacteria 12652
149 Ga0157369_10012500 3300013105 Bacteria 9633
150 Ga0157369_10036878 3300013105 Bacteria 5354
151 Ga0157369_10215096 3300013105 Bacteria 2013
152 Ga0157369_10567409 3300013105 Bacteria 1172
153 Ga0157374_10325340 3300013296 Bacteria 1524
154 Ga0157378_10323249 3300013297 Bacteria 1499
155 Ga0163162_10078902 3300013306 Bacteria 3358
156 Ga0157372_10015547 3300013307 Bacteria 8156
157 Ga0157372_10296389 3300013307 Bacteria 1881
158 Ga0157372_10371994 3300013307 Bacteria 1665
159 Ga0157375_10387604 3300013308 Bacteria 1564
160 Ga0163163_10004075 3300014325 Bacteria 12457
161 Ga0206353_10300642 3300020082 Bacteria 2388
162 Ga0213873_10019727 3300021358 Bacteria 1567
163 Ga0213874_10035847 3300021377 Bacteria 1459
164 Ga0213875_10007694 3300021388 Bacteria 5549
165 Ga0207680_10041874 3300025903 Bacteria 2675
166 Ga0207647_10015527 3300025904 Bacteria 5217
167 Ga0207647_10019837 3300025904 Bacteria 4515
168 Ga0207647_10119723 3300025904 Bacteria 1553
169 Ga0207647_10140539 3300025904 Bacteria 1415
170 Ga0207645_10002319 3300025907 Bacteria 15052
171 Ga0207645_10358188 3300025907 Bacteria 977
172 Ga0207705_10000276 3300025909 Bacteria 49160
173 Ga0207705_10001746 3300025909 Bacteria 17194
174 Ga0207705_10017522 3300025909 Bacteria 5128
175 Ga0207705_10028712 3300025909 Bacteria 3965
176 Ga0207705_10109965 3300025909 Bacteria 2036
177 Ga0207705_10131191 3300025909 Bacteria 1865
178 Ga0207705_10142524 3300025909 Bacteria 1790
179 Ga0207654_10221628 3300025911 Bacteria 1255
180 Ga0207707_10180325 3300025912 Bacteria 1844
181 Ga0207695_10050405 3300025913 Bacteria 4380
182 Ga0207671_10054898 3300025914 Bacteria 2951
183 Ga0207660_10084690 3300025917 Bacteria 2337
184 Ga0207660_10154967 3300025917 Bacteria 1763
185 Ga0207657_10000218 3300025919 Bacteria 59661
186 Ga0207657_10006606 3300025919 Bacteria 12004
187 Ga0207657_10032277 3300025919 Bacteria 4734
188 Ga0207657_10073414 3300025919 Bacteria 2891
189 Ga0207657_10090607 3300025919 Bacteria 2552
190 Ga0207657_10202596 3300025919 Bacteria 1595
191 Ga0207649_10012764 3300025920 Bacteria 4673
192 Ga0207649_10066332 3300025920 Bacteria 2288
193 Ga0207652_10029641 3300025921 Bacteria 4578
194 Ga0207652_10231241 3300025921 Bacteria 1666
195 Ga0207652_10300813 3300025921 Bacteria 1448
196 Ga0207681_10008022 3300025923 Bacteria 6460
197 Ga0207681_10089675 3300025923 Bacteria 2193
198 Ga0207694_10000966 3300025924 Bacteria 25308
199 Ga0207694_10007706 3300025924 Bacteria 8158
200 Ga0207650_10009163 3300025925 Bacteria 6765
201 Ga0207650_10086144 3300025925 Bacteria 2391
202 Ga0207644_10000227 3300025931 Bacteria 38835
203 Ga0207644_10069236 3300025931 Bacteria 2576
204 Ga0207644_10072849 3300025931 Bacteria 2517
205 Ga0207690_10000100 3300025932 Bacteria 71510
206 Ga0207690_10021531 3300025932 Bacteria 3999
207 Ga0207690_10032317 3300025932 Bacteria 3357
208 Ga0207706_10002713 3300025933 Bacteria 17246
209 Ga0207706_10012022 3300025933 Bacteria 7886
210 Ga0207706_10582240 3300025933 Bacteria 962
211 Ga0207669_10007131 3300025937 Bacteria 5148
212 Ga0207704_10264952 3300025938 Bacteria 1297
213 Ga0207691_10064440 3300025940 Bacteria 3320
214 Ga0207691_10065346 3300025940 Bacteria 3293
215 Ga0207711_10001921 3300025941 Bacteria 18877
216 Ga0207711_10107663 3300025941 Bacteria 2475
217 Ga0207689_10036697 3300025942 Bacteria 4069
218 Ga0207661_10001153 3300025944 Bacteria 17664
219 Ga0207679_10000287 3300025945 Bacteria 38346
220 Ga0207679_10000689 3300025945 Bacteria 22607
221 Ga0207667_10000122 3300025949 Bacteria 121588
222 Ga0207667_10021727 3300025949 Bacteria 7110
223 Ga0207667_10027779 3300025949 Bacteria 6154
224 Ga0207667_10366367 3300025949 Bacteria 1469
225 Ga0207651_10075904 3300025960 Bacteria 2400
226 Ga0207651_10132012 3300025960 Bacteria 1914
227 Ga0207651_10582885 3300025960 Bacteria 976
228 Ga0207668_10001772 3300025972 Bacteria 12598
229 Ga0207668_10425673 3300025972 Unclassified 1128
230 Ga0207640_10030468 3300025981 Bacteria 3322
231 Ga0207640_10047345 3300025981 Bacteria 2773
232 Ga0207640_10052485 3300025981 Bacteria 2656
233 Ga0207640_10100784 3300025981 Bacteria 2024
234 Ga0207658_10023721 3300025986 Bacteria 4285
235 Ga0207639_10000769 3300026041 Bacteria 21887
236 Ga0207639_10017503 3300026041 Bacteria 5081
237 Ga0207639_10228059 3300026041 Bacteria 1613
238 Ga0207639_10295620 3300026041 Bacteria 1429
239 Ga0207678_10008634 3300026067 Bacteria 8980
240 Ga0207678_10027050 3300026067 Bacteria 5002
241 Ga0207678_10175389 3300026067 Bacteria 1830
242 Ga0207678_10183623 3300026067 Bacteria 1786
243 Ga0207678_10464158 3300026067 Bacteria 1101
244 Ga0207702_10000208 3300026078 Bacteria 69979
245 Ga0207702_10062608 3300026078 Bacteria 3178
246 Ga0207702_10117520 3300026078 Bacteria 2374
247 Ga0207702_10120698 3300026078 Bacteria 2346
248 Ga0207641_10254788 3300026088 Bacteria 1640
249 Ga0207648_10020950 3300026089 Bacteria 5885
250 Ga0207676_10021935 3300026095 Bacteria 4691
251 Ga0207676_10093412 3300026095 Bacteria 2476
252 Ga0207676_10121407 3300026095 Bacteria 2204
253 Ga0207674_10003445 3300026116 Bacteria 19357
254 Ga0207674_10045988 3300026116 Bacteria 4485
255 Ga0207675_100144278 3300026118 Bacteria 2263
256 Ga0207683_10070543 3300026121 Bacteria 3087
257 Ga0207683_10139548 3300026121 Bacteria 2183
258 Ga0207698_10001407 3300026142 Bacteria 13964
259 Ga0207698_10003907 3300026142 Bacteria 9024
260 Ga0268266_10008685 3300028379 Bacteria 9012
261 Ga0268266_10301549 3300028379 Bacteria 1495
262 Ga0307405_10157900 3300031731 Bacteria 1603
263 Ga0307409_100091182 3300031995 Bacteria 2497
264 Ga0307409_100281190 3300031995 Unclassified 1538
265 Ga0307416_100383781 3300032002 Bacteria 1436
266 Ga0307414_10037363 3300032004 Bacteria 3251
267 Ga0307414_10158443 3300032004 Bacteria 1795
268 Ga0307411_10008125 3300032005 Bacteria 5411
269 Ga0307411_10050976 3300032005 Bacteria 2698
270 Ga0307415_100007913 3300032126 Bacteria 5848
271 Ga0307415_100142409 3300032126 Bacteria 1833
272 Ga0373961_0133429 3300035241 Bacteria 833
273 Ga0373931_0003694 3300035691 Bacteria 6925
274 Ga0373935_0178763 3300035692 Bacteria 1456
275 Ga0373937_0648699 3300036401 Bacteria 1001
276 Ga0395899_0006469 3300037312 Bacteria 9076
277 Ga0395899_0157655 3300037312 Bacteria 1605
278 Ga0395899_0224465 3300037312 Bacteria 1300
279 Ga0395900_0000964 3300037418 Bacteria 37445
280 Ga0395900_0081825 3300037418 Bacteria 3317
281 Ga0395900_0122646 3300037418 Bacteria 2665
282 Ga0395900_0436786 3300037418 Bacteria 1267
283 Ga0395898_0091653 3300037466 Bacteria 2924
284 Ga0395898_0371249 3300037466 Bacteria 1364
285 Ga0395905_0000559 3300037471 Bacteria 50796
286 Ga0395905_0009966 3300037471 Bacteria 9258
287 Ga0395905_0015329 3300037471 Bacteria 7286
288 Ga0395905_0021726 3300037471 Bacteria 6071
289 Ga0395905_0034596 3300037471 Bacteria 4745
290 Ga0395905_0042672 3300037471 Bacteria 4255
291 Ga0395905_0061523 3300037471 Bacteria 3512
292 Ga0395905_0073591 3300037471 Bacteria 3203
293 Ga0395905_0082048 3300037471 Bacteria 3021
294 Ga0395905_0145435 3300037471 Bacteria 2230
295 Ga0395905_0177015 3300037471 Bacteria 2002
296 Ga0395901_0000248 3300038443 Bacteria 67155
297 Ga0395901_0005488 3300038443 Bacteria 12849
298 Ga0395901_0039811 3300038443 Bacteria 4864
299 Ga0395901_0089434 3300038443 Bacteria 3223
300 Ga0395901_0294240 3300038443 Bacteria 1684
301 Ga0395901_0297275 3300038443 Bacteria 1674
302 Ga0395901_0696683 3300038443 Bacteria 1014
303 Ga0436365_0419858 3300039437 Bacteria 6930
304 Ga0436365_0482220 3300039437 Bacteria 16094
305 Ga0436365_0851767 3300039437 Bacteria 3638
306 Ga0436363_1406963 3300039450 Bacteria 13007
307 Ga0439449_0050008 3300042007 Bacteria 1546
308 Ga0466965_0068268 3300044683 Bacteria 1785
309 Ga0466961_0081808 3300044693 Bacteria 2043
310 Ga0466963_0007917 3300044694 Bacteria 6363
311 Ga0466963_0044656 3300044694 Bacteria 2917
312 Ga0466963_0056395 3300044694 Bacteria 2614
313 Ga0466963_0062883 3300044694 Bacteria 2483
314 Ga0466963_0064926 3300044694 Bacteria 2446
315 Ga0466963_0299293 3300044694 Bacteria 1131
316 Ga0466971_0043172 3300044719 Bacteria 2026
317 Ga0466970_0106131 3300044765 Bacteria 1532
318 Ga0466957_0015302 3300044842 Bacteria 4481
319 Ga0466957_0020057 3300044842 Bacteria 3934
320 Ga0466957_0046377 3300044842 Bacteria 2638
321 Ga0466957_0146406 3300044842 Bacteria 1525
322 Ga0466958_0058353 3300045836 Bacteria 2346
323 Ga0466958_0077489 3300045836 Bacteria 2041
324 Ga0466967_0000572 3300045976 Bacteria 18128
325 Ga0466967_0046576 3300045976 Bacteria 3776
326 Ga0466967_0053512 3300045976 Bacteria 3548
327 Ga0466967_0065076 3300045976 Bacteria 3244
328 Ga0466967_0078614 3300045976 Bacteria 2972
329 Ga0466967_0079685 3300045976 Bacteria 2953
330 Ga0466967_0093883 3300045976 Bacteria 2731
331 Ga0466967_0148999 3300045976 Bacteria 2185
332 Ga0466967_0231465 3300045976 Bacteria 1760
333 Ga0466967_0257226 3300045976 Bacteria 1669
334 Ga0466967_0405977 3300045976 Bacteria 1326
335 Ga0495585_0025102 3300046492 Bacteria 3416
336 Ga0495663_0001621 3300046525 Bacteria 7035
337 Ga0495621_0000245 3300046539 Bacteria 12896
338 Ga0495633_0003100 3300046558 Bacteria 11282
339 Ga0495625_0279624 3300046660 Bacteria 1074
340 Ga0495661_0060813 3300046665 Bacteria 2243
341 Ga0495669_0002382 3300046684 Bacteria 7714
342 Ga0495669_0026086 3300046684 Bacteria 2552
343 Ga0495669_0037969 3300046684 Bacteria 2132
344 Ga0495670_0046464 3300046691 Bacteria 2168
345 Ga0496101_0263306 3300048904 Bacteria 1345
346 Ga0496106_0210994 3300048909 Bacteria 1547
347 Ga0496107_0116825 3300048910 Bacteria 1964
348 Ga0496108_0000498 3300048911 Bacteria 31214
349 Ga0496108_0007380 3300048911 Bacteria 8914
350 Ga0496110_0047865 3300048913 Bacteria 3746
351 Ga0496112_0021282 3300048915 Bacteria 6165
352 Ga0496113_0020412 3300048916 Bacteria 4657
353 Ga0496113_0502813 3300048916 Bacteria 973
354 Ga0496114_0003647 3300048917 Bacteria 11842
355 Ga0496119_0032326 3300048922 Bacteria 3489
356 Ga0496121_0000017 3300048924 Bacteria 546415
357 Ga0496123_0139611 3300048926 Bacteria 1327
358 Ga0496125_0193865 3300048928 Bacteria 1338
359 Ga0501031_0025981 3300049568 Bacteria 3820
360 Ga0501031_0095657 3300049568 Unclassified 1938
361 Ga0501032_0003856 3300049569 Bacteria 11384
362 Ga0501032_0015580 3300049569 Bacteria 5362
363 Ga0501033_0001826 3300049570 Bacteria 18559
364 Ga0501033_0016099 3300049570 Bacteria 5662
365 Ga0501034_0044052 3300049571 Bacteria 4513
366 Ga0501034_0337418 3300049571 Bacteria 1438
367 Ga0501036_0038264 3300049572 Bacteria 4059
368 Ga0501036_0213506 3300049572 Bacteria 1621
369 Ga0501037_0000216 3300049573 Bacteria 50948
370 Ga0501037_0023652 3300049573 Bacteria 4543
371 Ga0501038_0035711 3300049574 Bacteria 4363
372 Ga0501038_0048982 3300049574 Bacteria 3655
373 Ga0501038_0331399 3300049574 Bacteria 1189
374 Ga0501039_0010911 3300049575 Bacteria 6925
375 Ga0501039_0433510 3300049575 Bacteria 1032
376 Ga0501040_0014899 3300049576 Bacteria 5134
377 Ga0501040_0032872 3300049576 Bacteria 3511
378 Ga0501040_0037924 3300049576 Bacteria 3276
379 Ga0501040_0085240 3300049576 Bacteria 2193
380 Ga0501041_0035263 3300049577 Bacteria 3031
381 Ga0501042_0206372 3300049578 Bacteria 1417
382 Ga0501043_0000132 3300049579 Bacteria 69702
383 Ga0501043_0028056 3300049579 Bacteria 4418
384 Ga0501046_0018278 3300049580 Bacteria 5836
385 Ga0501046_0034857 3300049580 Bacteria 4059
386 Ga0501046_0143395 3300049580 Bacteria 1806
387 Ga0501047_0030375 3300049581 Bacteria 5209
388 Ga0501048_0023190 3300049582 Bacteria 4537
389 Ga0501048_0114717 3300049582 Bacteria 1903
390 Ga0501048_0129799 3300049582 Unclassified 1782
391 Ga0501067_0129717 3300049583 Bacteria 1403
392 Ga0501068_0011760 3300049584 Bacteria 4947
393 Ga0501068_0021890 3300049584 Bacteria 3735
394 Ga0501069_0000051 3300049585 Bacteria 70783
395 Ga0501070_0000291 3300049586 Bacteria 46988
396 Ga0501070_0069906 3300049586 Bacteria 2907
397 Ga0501070_0487394 3300049586 Bacteria 991
398 Ga0501071_0002067 3300049587 Bacteria 12024
399 Ga0501071_0005006 3300049587 Bacteria 8471
400 Ga0501071_0011170 3300049587 Bacteria 6040
401 Ga0501072_0029565 3300049588 Bacteria 4282
402 Ga0501072_0032018 3300049588 Bacteria 4117
403 Ga0501074_0000043 3300049590 Bacteria 59245
404 Ga0501074_0020147 3300049590 Bacteria 4847
405 Ga0501074_0030310 3300049590 Bacteria 3920
406 Ga0501074_0486889 3300049590 Bacteria 874
407 Ga0501075_0003245 3300049591 Bacteria 10892
408 Ga0501075_0170210 3300049591 Bacteria 1662
409 Ga0501076_0009325 3300049592 Bacteria 7242
410 Ga0501077_0000486 3300049593 Bacteria 24085
411 Ga0501077_0001334 3300049593 Bacteria 14906
412 Ga0501079_0042703 3300049741 Bacteria 3500
413 Ga0501079_0185825 3300049741 Bacteria 1622
414 Ga0501080_0000551 3300049742 Bacteria 29597
415 Ga0501080_0007663 3300049742 Bacteria 9763
416 Ga0501080_0541551 3300049742 Bacteria 1037
417 Ga0501081_0012180 3300049743 Bacteria 5641
418 Ga0501081_0025681 3300049743 Bacteria 3966
419 Ga0501083_0000247 3300049744 Bacteria 34317
420 Ga0501083_0208257 3300049744 Bacteria 1275
421 Ga0501083_0272063 3300049744 Bacteria 1102
422 Ga0501035_0000280 3300049822 Bacteria 60510
423 Ga0501035_0018010 3300049822 Bacteria 6511
424 Ga0501035_0271031 3300049822 Bacteria 1437
425 Ga0501044_0000037 3300049823 Bacteria 161924
426 Ga0501044_0008962 3300049823 Bacteria 10938
427 Ga0501044_0031983 3300049823 Bacteria 5531
428 Ga0501044_0053330 3300049823 Bacteria 4160
429 Ga0501045_0018030 3300049824 Bacteria 5013
430 Ga0501045_0024081 3300049824 Bacteria 4369
431 Ga0501045_0070347 3300049824 Bacteria 2574
432 nmdc:mga0yw44_101690_c1 3300050492 Bacteria 1831
433 nmdc:mga05p37_4682_c1 3300050507 Bacteria 15979
434 nmdc:mga0n895_1004_c1 3300050512 Bacteria 20486
435 nmdc:mga0rr50_1899_c1 3300050513 Bacteria 11596
436 nmdc:mga08x19_59640_c1 3300050514 Bacteria 2471
437 nmdc:mga0a205_193_c1 3300050515 Bacteria 42226
438 Ga0500559_0001448 3300053136 Bacteria 13466
439 Ga0501084_0025576 3300054114 Bacteria 4924
440 Ga0590071_001183 3300059421 Bacteria 7060
441 Ga0590071_035271 3300059421 Bacteria 1198
442 Ga0501082_0009563 3300060353 Bacteria 8343
443 Ga0501082_0022936 3300060353 Bacteria 5379
444 Ga0501082_0119666 3300060353 Bacteria 2282
445 Ga0501082_0146730 3300060353 Bacteria 2048
446 Ga0501082_0489949 3300060353 Bacteria 1074
447 Ga0466962_0009383 3300061719 Bacteria 4690
448 Ga0466962_0093968 3300061719 Bacteria 1438
449 2535484780 2534681786 Bacteria 3308809
450 2753359395 2751185800 Bacteria 5467370
451 2758641651 2758568016 Bacteria 5645291
452 2837683419 2837678835 Bacteria 5252418
453 2894819840 2894817345 Bacteria 4892941
454 2915653884 2915650412 Bacteria 4288180
455 8004316875 8004312739 Bacteria 7444653
456 8045865634 8045864390 Bacteria 5043873
457 Ga0157370_10055412
458 JGI24741J21665_1011303
459 JGI24740J21852_10047530
460 JGI24740J21852_10053956
461 JGI24739J22299_10003381
462 JGI24737J22298_10004992
463 JGI24735J21928_10018688
464 JGI24735J21928_10052122
465 JGI24738J21930_10002673
466 Ga0070658_10000405
467 Ga0070658_10001600
468 Ga0070658_10021747
469 Ga0070658_10051374
470 Ga0070658_10059774
471 Ga0070658_10068747
472 Ga0070676_10023968
473 Ga0070683_100002224
474 Ga0070683_100048226
475 Ga0070683_100461764
476 Ga0070670_100011322
477 Ga0070670_100013086
478 Ga0068869_100036241
479 Ga0070666_10003536
480 Ga0070680_100028742
481 Ga0070682_100024645
482 Ga0070682_100133878
483 Ga0068868_100315428
484 Ga0070660_100000194
485 Ga0070660_100001048
486 Ga0070660_100275109
487 Ga0070660_100448062
488 Ga0070691_10115360
489 Ga0070661_100000157
490 Ga0070661_100064080
491 Ga0070661_100100359
492 Ga0070661_100253618
493 Ga0070661_100315993
494 Ga0070668_100023575
495 Ga0070668_100336752
496 Ga0070669_100075270
497 Ga0070671_100017860
498 Ga0070671_100018970
499 Ga0070671_100044776
500 Ga0070671_100068727
501 Ga0070674_100164837
502 Ga0070673_100113785
503 Ga0070659_100000086
504 Ga0070659_100011858
505 Ga0070659_100017336
506 Ga0070659_100078064
507 Ga0070659_100387789
508 Ga0070659_100660692
509 Ga0070667_100010080
510 Ga0070667_100017151
511 Ga0070667_100130886
512 Ga0070667_100606757
513 Ga0070713_100031108
514 Ga0070708_100004430
515 Ga0070708_100061118
516 Ga0070663_100053553
517 Ga0070663_100128672
518 Ga0070678_100185527
519 Ga0070678_100225816
520 Ga0070662_100000640
521 Ga0070662_100014749
522 Ga0068867_100221945
523 Ga0070679_100083970
524 Ga0070679_100099289
525 Ga0070679_100189627
526 Ga0070684_100013895
527 Ga0070684_100066115
528 Ga0070684_100451147
529 Ga0068853_100002366
530 Ga0068853_100023829
531 Ga0068853_100039018
532 Ga0068853_100068438
533 Ga0070672_100075538
534 Ga0070672_100098666
535 Ga0070693_100010206
536 Ga0070665_100005304
537 Ga0070665_100028812
538 Ga0068855_100001534
539 Ga0068855_100016873
540 Ga0068855_100068513
541 Ga0068855_100170723
542 Ga0068855_100296182
543 Ga0068855_100357164
544 Ga0070664_100000888
545 Ga0070664_100001052
546 Ga0070664_100100286
547 Ga0070664_100104537
548 Ga0068854_100031433
549 Ga0068854_100050927
550 Ga0068854_100061898
551 Ga0068854_100240463
552 Ga0068856_100000159
553 Ga0068856_100042622
554 Ga0068856_100092255
555 Ga0068856_100484660
556 Ga0068856_100683330
557 Ga0068852_100001069
558 Ga0068852_100005858
559 Ga0068852_100018129
560 Ga0068852_100041440
561 Ga0068852_100213343
562 Ga0068852_100349834
563 Ga0068864_100004743
564 Ga0068864_100011233
565 Ga0068864_100177902
566 Ga0068864_100191798
567 Ga0068861_100255054
568 Ga0068863_100017839
569 Ga0068863_100085351
570 Ga0068858_100040959
571 Ga0068858_100223743
572 Ga0068860_100026189
573 Ga0081540_1033228
574 Ga0070717_10003438
575 Ga0075365_10114087
576 Ga0075365_10384349
577 Ga0070716_100236054
578 Ga0097621_100188829
579 Ga0068871_100104267
580 Ga0068871_100138743
581 Ga0075431_100143367
582 Ga0075433_10000479
583 Ga0075434_100050913
584 Ga0075436_100003906
585 Ga0075435_100017185
586 Ga0105240_10100385
587 Ga0114129_10000847
588 Ga0105241_10076594
589 Ga0105248_10000213
590 Ga0105248_10003106
591 Ga0105248_10097293
592 Ga0105237_10104221
593 Ga0105238_10016800
594 Ga0105238_10038277
595 Ga0105238_10548841
596 Ga0105239_10034800
597 Ga0157373_10111362
598 Ga0157373_10155015
599 Ga0157373_10187092
600 Ga0157371_10000915
601 Ga0157371_10033094
602 Ga0157371_10071884
603 Ga0157371_10154099
604 Ga0157369_10007383
605 Ga0157369_10012500
606 Ga0157369_10036878
607 Ga0157369_10215096
608 Ga0157369_10567409
609 Ga0157374_10325340
610 Ga0157378_10323249
611 Ga0163162_10078902
612 Ga0157372_10015547
613 Ga0157372_10296389
614 Ga0157372_10371994
615 Ga0157375_10387604
616 Ga0163163_10004075
617 Ga0206353_10300642
618 Ga0213873_10019727
619 Ga0213874_10035847
620 Ga0213875_10007694
621 Ga0207680_10041874
622 Ga0207647_10015527
623 Ga0207647_10019837
624 Ga0207647_10119723
625 Ga0207647_10140539
626 Ga0207645_10002319
627 Ga0207645_10358188
628 Ga0207705_10000276
629 Ga0207705_10001746
630 Ga0207705_10017522
631 Ga0207705_10028712
632 Ga0207705_10109965
633 Ga0207705_10131191
634 Ga0207705_10142524
635 Ga0207654_10221628
636 Ga0207707_10180325
637 Ga0207695_10050405
638 Ga0207671_10054898
639 Ga0207660_10084690
640 Ga0207660_10154967
641 Ga0207657_10000218
642 Ga0207657_10006606
643 Ga0207657_10032277
644 Ga0207657_10073414
645 Ga0207657_10090607
646 Ga0207657_10202596
647 Ga0207649_10012764
648 Ga0207649_10066332
649 Ga0207652_10029641
650 Ga0207652_10231241
651 Ga0207652_10300813
652 Ga0207681_10008022
653 Ga0207681_10089675
654 Ga0207694_10000966
655 Ga0207694_10007706
656 Ga0207650_10009163
657 Ga0207650_10086144
658 Ga0207644_10000227
659 Ga0207644_10069236
660 Ga0207644_10072849
661 Ga0207690_10000100
662 Ga0207690_10021531
663 Ga0207690_10032317
664 Ga0207706_10002713
665 Ga0207706_10012022
666 Ga0207706_10582240
667 Ga0207669_10007131
668 Ga0207704_10264952
669 Ga0207691_10064440
670 Ga0207691_10065346
671 Ga0207711_10001921
672 Ga0207711_10107663
673 Ga0207689_10036697
674 Ga0207661_10001153
675 Ga0207679_10000287
676 Ga0207679_10000689
677 Ga0207667_10000122
678 Ga0207667_10021727
679 Ga0207667_10027779
680 Ga0207667_10366367
681 Ga0207651_10075904
682 Ga0207651_10132012
683 Ga0207651_10582885
684 Ga0207668_10001772
685 Ga0207668_10425673
686 Ga0207640_10030468
687 Ga0207640_10047345
688 Ga0207640_10052485
689 Ga0207640_10100784
690 Ga0207658_10023721
691 Ga0207639_10000769
692 Ga0207639_10017503
693 Ga0207639_10228059
694 Ga0207639_10295620
695 Ga0207678_10008634
696 Ga0207678_10027050
697 Ga0207678_10175389
698 Ga0207678_10183623
699 Ga0207678_10464158
700 Ga0207702_10000208
701 Ga0207702_10062608
702 Ga0207702_10117520
703 Ga0207702_10120698
704 Ga0207641_10254788
705 Ga0207648_10020950
706 Ga0207676_10021935
707 Ga0207676_10093412
708 Ga0207676_10121407
709 Ga0207674_10003445
710 Ga0207674_10045988
711 Ga0207675_100144278
712 Ga0207683_10070543
713 Ga0207683_10139548
714 Ga0207698_10001407
715 Ga0207698_10003907
716 Ga0268266_10008685
717 Ga0268266_10301549
718 Ga0307405_10157900
719 Ga0307409_100091182
720 Ga0307409_100281190
721 Ga0307416_100383781
722 Ga0307414_10037363
723 Ga0307414_10158443
724 Ga0307411_10008125
725 Ga0307411_10050976
726 Ga0307415_100007913
727 Ga0307415_100142409
728 Ga0373961_0133429
729 Ga0373931_0003694
730 Ga0373935_0178763
731 Ga0373937_0648699
732 Ga0395899_0006469
733 Ga0395899_0157655
734 Ga0395899_0224465
735 Ga0395900_0000964
736 Ga0395900_0081825
737 Ga0395900_0122646
738 Ga0395900_0436786
739 Ga0395898_0091653
740 Ga0395898_0371249
741 Ga0395905_0000559
742 Ga0395905_0009966
743 Ga0395905_0015329
744 Ga0395905_0021726
745 Ga0395905_0034596
746 Ga0395905_0042672
747 Ga0395905_0061523
748 Ga0395905_0073591
749 Ga0395905_0082048
750 Ga0395905_0145435
751 Ga0395905_0177015
752 Ga0395901_0000248
753 Ga0395901_0005488
754 Ga0395901_0039811
755 Ga0395901_0089434
756 Ga0395901_0294240
757 Ga0395901_0297275
758 Ga0395901_0696683
759 Ga0436365_0419858
760 Ga0436365_0482220
761 Ga0436365_0851767
762 Ga0436363_1406963
763 Ga0439449_0050008
764 Ga0466965_0068268
765 Ga0466961_0081808
766 Ga0466963_0007917
767 Ga0466963_0044656
768 Ga0466963_0056395
769 Ga0466963_0062883
770 Ga0466963_0064926
771 Ga0466963_0299293
772 Ga0466971_0043172
773 Ga0466970_0106131
774 Ga0466957_0015302
775 Ga0466957_0020057
776 Ga0466957_0046377
777 Ga0466957_0146406
778 Ga0466958_0058353
779 Ga0466958_0077489
780 Ga0466967_0000572
781 Ga0466967_0046576
782 Ga0466967_0053512
783 Ga0466967_0065076
784 Ga0466967_0078614
785 Ga0466967_0079685
786 Ga0466967_0093883
787 Ga0466967_0148999
788 Ga0466967_0231465
789 Ga0466967_0257226
790 Ga0466967_0405977
791 Ga0495585_0025102
792 Ga0495663_0001621
793 Ga0495621_0000245
794 Ga0495633_0003100
795 Ga0495625_0279624
796 Ga0495661_0060813
797 Ga0495669_0002382
798 Ga0495669_0026086
799 Ga0495669_0037969
800 Ga0495670_0046464
801 Ga0496101_0263306
802 Ga0496106_0210994
803 Ga0496107_0116825
804 Ga0496108_0000498
805 Ga0496108_0007380
806 Ga0496110_0047865
807 Ga0496112_0021282
808 Ga0496113_0020412
809 Ga0496113_0502813
810 Ga0496114_0003647
811 Ga0496119_0032326
812 Ga0496121_0000017
813 Ga0496123_0139611
814 Ga0496125_0193865
815 Ga0501031_0025981
816 Ga0501031_0095657
817 Ga0501032_0003856
818 Ga0501032_0015580
819 Ga0501033_0001826
820 Ga0501033_0016099
821 Ga0501034_0044052
822 Ga0501034_0337418
823 Ga0501036_0038264
824 Ga0501036_0213506
825 Ga0501037_0000216
826 Ga0501037_0023652
827 Ga0501038_0035711
828 Ga0501038_0048982
829 Ga0501038_0331399
830 Ga0501039_0010911
831 Ga0501039_0433510
832 Ga0501040_0014899
833 Ga0501040_0032872
834 Ga0501040_0037924
835 Ga0501040_0085240
836 Ga0501041_0035263
837 Ga0501042_0206372
838 Ga0501043_0000132
839 Ga0501043_0028056
840 Ga0501046_0018278
841 Ga0501046_0034857
842 Ga0501046_0143395
843 Ga0501047_0030375
844 Ga0501048_0023190
845 Ga0501048_0114717
846 Ga0501048_0129799
847 Ga0501067_0129717
848 Ga0501068_0011760
849 Ga0501068_0021890
850 Ga0501069_0000051
851 Ga0501070_0000291
852 Ga0501070_0069906
853 Ga0501070_0487394
854 Ga0501071_0002067
855 Ga0501071_0005006
856 Ga0501071_0011170
857 Ga0501072_0029565
858 Ga0501072_0032018
859 Ga0501074_0000043
860 Ga0501074_0020147
861 Ga0501074_0030310
862 Ga0501074_0486889
863 Ga0501075_0003245
864 Ga0501075_0170210
865 Ga0501076_0009325
866 Ga0501077_0000486
867 Ga0501077_0001334
868 Ga0501079_0042703
869 Ga0501079_0185825
870 Ga0501080_0000551
871 Ga0501080_0007663
872 Ga0501080_0541551
873 Ga0501081_0012180
874 Ga0501081_0025681
875 Ga0501083_0000247
876 Ga0501083_0208257
877 Ga0501083_0272063
878 Ga0501035_0000280
879 Ga0501035_0018010
880 Ga0501035_0271031
881 Ga0501044_0000037
882 Ga0501044_0008962
883 Ga0501044_0031983
884 Ga0501044_0053330
885 Ga0501045_0018030
886 Ga0501045_0024081
887 Ga0501045_0070347
888 nmdc:mga0yw44_101690_c1
889 nmdc:mga05p37_4682_c1
890 nmdc:mga0n895_1004_c1
891 nmdc:mga0rr50_1899_c1
892 nmdc:mga08x19_59640_c1
893 nmdc:mga0a205_193_c1
894 Ga0500559_0001448
895 Ga0501084_0025576
896 Ga0590071_001183
897 Ga0590071_035271
898 Ga0501082_0009563
899 Ga0501082_0022936
900 Ga0501082_0119666
901 Ga0501082_0146730
902 Ga0501082_0489949
903 Ga0466962_0009383
904 Ga0466962_0093968
905 2535484780
906 2753359395
907 2758641651
908 2837683419
909 2894819840
910 2915653884
911 8004316875
912 8045865634

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00581

Rhodanese

Rhodanese-like domain

61

181

0.91

PF00581

Rhodanese

Rhodanese-like domain

204

321

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wqk-assembly2.cif.gz_B crystal structure of 3-mercaptopyruvate sulfurtransferase(3mst) in complex with compound1 0.9592 3 268
8q5z-assembly1.cif.gz_A crystal structure of bovine thiosulfate sulfurtransferase 0.9584 3 268
8bgq-assembly1.cif.gz_A error: 404 client error: for url: https://data.rcsb.org/rest/v1/core/entry/8bgq 0.9584 3 268
8agf-assembly1.cif.gz_A crystal structure of human thiosulfate sulfurtransferase amino acids 2-297 0.9573 1 268
1boi-assembly1.cif.gz_A n-terminally truncated rhodanese 0.9567 4 268
ID Description Score Start End Superfamily
af_Q24JL3_210_336_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9633 151 271 3.40.250.10
af_Q54E40_194_325_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9571 147 265 3.40.250.10
af_F1Q9K6_160_299_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9564 147 269 3.40.250.10
af_A0A1D6KFY9_106_247_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9529 1 133 3.40.250.10
5wqjB01 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9523 3 145 3.40.250.10
ID Description Score Start End GO Terms
AF-A0A6G7YQY9-F1-model_v4 Sulfurtransferase 0.9924 1 277 GO:0004792
AF-A0A6G7YQY9-F1-model_v4 Sulfurtransferase 0.9888 1 277 GO:0004792
AF-A0A3D0R8E5-F1-model_v4 Sulfurtransferase 0.9867 164 277 GO:0004792
AF-A0A3B0RPH8-F1-model_v4 3-mercaptopyruvate sulfurtransferase (EC 2.8.1.2) 0.9829 1 274 GO:0004792
GO:0005739
GO:0016784
AF-A0A6M4ASG8-F1-model_v4 Sulfurtransferase 0.9822 1 277 GO:0004792

Map