F447760

General Info

Members Datasets Scaffolds Average Seq Length
456 223 912 628

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10039114|Ga0105241_100391142
Length 680
Sequence MNRLHVITFRLLIFAVALSSCLVARTLAQKPTPSPSSQAATKPDDKAGKKEEQENPFAPEPAGXXXXGMTGADTNDPRAKLTPGFYNAGETSLGLKHLLLVKKPAAFQLGSDNPDDPKVQKILGQMGNPAQLAQVPKGVQLVIAQLAFANSDIAFQGNHLFQGNFYGLSIYDISNPAKASLLTTMICPGGQNDVSVYKNLLFMSVEMANGRLDCGTQGFPPAPAPAKEPAKDEKPSPPAAQKDRFRGVRIFDITDIKNPKQVAAIQTCRGSHTHTLVTDPNDKDNVYVYVSGTSFVRQNEELAGCSGEEPEKDPNTSLFRIDVIKVPLASPQDAKIVSSPRLFMDPATGKLDALSNGGSHGKNGPEKPEASNQCHDITAYSAIGLAAGACSGNGILIDIKDPANPKRLDAVNDPNYAYWHSASFSNDGKKLVFTDEWGGGLGARCRPNDPIKWGADSIFHVNDNKMKFASYYKMPAAQGDSENCVAHNGSLVPIPGRDILVQAWYQGGISIVDFTDAEHPVEIGYFDRGPINPNMLILGGDWSAYWYNGHVYSSEIARGLDVFELTPTKFLTQNEINAAKSVQVAELNVQNQQKIEWPRTLVVAKAYLDQLERSQALPADQIASVRAAIQSVENTQTNHAGQGKLKDLASAMETSAGAAKNAADSKRLHELAEILKNPAH

Samples

Sample ID Description Type Environment
1 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
106 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
165 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
173 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
180 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
181 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
182 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
183 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
184 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
185 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
186 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
187 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
188 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
189 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
192 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
203 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
204 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
207 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
208 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
209 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
210 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
211 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
212 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
213 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
214 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
215 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
216 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
221 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.68
Metatranscriptomes 1.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.73
Rhizosphere 95.83
Stem 0
Stem Tuber 0
Unclassified 5.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105241_10039114 3300009174 Bacteria 3577
2 CNAas_1000054 3300000532 Bacteria 8215
3 LJNas_1000324 3300000546 Bacteria 8362
4 LJNas_1000899 3300000546 Bacteria 4841
5 JGI24748J21848_1000022 3300002074 Bacteria 106580
6 JGI24034J26672_10000026 3300002239 Bacteria 109498
7 JGI24751J29686_10000233 3300002459 Bacteria 22750
8 Ga0058863_10010571 3300004799 Bacteria 2806
9 Ga0058861_12046805 3300004800 Bacteria 2864
10 Ga0065714_10002183 3300005288 Bacteria 378167
11 Ga0065704_10095039 3300005289 Bacteria 2509
12 Ga0065712_10000030 3300005290 Bacteria 237869
13 Ga0065715_10001299 3300005293 Bacteria 6573
14 Ga0065715_10090182 3300005293 Bacteria 7505
15 Ga0065715_10104828 3300005293 Bacteria 2933
16 Ga0065707_10004703 3300005295 Bacteria 4556
17 Ga0070658_10012595 3300005327 Bacteria 6784
18 Ga0070690_100004590 3300005330 Bacteria 7679
19 Ga0070690_100045396 3300005330 Bacteria 2791
20 Ga0070690_100063557 3300005330 Bacteria 2382
21 Ga0070670_100000227 3300005331 Bacteria 51904
22 Ga0070666_10034436 3300005335 Bacteria 3357
23 Ga0070680_100005929 3300005336 Bacteria 9271
24 Ga0070680_100081159 3300005336 Bacteria 2676
25 Ga0070680_100092672 3300005336 Bacteria 2502
26 Ga0070682_100004472 3300005337 Bacteria 7765
27 Ga0070682_100013988 3300005337 Bacteria 4630
28 Ga0070660_100012330 3300005339 Bacteria 6103
29 Ga0070689_100000656 3300005340 Bacteria 20892
30 Ga0070689_100026512 3300005340 Bacteria 4364
31 Ga0070689_100091021 3300005340 Bacteria 2404
32 Ga0070687_100047901 3300005343 Bacteria 2195
33 Ga0070692_10014709 3300005345 Bacteria 3684
34 Ga0070692_10025214 3300005345 Bacteria 2929
35 Ga0070669_100056523 3300005353 Unclassified 2877
36 Ga0070671_100018722 3300005355 Bacteria 5628
37 Ga0070671_100073831 3300005355 Bacteria 2849
38 Ga0070671_100074762 3300005355 Bacteria 2831
39 Ga0070673_100001252 3300005364 Bacteria 14759
40 Ga0070673_100016050 3300005364 Bacteria 5283
41 Ga0070659_100003156 3300005366 Bacteria 11740
42 Ga0070667_100036330 3300005367 Bacteria 4130
43 Ga0070703_10000120 3300005406 Bacteria 41011
44 Ga0070703_10015261 3300005406 Bacteria 2198
45 Ga0070709_10000122 3300005434 Bacteria 51609
46 Ga0070709_10002718 3300005434 Bacteria 9561
47 Ga0070714_100075064 3300005435 Bacteria 2933
48 Ga0070714_100105416 3300005435 Bacteria 2489
49 Ga0070713_100024011 3300005436 Bacteria 4741
50 Ga0070710_10002921 3300005437 Bacteria 8126
51 Ga0070711_100000015 3300005439 Bacteria 154719
52 Ga0070711_100010735 3300005439 Bacteria 5677
53 Ga0070705_100000254 3300005440 Bacteria 31739
54 Ga0070705_100012878 3300005440 Bacteria 4266
55 Ga0070700_100000110 3300005441 Bacteria 52465
56 Ga0070700_100007453 3300005441 Bacteria 5911
57 Ga0070694_100017982 3300005444 Bacteria 4477
58 Ga0070694_100026002 3300005444 Bacteria 3791
59 Ga0070662_100043936 3300005457 Bacteria 3200
60 Ga0070681_10001179 3300005458 Bacteria 22582
61 Ga0070681_10001264 3300005458 Bacteria 22044
62 Ga0070681_10060593 3300005458 Bacteria 3760
63 Ga0070681_10067975 3300005458 Bacteria 3531
64 Ga0070681_10076418 3300005458 Bacteria 3307
65 Ga0068867_100068520 3300005459 Bacteria 2648
66 Ga0068867_100072736 3300005459 Bacteria 2574
67 Ga0070706_100000307 3300005467 Bacteria 59485
68 Ga0070706_100033203 3300005467 Bacteria 4763
69 Ga0070707_100000536 3300005468 Bacteria 37935
70 Ga0070707_100027575 3300005468 Bacteria 5404
71 Ga0070707_100048522 3300005468 Bacteria 4066
72 Ga0070698_100030078 3300005471 Bacteria 5635
73 Ga0070698_100032579 3300005471 Bacteria 5397
74 Ga0070698_100035985 3300005471 Bacteria 5118
75 Ga0070698_100045581 3300005471 Bacteria 4488
76 Ga0070698_100047078 3300005471 Bacteria 4409
77 Ga0070698_100065727 3300005471 Bacteria 3651
78 Ga0070699_100000022 3300005518 Bacteria 162893
79 Ga0070699_100043576 3300005518 Bacteria 3883
80 Ga0070679_100000108 3300005530 Bacteria 65441
81 Ga0070679_100156891 3300005530 Bacteria 2250
82 Ga0068853_100011635 3300005539 Bacteria 7152
83 Ga0068853_100027987 3300005539 Bacteria 4740
84 Ga0068853_100070291 3300005539 Bacteria 3047
85 Ga0068853_100085736 3300005539 Bacteria 2761
86 Ga0070686_100042945 3300005544 Bacteria 2834
87 Ga0070695_100040638 3300005545 Bacteria 2945
88 Ga0070696_100018183 3300005546 Bacteria 4748
89 Ga0070696_100028027 3300005546 Unclassified 3842
90 Ga0070693_100002617 3300005547 Bacteria 8287
91 Ga0070693_100040219 3300005547 Bacteria 2624
92 Ga0070665_100003294 3300005548 Bacteria 17313
93 Ga0070704_100008990 3300005549 Bacteria 6021
94 Ga0070704_100023030 3300005549 Bacteria 4060
95 Ga0068855_100149351 3300005563 Bacteria 2657
96 Ga0070664_100000979 3300005564 Bacteria 22356
97 Ga0070664_100033483 3300005564 Bacteria 4305
98 Ga0068857_100001403 3300005577 Bacteria 19017
99 Ga0068857_100030673 3300005577 Bacteria 4748
100 Ga0068854_100032383 3300005578 Bacteria 3637
101 Ga0068854_100042934 3300005578 Bacteria 3203
102 Ga0068854_100058289 3300005578 Bacteria 2787
103 Ga0070702_100016329 3300005615 Bacteria 3807
104 Ga0068852_100003592 3300005616 Bacteria 10856
105 Ga0068859_100005956 3300005617 Bacteria 12379
106 Ga0068859_100012032 3300005617 Bacteria 8691
107 Ga0068859_100047942 3300005617 Bacteria 4292
108 Ga0068859_100050099 3300005617 Bacteria 4195
109 Ga0068859_100057276 3300005617 Bacteria 3925
110 Ga0068859_100120027 3300005617 Bacteria 2696
111 Ga0068864_100006849 3300005618 Bacteria 9335
112 Ga0068864_100023085 3300005618 Bacteria 5223
113 Ga0068864_100026147 3300005618 Bacteria 4920
114 Ga0068861_100003427 3300005719 Bacteria 10525
115 Ga0068861_100004453 3300005719 Bacteria 9406
116 Ga0068861_100005318 3300005719 Bacteria 8692
117 Ga0068851_10028962 3300005834 Bacteria 2739
118 Ga0068863_100055360 3300005841 Bacteria 3756
119 Ga0068858_100003191 3300005842 Bacteria 16382
120 Ga0068858_100058269 3300005842 Bacteria 3571
121 Ga0068860_100010295 3300005843 Bacteria 9251
122 Ga0068860_100021340 3300005843 Bacteria 6270
123 Ga0068860_100022707 3300005843 Bacteria 6065
124 Ga0068860_100060101 3300005843 Unclassified 3613
125 Ga0068860_100078435 3300005843 Bacteria 3141
126 Ga0068860_100148689 3300005843 Bacteria 2255
127 Ga0068860_100167897 3300005843 Bacteria 2119
128 Ga0068862_100026434 3300005844 Bacteria 4878
129 Ga0068862_100028189 3300005844 Bacteria 4728
130 Ga0068862_100039175 3300005844 Bacteria 4024
131 Ga0081455_10082126 3300005937 Unclassified 2637
132 Ga0081540_1001796 3300005983 Bacteria 17998
133 Ga0081539_10000647 3300005985 Bacteria 70112
134 Ga0081539_10001129 3300005985 Bacteria 48420
135 Ga0075432_10004792 3300006058 Bacteria 4602
136 Ga0070715_10018968 3300006163 Bacteria 2630
137 Ga0070712_100069599 3300006175 Bacteria 2511
138 Ga0097621_100007316 3300006237 Bacteria 7890
139 Ga0097621_100010579 3300006237 Bacteria 6758
140 Ga0097621_100014670 3300006237 Bacteria 5871
141 Ga0097621_100034612 3300006237 Bacteria 4030
142 Ga0097621_100041678 3300006237 Unclassified 3696
143 Ga0068871_100001485 3300006358 Bacteria 15720
144 Ga0068871_100009585 3300006358 Bacteria 7029
145 Ga0068871_100029488 3300006358 Bacteria 4310
146 Ga0075433_10068181 3300006852 Bacteria 3123
147 Ga0075433_10072823 3300006852 Bacteria 3022
148 Ga0075433_10085887 3300006852 Bacteria 2778
149 Ga0075433_10095331 3300006852 Bacteria 2633
150 Ga0075429_100056079 3300006880 Bacteria 3429
151 Ga0068865_100051435 3300006881 Bacteria 2852
152 Ga0075436_100000586 3300006914 Bacteria 23812
153 Ga0075436_100004788 3300006914 Bacteria 9295
154 Ga0075436_100021172 3300006914 Bacteria 4462
155 Ga0097620_100005956 3300006931 Bacteria 12379
156 Ga0097620_100012032 3300006931 Bacteria 8691
157 Ga0097620_100047946 3300006931 Bacteria 4292
158 Ga0097620_100050099 3300006931 Bacteria 4195
159 Ga0097620_100057288 3300006931 Bacteria 3925
160 Ga0097620_100120030 3300006931 Bacteria 2696
161 Ga0075435_100052586 3300007076 Bacteria 3282
162 Ga0075435_100073388 3300007076 Bacteria 2797
163 Ga0105240_10134121 3300009093 Bacteria 2966
164 Ga0111539_10012348 3300009094 Bacteria 10704
165 Ga0111539_10026186 3300009094 Bacteria 7136
166 Ga0111539_10037847 3300009094 Bacteria 5820
167 Ga0105245_10012107 3300009098 Bacteria 7502
168 Ga0105247_10000047 3300009101 Bacteria 151385
169 Ga0105247_10001848 3300009101 Bacteria 14804
170 Ga0114129_10001025 3300009147 Bacteria 36471
171 Ga0114129_10057937 3300009147 Bacteria 5420
172 Ga0114129_10066317 3300009147 Bacteria 5036
173 Ga0114129_10081283 3300009147 Bacteria 4504
174 Ga0114129_10136548 3300009147 Bacteria 3365
175 Ga0114129_10183793 3300009147 Unclassified 2843
176 Ga0105243_10027219 3300009148 Bacteria 4380
177 Ga0105241_10033119 3300009174 Bacteria 3878
178 Ga0105242_10000784 3300009176 Bacteria 24671
179 Ga0105242_10008669 3300009176 Bacteria 7803
180 Ga0105248_10001318 3300009177 Bacteria 27655
181 Ga0105248_10001795 3300009177 Bacteria 23869
182 Ga0105248_10042522 3300009177 Bacteria 5096
183 Ga0105248_10047522 3300009177 Bacteria 4813
184 Ga0105248_10053560 3300009177 Bacteria 4527
185 Ga0105237_10001943 3300009545 Bacteria 26329
186 Ga0105238_10001915 3300009551 Bacteria 20880
187 Ga0105238_10009748 3300009551 Bacteria 9617
188 Ga0105238_10018750 3300009551 Bacteria 7047
189 Ga0105238_10020577 3300009551 Bacteria 6720
190 Ga0105249_10036506 3300009553 Bacteria 4458
191 Ga0105249_10054128 3300009553 Bacteria 3669
192 Ga0105249_10065837 3300009553 Bacteria 3335
193 Ga0105239_10032850 3300010375 Bacteria 5702
194 Ga0105239_10050562 3300010375 Bacteria 4558
195 Ga0157370_10035137 3300013104 Bacteria 4874
196 Ga0157369_10000299 3300013105 Bacteria 66242
197 Ga0157369_10097630 3300013105 Bacteria 3134
198 Ga0157369_10105556 3300013105 Bacteria 2999
199 Ga0157369_10108389 3300013105 Unclassified 2954
200 Ga0157374_10015770 3300013296 Bacteria 6636
201 Ga0157374_10026981 3300013296 Bacteria 5174
202 Ga0157374_10052404 3300013296 Bacteria 3800
203 Ga0157378_10000185 3300013297 Bacteria 59863
204 Ga0157378_10001622 3300013297 Bacteria 20343
205 Ga0157378_10004763 3300013297 Bacteria 11892
206 Ga0157378_10018605 3300013297 Bacteria 6108
207 Ga0157378_10038202 3300013297 Unclassified 4254
208 Ga0157378_10050308 3300013297 Bacteria 3708
209 Ga0157378_10093084 3300013297 Bacteria 2743
210 Ga0163162_10007217 3300013306 Bacteria 10788
211 Ga0163162_10009768 3300013306 Bacteria 9342
212 Ga0163162_10016181 3300013306 Bacteria 7294
213 Ga0163162_10065471 3300013306 Bacteria 3681
214 Ga0163162_10071056 3300013306 Bacteria 3533
215 Ga0163162_10071242 3300013306 Bacteria 3528
216 Ga0157372_10019811 3300013307 Bacteria 7250
217 Ga0157372_10030394 3300013307 Bacteria 5911
218 Ga0157372_10058722 3300013307 Bacteria 4301
219 Ga0157372_10116564 3300013307 Bacteria 3063
220 Ga0157375_10005030 3300013308 Bacteria 11483
221 Ga0163163_10000277 3300014325 Bacteria 51205
222 Ga0163163_10004232 3300014325 Bacteria 12232
223 Ga0163163_10009450 3300014325 Bacteria 8706
224 Ga0163163_10015192 3300014325 Bacteria 7111
225 Ga0163163_10096911 3300014325 Bacteria 2970
226 Ga0157380_10000337 3300014326 Bacteria 27979
227 Ga0157380_10009532 3300014326 Bacteria 6965
228 Ga0157380_10043328 3300014326 Bacteria 3523
229 Ga0157379_10048417 3300014968 Bacteria 3794
230 Ga0157379_10080344 3300014968 Bacteria 2921
231 Ga0157376_10000028 3300014969 Bacteria 202069
232 Ga0157376_10001905 3300014969 Bacteria 13928
233 Ga0157376_10005115 3300014969 Bacteria 9144
234 Ga0157376_10125348 3300014969 Bacteria 2283
235 Ga0163161_10003914 3300017792 Bacteria 10444
236 Ga0163161_10015643 3300017792 Bacteria 5292
237 Ga0163161_10049833 3300017792 Bacteria 3028
238 Ga0213872_10004255 3300021361 Bacteria 7674
239 Ga0207672_1000675 3300025223 Bacteria 3932
240 Ga0207653_10000025 3300025885 Bacteria 116998
241 Ga0207653_10017382 3300025885 Bacteria 2264
242 Ga0207692_10001867 3300025898 Bacteria 7999
243 Ga0207692_10037250 3300025898 Bacteria 2378
244 Ga0207710_10000001 3300025900 Bacteria 1797433
245 Ga0207647_10005687 3300025904 Bacteria 9102
246 Ga0207699_10000006 3300025906 Bacteria 430147
247 Ga0207699_10003823 3300025906 Bacteria 7185
248 Ga0207705_10007458 3300025909 Bacteria 8042
249 Ga0207684_10000378 3300025910 Bacteria 60505
250 Ga0207684_10005436 3300025910 Bacteria 11749
251 Ga0207654_10011719 3300025911 Bacteria 4476
252 Ga0207707_10000053 3300025912 Bacteria 116823
253 Ga0207707_10004264 3300025912 Bacteria 12656
254 Ga0207707_10010418 3300025912 Bacteria 8066
255 Ga0207707_10051587 3300025912 Bacteria 3582
256 Ga0207695_10096871 3300025913 Bacteria 2951
257 Ga0207671_10001235 3300025914 Bacteria 30209
258 Ga0207693_10029003 3300025915 Bacteria 4374
259 Ga0207693_10065212 3300025915 Bacteria 2852
260 Ga0207663_10000016 3300025916 Bacteria 147239
261 Ga0207663_10027414 3300025916 Bacteria 3320
262 Ga0207660_10005724 3300025917 Bacteria 8064
263 Ga0207660_10024763 3300025917 Bacteria 4065
264 Ga0207660_10084988 3300025917 Bacteria 2333
265 Ga0207662_10024635 3300025918 Unclassified 3463
266 Ga0207649_10035438 3300025920 Bacteria 2999
267 Ga0207652_10000069 3300025921 Bacteria 109874
268 Ga0207652_10017050 3300025921 Bacteria 5941
269 Ga0207646_10030000 3300025922 Bacteria 4936
270 Ga0207646_10053453 3300025922 Bacteria 3613
271 Ga0207646_10111356 3300025922 Bacteria 2457
272 Ga0207681_10006979 3300025923 Bacteria 6931
273 Ga0207694_10003221 3300025924 Bacteria 13003
274 Ga0207650_10000027 3300025925 Bacteria 257466
275 Ga0207650_10002965 3300025925 Bacteria 11714
276 Ga0207650_10038731 3300025925 Bacteria 3483
277 Ga0207687_10069970 3300025927 Unclassified 2504
278 Ga0207664_10035639 3300025929 Bacteria 3841
279 Ga0207644_10007103 3300025931 Bacteria 7300
280 Ga0207644_10016370 3300025931 Bacteria 4989
281 Ga0207690_10017309 3300025932 Bacteria 4399
282 Ga0207706_10090029 3300025933 Bacteria 2698
283 Ga0207686_10000141 3300025934 Bacteria 56428
284 Ga0207686_10000380 3300025934 Bacteria 30978
285 Ga0207709_10006654 3300025935 Bacteria 6485
286 Ga0207709_10014486 3300025935 Bacteria 4355
287 Ga0207670_10002000 3300025936 Bacteria 10696
288 Ga0207670_10030590 3300025936 Bacteria 3440
289 Ga0207704_10044204 3300025938 Bacteria 2637
290 Ga0207665_10046863 3300025939 Bacteria 2897
291 Ga0207691_10033086 3300025940 Unclassified 4815
292 Ga0207711_10011575 3300025941 Bacteria 7333
293 Ga0207689_10010175 3300025942 Bacteria 8105
294 Ga0207689_10027833 3300025942 Bacteria 4730
295 Ga0207689_10041992 3300025942 Bacteria 3784
296 Ga0207679_10010218 3300025945 Bacteria 6038
297 Ga0207667_10070332 3300025949 Bacteria 3642
298 Ga0207667_10083563 3300025949 Bacteria 3306
299 Ga0207651_10002037 3300025960 Bacteria 9505
300 Ga0207651_10043045 3300025960 Bacteria 3011
301 Ga0207712_10002644 3300025961 Bacteria 11467
302 Ga0207712_10019033 3300025961 Bacteria 4480
303 Ga0207712_10044103 3300025961 Bacteria 3080
304 Ga0207703_10000186 3300026035 Bacteria 72779
305 Ga0207708_10000028 3300026075 Bacteria 164263
306 Ga0207708_10009616 3300026075 Bacteria 7168
307 Ga0207708_10014279 3300026075 Bacteria 5941
308 Ga0207641_10004029 3300026088 Bacteria 12817
309 Ga0207641_10036642 3300026088 Bacteria 4094
310 Ga0207641_10130448 3300026088 Bacteria 2256
311 Ga0207648_10056570 3300026089 Bacteria 3423
312 Ga0207648_10082756 3300026089 Unclassified 2799
313 Ga0207674_10010021 3300026116 Bacteria 10782
314 Ga0207674_10015569 3300026116 Bacteria 8351
315 Ga0207674_10044681 3300026116 Bacteria 4562
316 Ga0207675_100007762 3300026118 Bacteria 10123
317 Ga0207675_100022254 3300026118 Bacteria 5903
318 Ga0207675_100028240 3300026118 Bacteria 5224
319 Ga0207675_100106589 3300026118 Bacteria 2642
320 Ga0207683_10088570 3300026121 Unclassified 2754
321 Ga0207428_10008708 3300027907 Bacteria 9156
322 Ga0207428_10069365 3300027907 Bacteria 2772
323 Ga0265354_1000124 3300028016 Bacteria 13560
324 Ga0265354_1001567 3300028016 Bacteria 3211
325 Ga0268266_10000490 3300028379 Bacteria 56757
326 Ga0268265_10008047 3300028380 Bacteria 7120
327 Ga0268264_10001916 3300028381 Bacteria 18796
328 Ga0268264_10015240 3300028381 Bacteria 6306
329 Ga0268264_10035899 3300028381 Unclassified 4082
330 Ga0268264_10044878 3300028381 Bacteria 3668
331 Ga0268264_10051109 3300028381 Bacteria 3443
332 Ga0268264_10143478 3300028381 Unclassified 2132
333 Ga0265770_1000913 3300030878 Bacteria 4104
334 Ga0265760_10003800 3300031090 Bacteria 4375
335 Ga0265760_10009339 3300031090 Bacteria 2803
336 Ga0265760_10013812 3300031090 Bacteria 2312
337 Ga0307408_100030359 3300031548 Bacteria 3753
338 Ga0307408_100093035 3300031548 Bacteria 2280
339 Ga0307405_10003199 3300031731 Bacteria 7460
340 Ga0307405_10018372 3300031731 Bacteria 3856
341 Ga0307413_10001683 3300031824 Bacteria 8610
342 Ga0307413_10005641 3300031824 Bacteria 5614
343 Ga0307413_10029069 3300031824 Bacteria 3087
344 Ga0307410_10005645 3300031852 Bacteria 6653
345 Ga0307410_10009669 3300031852 Bacteria 5422
346 Ga0307410_10009763 3300031852 Bacteria 5401
347 Ga0307410_10010267 3300031852 Bacteria 5293
348 Ga0307410_10026916 3300031852 Unclassified 3627
349 Ga0307406_10005945 3300031901 Bacteria 6698
350 Ga0307406_10061668 3300031901 Bacteria 2423
351 Ga0307407_10003220 3300031903 Bacteria 6632
352 Ga0307407_10027290 3300031903 Bacteria 3036
353 Ga0307412_10015422 3300031911 Bacteria 4532
354 Ga0307412_10036061 3300031911 Bacteria 3165
355 Ga0307412_10047206 3300031911 Bacteria 2827
356 Ga0307409_100002896 3300031995 Bacteria 9101
357 Ga0307409_100010496 3300031995 Bacteria 5764
358 Ga0307409_100099953 3300031995 Bacteria 2404
359 Ga0307409_100104630 3300031995 Bacteria 2358
360 Ga0307409_100133029 3300031995 Bacteria 2129
361 Ga0307416_100018888 3300032002 Unclassified 4872
362 Ga0307416_100032270 3300032002 Bacteria 3954
363 Ga0307416_100078952 3300032002 Bacteria 2772
364 Ga0307416_100102387 3300032002 Bacteria 2497
365 Ga0307416_100131442 3300032002 Bacteria 2254
366 Ga0307414_10032762 3300032004 Unclassified 3426
367 Ga0307411_10001591 3300032005 Bacteria 9425
368 Ga0307411_10005110 3300032005 Bacteria 6403
369 Ga0307411_10031315 3300032005 Bacteria 3271
370 Ga0307411_10036560 3300032005 Unclassified 3078
371 Ga0307411_10087852 3300032005 Bacteria 2160
372 Ga0307415_100004561 3300032126 Bacteria 7215
373 Ga0307415_100037702 3300032126 Unclassified 3179
374 Ga0307415_100038601 3300032126 Bacteria 3149
375 Ga0307415_100050999 3300032126 Bacteria 2806
376 Ga0307415_100095340 3300032126 Bacteria 2166
377 Ga0373923_0004867 3300035111 Bacteria 4502
378 Ga0373946_0000971 3300035171 Bacteria 9827
379 Ga0373924_0000916 3300035410 Bacteria 9309
380 Ga0373927_0002392 3300035695 Bacteria 13683
381 Ga0373937_0012200 3300036401 Bacteria 7546
382 Ga0373925_0001360 3300037068 Bacteria 21324
383 Ga0395898_0010893 3300037466 Bacteria 9489
384 Ga0395901_0124237 3300038443 Bacteria 2712
385 Ga0436361_0674098 3300039447 Bacteria 28247
386 Ga0466963_0000731 3300044694 Bacteria 16142
387 Ga0466963_0051524 3300044694 Bacteria 2729
388 Ga0466957_0000197 3300044842 Bacteria 27875
389 Ga0466959_0004484 3300045049 Bacteria 9356
390 Ga0466967_0008804 3300045976 Bacteria 7438
391 Ga0495580_0008515 3300046472 Bacteria 8152
392 Ga0495580_0010983 3300046472 Bacteria 7019
393 Ga0495580_0017692 3300046472 Bacteria 5323
394 Ga0495580_0033263 3300046472 Bacteria 3716
395 Ga0495628_0015344 3300046516 Bacteria 6397
396 Ga0495630_0025374 3300046517 Bacteria 4382
397 Ga0495630_0027078 3300046517 Bacteria 4249
398 Ga0495621_0003491 3300046539 Bacteria 4341
399 Ga0495668_0000430 3300046616 Bacteria 54487
400 Ga0495647_0040264 3300046681 Bacteria 1775
401 Ga0495674_0019344 3300047319 Bacteria 6319
402 Ga0495675_0041050 3300047444 Bacteria 2949
403 Ga0496100_0030307 3300048903 Bacteria 3355
404 Ga0496102_0015227 3300048905 Bacteria 6695
405 Ga0496102_0024312 3300048905 Bacteria 5385
406 Ga0496102_0177522 3300048905 Bacteria 2006
407 Ga0496104_0034932 3300048907 Bacteria 4691
408 Ga0496105_0001711 3300048908 Bacteria 15668
409 Ga0496105_0113147 3300048908 Bacteria 2240
410 Ga0496106_0010642 3300048909 Bacteria 6797
411 Ga0496106_0043050 3300048909 Bacteria 3387
412 Ga0496106_0064643 3300048909 Bacteria 2784
413 Ga0496107_0087334 3300048910 Bacteria 2277
414 Ga0496108_0016499 3300048911 Bacteria 6028
415 Ga0496109_0000050 3300048912 Bacteria 126918
416 Ga0496109_0141948 3300048912 Bacteria 2246
417 Ga0496114_0003663 3300048917 Bacteria 11824
418 Ga0496114_0018686 3300048917 Bacteria 5609
419 Ga0496115_0018235 3300048918 Bacteria 5384
420 Ga0496126_0000029 3300048929 Bacteria 389370
421 Ga0496126_0020498 3300048929 Bacteria 6477
422 Ga0501298_001346 3300049521 Bacteria 3609
423 Ga0501299_002504 3300049522 Bacteria 2547
424 Ga0501038_0008149 3300049574 Bacteria 9644
425 Ga0501072_0015425 3300049588 Bacteria 5857
426 Ga0501202_001202 3300049652 Bacteria 4081
427 Ga0501217_001146 3300049661 Bacteria 4858
428 Ga0501227_001292 3300049665 Bacteria 5618
429 Ga0501239_000067 3300049672 Bacteria 6497
430 Ga0501249_001223 3300049679 Bacteria 5389
431 Ga0501249_001541 3300049679 Unclassified 4719
432 Ga0501225_0001258 3300049705 Bacteria 7867
433 Ga0501234_001197 3300049707 Bacteria 4096
434 Ga0501263_000627 3300049760 Bacteria 2809
435 Ga0501268_000582 3300049765 Bacteria 4060
436 Ga0501270_000328 3300049767 Unclassified 4126
437 nmdc:mga05p37_11343_c1 3300050507 Bacteria 10600
438 nmdc:mga05p37_161897_c1 3300050507 Bacteria 2732
439 nmdc:mga05p37_256_c1 3300050507 Bacteria 54932
440 nmdc:mga05p37_86456_c1 3300050507 Unclassified 3864
441 nmdc:mga06r32_232644_c1 3300050510 Bacteria 1831
442 nmdc:mga06r32_8985_c1 3300050510 Bacteria 9002
443 nmdc:mga08y16_109971_c1 3300050511 Bacteria 2870
444 nmdc:mga08y16_155591_c1 3300050511 Bacteria 2376
445 nmdc:mga08y16_1618_c1 3300050511 Bacteria 22810
446 nmdc:mga08y16_35423_c1 3300050511 Bacteria 5241
447 nmdc:mga0n895_35452_c1 3300050512 Bacteria 4810
448 nmdc:mga08x19_156_c1 3300050514 Bacteria 56117
449 nmdc:mga08x19_32_c1 3300050514 Bacteria 203770
450 nmdc:mga08x19_4366_c1 3300050514 Bacteria 8384
451 nmdc:mga0a205_188308_c1 3300050515 Bacteria 1956
452 nmdc:mga0a205_28878_c1 3300050515 Bacteria 5303
453 nmdc:mga0a205_29584_c1 3300050515 Bacteria 5242
454 nmdc:mga0a205_39038_c1 3300050515 Bacteria 4569
455 Ga0495601_0004740 3300053077 Bacteria 7884
456 Ga0495601_0020550 3300053077 Bacteria 4034
457 Ga0105241_10039114
458 CNAas_1000054
459 LJNas_1000324
460 LJNas_1000899
461 JGI24748J21848_1000022
462 JGI24034J26672_10000026
463 JGI24751J29686_10000233
464 Ga0058863_10010571
465 Ga0058861_12046805
466 Ga0065714_10002183
467 Ga0065704_10095039
468 Ga0065712_10000030
469 Ga0065715_10001299
470 Ga0065715_10090182
471 Ga0065715_10104828
472 Ga0065707_10004703
473 Ga0070658_10012595
474 Ga0070690_100004590
475 Ga0070690_100045396
476 Ga0070690_100063557
477 Ga0070670_100000227
478 Ga0070666_10034436
479 Ga0070680_100005929
480 Ga0070680_100081159
481 Ga0070680_100092672
482 Ga0070682_100004472
483 Ga0070682_100013988
484 Ga0070660_100012330
485 Ga0070689_100000656
486 Ga0070689_100026512
487 Ga0070689_100091021
488 Ga0070687_100047901
489 Ga0070692_10014709
490 Ga0070692_10025214
491 Ga0070669_100056523
492 Ga0070671_100018722
493 Ga0070671_100073831
494 Ga0070671_100074762
495 Ga0070673_100001252
496 Ga0070673_100016050
497 Ga0070659_100003156
498 Ga0070667_100036330
499 Ga0070703_10000120
500 Ga0070703_10015261
501 Ga0070709_10000122
502 Ga0070709_10002718
503 Ga0070714_100075064
504 Ga0070714_100105416
505 Ga0070713_100024011
506 Ga0070710_10002921
507 Ga0070711_100000015
508 Ga0070711_100010735
509 Ga0070705_100000254
510 Ga0070705_100012878
511 Ga0070700_100000110
512 Ga0070700_100007453
513 Ga0070694_100017982
514 Ga0070694_100026002
515 Ga0070662_100043936
516 Ga0070681_10001179
517 Ga0070681_10001264
518 Ga0070681_10060593
519 Ga0070681_10067975
520 Ga0070681_10076418
521 Ga0068867_100068520
522 Ga0068867_100072736
523 Ga0070706_100000307
524 Ga0070706_100033203
525 Ga0070707_100000536
526 Ga0070707_100027575
527 Ga0070707_100048522
528 Ga0070698_100030078
529 Ga0070698_100032579
530 Ga0070698_100035985
531 Ga0070698_100045581
532 Ga0070698_100047078
533 Ga0070698_100065727
534 Ga0070699_100000022
535 Ga0070699_100043576
536 Ga0070679_100000108
537 Ga0070679_100156891
538 Ga0068853_100011635
539 Ga0068853_100027987
540 Ga0068853_100070291
541 Ga0068853_100085736
542 Ga0070686_100042945
543 Ga0070695_100040638
544 Ga0070696_100018183
545 Ga0070696_100028027
546 Ga0070693_100002617
547 Ga0070693_100040219
548 Ga0070665_100003294
549 Ga0070704_100008990
550 Ga0070704_100023030
551 Ga0068855_100149351
552 Ga0070664_100000979
553 Ga0070664_100033483
554 Ga0068857_100001403
555 Ga0068857_100030673
556 Ga0068854_100032383
557 Ga0068854_100042934
558 Ga0068854_100058289
559 Ga0070702_100016329
560 Ga0068852_100003592
561 Ga0068859_100005956
562 Ga0068859_100012032
563 Ga0068859_100047942
564 Ga0068859_100050099
565 Ga0068859_100057276
566 Ga0068859_100120027
567 Ga0068864_100006849
568 Ga0068864_100023085
569 Ga0068864_100026147
570 Ga0068861_100003427
571 Ga0068861_100004453
572 Ga0068861_100005318
573 Ga0068851_10028962
574 Ga0068863_100055360
575 Ga0068858_100003191
576 Ga0068858_100058269
577 Ga0068860_100010295
578 Ga0068860_100021340
579 Ga0068860_100022707
580 Ga0068860_100060101
581 Ga0068860_100078435
582 Ga0068860_100148689
583 Ga0068860_100167897
584 Ga0068862_100026434
585 Ga0068862_100028189
586 Ga0068862_100039175
587 Ga0081455_10082126
588 Ga0081540_1001796
589 Ga0081539_10000647
590 Ga0081539_10001129
591 Ga0075432_10004792
592 Ga0070715_10018968
593 Ga0070712_100069599
594 Ga0097621_100007316
595 Ga0097621_100010579
596 Ga0097621_100014670
597 Ga0097621_100034612
598 Ga0097621_100041678
599 Ga0068871_100001485
600 Ga0068871_100009585
601 Ga0068871_100029488
602 Ga0075433_10068181
603 Ga0075433_10072823
604 Ga0075433_10085887
605 Ga0075433_10095331
606 Ga0075429_100056079
607 Ga0068865_100051435
608 Ga0075436_100000586
609 Ga0075436_100004788
610 Ga0075436_100021172
611 Ga0097620_100005956
612 Ga0097620_100012032
613 Ga0097620_100047946
614 Ga0097620_100050099
615 Ga0097620_100057288
616 Ga0097620_100120030
617 Ga0075435_100052586
618 Ga0075435_100073388
619 Ga0105240_10134121
620 Ga0111539_10012348
621 Ga0111539_10026186
622 Ga0111539_10037847
623 Ga0105245_10012107
624 Ga0105247_10000047
625 Ga0105247_10001848
626 Ga0114129_10001025
627 Ga0114129_10057937
628 Ga0114129_10066317
629 Ga0114129_10081283
630 Ga0114129_10136548
631 Ga0114129_10183793
632 Ga0105243_10027219
633 Ga0105241_10033119
634 Ga0105242_10000784
635 Ga0105242_10008669
636 Ga0105248_10001318
637 Ga0105248_10001795
638 Ga0105248_10042522
639 Ga0105248_10047522
640 Ga0105248_10053560
641 Ga0105237_10001943
642 Ga0105238_10001915
643 Ga0105238_10009748
644 Ga0105238_10018750
645 Ga0105238_10020577
646 Ga0105249_10036506
647 Ga0105249_10054128
648 Ga0105249_10065837
649 Ga0105239_10032850
650 Ga0105239_10050562
651 Ga0157370_10035137
652 Ga0157369_10000299
653 Ga0157369_10097630
654 Ga0157369_10105556
655 Ga0157369_10108389
656 Ga0157374_10015770
657 Ga0157374_10026981
658 Ga0157374_10052404
659 Ga0157378_10000185
660 Ga0157378_10001622
661 Ga0157378_10004763
662 Ga0157378_10018605
663 Ga0157378_10038202
664 Ga0157378_10050308
665 Ga0157378_10093084
666 Ga0163162_10007217
667 Ga0163162_10009768
668 Ga0163162_10016181
669 Ga0163162_10065471
670 Ga0163162_10071056
671 Ga0163162_10071242
672 Ga0157372_10019811
673 Ga0157372_10030394
674 Ga0157372_10058722
675 Ga0157372_10116564
676 Ga0157375_10005030
677 Ga0163163_10000277
678 Ga0163163_10004232
679 Ga0163163_10009450
680 Ga0163163_10015192
681 Ga0163163_10096911
682 Ga0157380_10000337
683 Ga0157380_10009532
684 Ga0157380_10043328
685 Ga0157379_10048417
686 Ga0157379_10080344
687 Ga0157376_10000028
688 Ga0157376_10001905
689 Ga0157376_10005115
690 Ga0157376_10125348
691 Ga0163161_10003914
692 Ga0163161_10015643
693 Ga0163161_10049833
694 Ga0213872_10004255
695 Ga0207672_1000675
696 Ga0207653_10000025
697 Ga0207653_10017382
698 Ga0207692_10001867
699 Ga0207692_10037250
700 Ga0207710_10000001
701 Ga0207647_10005687
702 Ga0207699_10000006
703 Ga0207699_10003823
704 Ga0207705_10007458
705 Ga0207684_10000378
706 Ga0207684_10005436
707 Ga0207654_10011719
708 Ga0207707_10000053
709 Ga0207707_10004264
710 Ga0207707_10010418
711 Ga0207707_10051587
712 Ga0207695_10096871
713 Ga0207671_10001235
714 Ga0207693_10029003
715 Ga0207693_10065212
716 Ga0207663_10000016
717 Ga0207663_10027414
718 Ga0207660_10005724
719 Ga0207660_10024763
720 Ga0207660_10084988
721 Ga0207662_10024635
722 Ga0207649_10035438
723 Ga0207652_10000069
724 Ga0207652_10017050
725 Ga0207646_10030000
726 Ga0207646_10053453
727 Ga0207646_10111356
728 Ga0207681_10006979
729 Ga0207694_10003221
730 Ga0207650_10000027
731 Ga0207650_10002965
732 Ga0207650_10038731
733 Ga0207687_10069970
734 Ga0207664_10035639
735 Ga0207644_10007103
736 Ga0207644_10016370
737 Ga0207690_10017309
738 Ga0207706_10090029
739 Ga0207686_10000141
740 Ga0207686_10000380
741 Ga0207709_10006654
742 Ga0207709_10014486
743 Ga0207670_10002000
744 Ga0207670_10030590
745 Ga0207704_10044204
746 Ga0207665_10046863
747 Ga0207691_10033086
748 Ga0207711_10011575
749 Ga0207689_10010175
750 Ga0207689_10027833
751 Ga0207689_10041992
752 Ga0207679_10010218
753 Ga0207667_10070332
754 Ga0207667_10083563
755 Ga0207651_10002037
756 Ga0207651_10043045
757 Ga0207712_10002644
758 Ga0207712_10019033
759 Ga0207712_10044103
760 Ga0207703_10000186
761 Ga0207708_10000028
762 Ga0207708_10009616
763 Ga0207708_10014279
764 Ga0207641_10004029
765 Ga0207641_10036642
766 Ga0207641_10130448
767 Ga0207648_10056570
768 Ga0207648_10082756
769 Ga0207674_10010021
770 Ga0207674_10015569
771 Ga0207674_10044681
772 Ga0207675_100007762
773 Ga0207675_100022254
774 Ga0207675_100028240
775 Ga0207675_100106589
776 Ga0207683_10088570
777 Ga0207428_10008708
778 Ga0207428_10069365
779 Ga0265354_1000124
780 Ga0265354_1001567
781 Ga0268266_10000490
782 Ga0268265_10008047
783 Ga0268264_10001916
784 Ga0268264_10015240
785 Ga0268264_10035899
786 Ga0268264_10044878
787 Ga0268264_10051109
788 Ga0268264_10143478
789 Ga0265770_1000913
790 Ga0265760_10003800
791 Ga0265760_10009339
792 Ga0265760_10013812
793 Ga0307408_100030359
794 Ga0307408_100093035
795 Ga0307405_10003199
796 Ga0307405_10018372
797 Ga0307413_10001683
798 Ga0307413_10005641
799 Ga0307413_10029069
800 Ga0307410_10005645
801 Ga0307410_10009669
802 Ga0307410_10009763
803 Ga0307410_10010267
804 Ga0307410_10026916
805 Ga0307406_10005945
806 Ga0307406_10061668
807 Ga0307407_10003220
808 Ga0307407_10027290
809 Ga0307412_10015422
810 Ga0307412_10036061
811 Ga0307412_10047206
812 Ga0307409_100002896
813 Ga0307409_100010496
814 Ga0307409_100099953
815 Ga0307409_100104630
816 Ga0307409_100133029
817 Ga0307416_100018888
818 Ga0307416_100032270
819 Ga0307416_100078952
820 Ga0307416_100102387
821 Ga0307416_100131442
822 Ga0307414_10032762
823 Ga0307411_10001591
824 Ga0307411_10005110
825 Ga0307411_10031315
826 Ga0307411_10036560
827 Ga0307411_10087852
828 Ga0307415_100004561
829 Ga0307415_100037702
830 Ga0307415_100038601
831 Ga0307415_100050999
832 Ga0307415_100095340
833 Ga0373923_0004867
834 Ga0373946_0000971
835 Ga0373924_0000916
836 Ga0373927_0002392
837 Ga0373937_0012200
838 Ga0373925_0001360
839 Ga0395898_0010893
840 Ga0395901_0124237
841 Ga0436361_0674098
842 Ga0466963_0000731
843 Ga0466963_0051524
844 Ga0466957_0000197
845 Ga0466959_0004484
846 Ga0466967_0008804
847 Ga0495580_0008515
848 Ga0495580_0010983
849 Ga0495580_0017692
850 Ga0495580_0033263
851 Ga0495628_0015344
852 Ga0495630_0025374
853 Ga0495630_0027078
854 Ga0495621_0003491
855 Ga0495668_0000430
856 Ga0495647_0040264
857 Ga0495674_0019344
858 Ga0495675_0041050
859 Ga0496100_0030307
860 Ga0496102_0015227
861 Ga0496102_0024312
862 Ga0496102_0177522
863 Ga0496104_0034932
864 Ga0496105_0001711
865 Ga0496105_0113147
866 Ga0496106_0010642
867 Ga0496106_0043050
868 Ga0496106_0064643
869 Ga0496107_0087334
870 Ga0496108_0016499
871 Ga0496109_0000050
872 Ga0496109_0141948
873 Ga0496114_0003663
874 Ga0496114_0018686
875 Ga0496115_0018235
876 Ga0496126_0000029
877 Ga0496126_0020498
878 Ga0501298_001346
879 Ga0501299_002504
880 Ga0501038_0008149
881 Ga0501072_0015425
882 Ga0501202_001202
883 Ga0501217_001146
884 Ga0501227_001292
885 Ga0501239_000067
886 Ga0501249_001223
887 Ga0501249_001541
888 Ga0501225_0001258
889 Ga0501234_001197
890 Ga0501263_000627
891 Ga0501268_000582
892 Ga0501270_000328
893 nmdc:mga05p37_11343_c1
894 nmdc:mga05p37_161897_c1
895 nmdc:mga05p37_256_c1
896 nmdc:mga05p37_86456_c1
897 nmdc:mga06r32_232644_c1
898 nmdc:mga06r32_8985_c1
899 nmdc:mga08y16_109971_c1
900 nmdc:mga08y16_155591_c1
901 nmdc:mga08y16_1618_c1
902 nmdc:mga08y16_35423_c1
903 nmdc:mga0n895_35452_c1
904 nmdc:mga08x19_156_c1
905 nmdc:mga08x19_32_c1
906 nmdc:mga08x19_4366_c1
907 nmdc:mga0a205_188308_c1
908 nmdc:mga0a205_28878_c1
909 nmdc:mga0a205_29584_c1
910 nmdc:mga0a205_39038_c1
911 Ga0495601_0004740
912 Ga0495601_0020550

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ce9-assembly2.cif.gz_D a wrpw peptide bound to the groucho-tle wd40 domain. 0.7499 115 526
5yzv-assembly1.cif.gz_B biophysical and structural characterization of the thermostable wd40 domain of a prokaryotic protein, thermomonospora curvata pkwa 0.7377 110 523
7fik-assembly1.cif.gz_h the cryo-em structure of the cr subunit from x. laevis npc 0.7363 205 514
6lk8-assembly1.cif.gz_H structure of xenopus laevis cytoplasmic ring subunit. 0.7338 205 530
5oa1-assembly1.cif.gz_V rna polymerase i pre-initiation complex 0.7277 110 526
ID Description Score Start End Superfamily
af_Q8I5L1_303_618_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7834 110 523 2.130.10.10
af_A0A1D8PLN7_10_148_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7686 334 491 2.130.10.10
af_A0A1D6IXS6_5_287_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.74 110 483 2.130.10.10
af_A0A571BF50_212_538_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7368 119 523 2.130.10.10
af_P54686_315_596_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7283 110 525 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A321M2E8-F1-model_v4 Secreted protein 0.9798 27 639 GO:0016020
AF-A0A2V9BJH3-F1-model_v4 Uncharacterized protein 0.9792 574 639
AF-A0A3D0P7C4-F1-model_v4 Uncharacterized protein 0.9741 300 639
AF-E8WVI1-F1-model_v4 Putative secreted protein 0.9734 22 598
AF-A0A2V8SFV1-F1-model_v4 DUF305 domain-containing protein 0.9732 24 639

Map