F447729

General Info

Members Datasets Scaffolds Average Seq Length
456 225 912 247

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100214330|Ga0068855_1002143302
Length 259
Sequence MARFVLVHGAFSGAWIWGPMTDCLMAAGHEVAAFDLPGLGDDKTPASEVTLDRCAGRLCEVLAAGSRPAIVVGNSMGGVIATQAAARCPERVAALVYATAFLPKNGQSLLDLTKLPEGAGDQVQANIIIEGDPPLATMPAAASRRALYGSCADDVAAWAIAQQRPQPIGPFLTPVSIPAGALDGINRYFVLCTRDRAIPLPLQRRMIAENICDDVVELDTDHTPHLSMTEKLAEVLDQFAAHASTNGKKARGATQSVNG

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
84 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
130 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
131 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
132 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
133 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
139 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
140 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
148 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
149 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
152 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
153 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
158 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
159 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
160 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
161 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
162 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
163 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
195 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
196 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
203 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
204 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
205 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
206 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
207 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
208 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
213 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
217 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
218 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
219 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
220 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
221 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
222 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
223 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
225 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.97
Nodule 0
Rhizoplane 10.31
Rhizosphere 87.5
Stem 0
Stem Tuber 0
Unclassified 20.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100214330 3300005563 Bacteria 2162
2 JGI25153J46596_10002424 3300003215 Bacteria 10754
3 Ga0070658_10000010 3300005327 Bacteria 297212
4 Ga0070658_10043263 3300005327 Bacteria 3638
5 Ga0070658_10249301 3300005327 Bacteria 1506
6 Ga0070658_10279799 3300005327 Bacteria 1420
7 Ga0070658_10375166 3300005327 Unclassified 1220
8 Ga0070658_10437667 3300005327 Unclassified 1126
9 Ga0070658_10482573 3300005327 Unclassified 1070
10 Ga0070676_10206197 3300005328 Unclassified 1291
11 Ga0070683_100133345 3300005329 Bacteria 2351
12 Ga0070683_100192789 3300005329 Bacteria 1935
13 Ga0070670_100158210 3300005331 Unclassified 1963
14 Ga0070680_100023498 3300005336 Bacteria 4917
15 Ga0070680_100066924 3300005336 Bacteria 2946
16 Ga0070680_100198378 3300005336 Bacteria 1692
17 Ga0070682_100049605 3300005337 Bacteria 2617
18 Ga0068868_100110684 3300005338 Unclassified 2231
19 Ga0068868_100399998 3300005338 Unclassified 1185
20 Ga0070660_100140780 3300005339 Bacteria 1935
21 Ga0070660_100183988 3300005339 Bacteria 1691
22 Ga0070689_100202991 3300005340 Bacteria 1619
23 Ga0070661_100001255 3300005344 Bacteria 17805
24 Ga0070661_100278787 3300005344 Bacteria 1296
25 Ga0070661_100685915 3300005344 Bacteria 834
26 Ga0070692_10182354 3300005345 Bacteria 1217
27 Ga0070673_100661054 3300005364 Unclassified 957
28 Ga0070688_100610360 3300005365 Unclassified 836
29 Ga0070667_100246310 3300005367 Bacteria 1597
30 Ga0070711_100025666 3300005439 Bacteria 3857
31 Ga0070711_100816023 3300005439 Bacteria 792
32 Ga0070708_100088041 3300005445 Bacteria 2822
33 Ga0070663_100114916 3300005455 Bacteria 2027
34 Ga0070663_100163045 3300005455 Bacteria 1717
35 Ga0070678_100007538 3300005456 Bacteria 6461
36 Ga0070678_100555952 3300005456 Bacteria 1019
37 Ga0070662_100150957 3300005457 Unclassified 1809
38 Ga0070681_10012979 3300005458 Bacteria 8274
39 Ga0070681_10014578 3300005458 Bacteria 7823
40 Ga0070681_10296575 3300005458 Bacteria 1526
41 Ga0068867_100338402 3300005459 Bacteria 1252
42 Ga0070706_100562810 3300005467 Bacteria 1060
43 Ga0070679_100005061 3300005530 Bacteria 12170
44 Ga0070679_100011822 3300005530 Bacteria 8326
45 Ga0070679_100113259 3300005530 Unclassified 2698
46 Ga0070679_100115573 3300005530 Bacteria 2669
47 Ga0070684_100011501 3300005535 Bacteria 7048
48 Ga0070684_100041787 3300005535 Unclassified 3955
49 Ga0070684_100045960 3300005535 Bacteria 3782
50 Ga0068853_100066767 3300005539 Bacteria 3124
51 Ga0068853_100081703 3300005539 Bacteria 2830
52 Ga0068853_100266986 3300005539 Unclassified 1575
53 Ga0070672_100734369 3300005543 Bacteria 866
54 Ga0070686_100355146 3300005544 Bacteria 1102
55 Ga0070696_100084453 3300005546 Bacteria 2253
56 Ga0070696_100283443 3300005546 Unclassified 1264
57 Ga0070693_100041284 3300005547 Bacteria 2594
58 Ga0070665_100025169 3300005548 Bacteria 5997
59 Ga0070665_100747281 3300005548 Bacteria 991
60 Ga0068855_100001139 3300005563 Bacteria 32967
61 Ga0068855_100044648 3300005563 Bacteria 5244
62 Ga0068855_100099186 3300005563 Bacteria 3355
63 Ga0068855_100913883 3300005563 Unclassified 926
64 Ga0068855_100988318 3300005563 Unclassified 885
65 Ga0070664_100126383 3300005564 Bacteria 2243
66 Ga0070664_100225733 3300005564 Unclassified 1677
67 Ga0068857_100013240 3300005577 Bacteria 7186
68 Ga0068857_100096319 3300005577 Bacteria 2652
69 Ga0068857_100143322 3300005577 Unclassified 2161
70 Ga0068854_100009062 3300005578 Bacteria 6413
71 Ga0068854_100538255 3300005578 Unclassified 989
72 Ga0068856_100001921 3300005614 Bacteria 21667
73 Ga0068856_100042365 3300005614 Unclassified 4478
74 Ga0068856_100047258 3300005614 Unclassified 4240
75 Ga0068856_100079232 3300005614 Bacteria 3257
76 Ga0068856_100137366 3300005614 Bacteria 2450
77 Ga0068856_100175793 3300005614 Bacteria 2153
78 Ga0068856_100556068 3300005614 Unclassified 1169
79 Ga0070702_100145803 3300005615 Bacteria 1513
80 Ga0070702_100159786 3300005615 Unclassified 1455
81 Ga0068852_100120718 3300005616 Unclassified 2399
82 Ga0068852_100355319 3300005616 Bacteria 1432
83 Ga0068866_10107782 3300005718 Bacteria 1549
84 Ga0068861_100013891 3300005719 Bacteria 5643
85 Ga0068861_100693336 3300005719 Unclassified 945
86 Ga0068870_10100323 3300005840 Bacteria 1635
87 Ga0068870_10119700 3300005840 Bacteria 1515
88 Ga0068863_100012470 3300005841 Bacteria 8205
89 Ga0068863_100838267 3300005841 Unclassified 918
90 Ga0068858_100020550 3300005842 Bacteria 6169
91 Ga0068858_100088596 3300005842 Bacteria 2879
92 Ga0068858_100125022 3300005842 Bacteria 2407
93 Ga0068858_100156970 3300005842 Bacteria 2141
94 Ga0068860_100203616 3300005843 Bacteria 1919
95 Ga0068862_100373795 3300005844 Unclassified 1327
96 Ga0081455_10213981 3300005937 Bacteria 1434
97 Ga0070712_100124036 3300006175 Bacteria 1948
98 Ga0097621_100024302 3300006237 Unclassified 4730
99 Ga0097621_100209057 3300006237 Bacteria 1697
100 Ga0068871_100002693 3300006358 Bacteria 12118
101 Ga0068871_100218527 3300006358 Bacteria 1650
102 Ga0075428_100100447 3300006844 Bacteria 3154
103 Ga0075428_100109806 3300006844 Bacteria 3005
104 Ga0075431_100223654 3300006847 Bacteria 1920
105 Ga0075431_101035671 3300006847 Unclassified 787
106 Ga0075433_10154035 3300006852 Bacteria 2045
107 Ga0075433_10483573 3300006852 Unclassified 1091
108 Ga0075434_100018150 3300006871 Bacteria 6791
109 Ga0075429_100145310 3300006880 Bacteria 2076
110 Ga0075429_100321736 3300006880 Bacteria 1354
111 Ga0075429_100714253 3300006880 Unclassified 878
112 Ga0068865_100276735 3300006881 Bacteria 1335
113 Ga0075436_100133591 3300006914 Bacteria 1741
114 Ga0075435_100093616 3300007076 Unclassified 2483
115 Ga0075435_100255667 3300007076 Bacteria 1492
116 Ga0105240_10000386 3300009093 Bacteria 82889
117 Ga0105240_10060374 3300009093 Bacteria 4727
118 Ga0105240_10148507 3300009093 Bacteria 2794
119 Ga0105240_10159066 3300009093 Bacteria 2685
120 Ga0105240_10397208 3300009093 Unclassified 1554
121 Ga0105240_10458433 3300009093 Unclassified 1425
122 Ga0105245_10011788 3300009098 Bacteria 7605
123 Ga0105245_10016165 3300009098 Bacteria 6503
124 Ga0105245_10097499 3300009098 Bacteria 2715
125 Ga0105245_10345231 3300009098 Bacteria 1473
126 Ga0114129_10052085 3300009147 Bacteria 5745
127 Ga0114129_10728457 3300009147 Bacteria 1272
128 Ga0114129_11492379 3300009147 Bacteria 831
129 Ga0105243_10293391 3300009148 Bacteria 1470
130 Ga0105243_10656081 3300009148 Bacteria 1017
131 Ga0105243_10965136 3300009148 Unclassified 852
132 Ga0105241_10015797 3300009174 Bacteria 5531
133 Ga0105241_10043103 3300009174 Bacteria 3416
134 Ga0105241_10407584 3300009174 Bacteria 1194
135 Ga0105241_10708132 3300009174 Unclassified 920
136 Ga0105242_10463368 3300009176 Bacteria 1197
137 Ga0105242_10578047 3300009176 Unclassified 1082
138 Ga0105248_10363427 3300009177 Bacteria 1630
139 Ga0105237_10027760 3300009545 Bacteria 5770
140 Ga0105237_10232024 3300009545 Bacteria 1846
141 Ga0105238_10003839 3300009551 Bacteria 14925
142 Ga0105238_10038339 3300009551 Unclassified 4867
143 Ga0105238_10046130 3300009551 Bacteria 4399
144 Ga0105238_10145776 3300009551 Bacteria 2344
145 Ga0105238_10193148 3300009551 Unclassified 2011
146 Ga0105249_10003513 3300009553 Bacteria 13561
147 Ga0105249_10012368 3300009553 Bacteria 7522
148 Ga0105249_10272835 3300009553 Bacteria 1686
149 Ga0105239_10030083 3300010375 Bacteria 5971
150 Ga0105239_10039766 3300010375 Bacteria 5153
151 Ga0105239_10389662 3300010375 Unclassified 1576
152 Ga0105239_10441915 3300010375 Bacteria 1475
153 Ga0105239_10767076 3300010375 Bacteria 1104
154 Ga0105239_10835240 3300010375 Unclassified 1056
155 Ga0105239_10881685 3300010375 Unclassified 1027
156 Ga0105246_10022345 3300011119 Unclassified 4080
157 Ga0105246_10234330 3300011119 Bacteria 1447
158 Ga0105246_10403725 3300011119 Bacteria 1135
159 Ga0105246_10737831 3300011119 Bacteria 867
160 Ga0157371_10136241 3300013102 Unclassified 1748
161 Ga0157370_10003099 3300013104 Bacteria 19679
162 Ga0157370_10031259 3300013104 Bacteria 5210
163 Ga0157370_10034941 3300013104 Bacteria 4891
164 Ga0157370_10080970 3300013104 Unclassified 3057
165 Ga0157370_10094610 3300013104 Bacteria 2803
166 Ga0157370_10227525 3300013104 Bacteria 1726
167 Ga0157370_10293470 3300013104 Bacteria 1501
168 Ga0157369_10004760 3300013105 Bacteria 15956
169 Ga0157369_10012152 3300013105 Bacteria 9773
170 Ga0157369_10018012 3300013105 Bacteria 7924
171 Ga0157369_10069785 3300013105 Bacteria 3775
172 Ga0157369_10099315 3300013105 Unclassified 3103
173 Ga0157374_10102093 3300013296 Bacteria 2750
174 Ga0157374_10164508 3300013296 Bacteria 2162
175 Ga0157374_10270170 3300013296 Bacteria 1676
176 Ga0157378_11092795 3300013297 Unclassified 834
177 Ga0163162_10407601 3300013306 Bacteria 1492
178 Ga0163162_10537678 3300013306 Unclassified 1297
179 Ga0157372_10125165 3300013307 Plasmid 2955
180 Ga0157372_10360399 3300013307 Bacteria 1694
181 Ga0157372_10660216 3300013307 Bacteria 1217
182 Ga0157375_10482559 3300013308 Bacteria 1404
183 Ga0157375_10491483 3300013308 Bacteria 1392
184 Ga0163163_10000016 3300014325 Bacteria 213966
185 Ga0163163_10063130 3300014325 Bacteria 3672
186 Ga0163163_10085645 3300014325 Bacteria 3159
187 Ga0157380_10021165 3300014326 Bacteria 4875
188 Ga0157380_10082672 3300014326 Unclassified 2629
189 Ga0157377_10047282 3300014745 Bacteria 2410
190 Ga0157379_10001624 3300014968 Bacteria 18542
191 Ga0157376_10084928 3300014969 Bacteria 2726
192 Ga0157376_10085965 3300014969 Unclassified 2711
193 Ga0209233_1007065 3300025261 Bacteria 3582
194 Ga0209758_1000032 3300025297 Bacteria 481623
195 Ga0207656_10085113 3300025321 Bacteria 1427
196 Ga0207688_10150763 3300025901 Unclassified 1373
197 Ga0207645_10248057 3300025907 Bacteria 1177
198 Ga0207643_10014639 3300025908 Bacteria 4264
199 Ga0207643_10017007 3300025908 Bacteria 3971
200 Ga0207705_10000016 3300025909 Bacteria 377359
201 Ga0207705_10049487 3300025909 Bacteria 3024
202 Ga0207705_10133570 3300025909 Unclassified 1848
203 Ga0207705_10205927 3300025909 Bacteria 1491
204 Ga0207705_10599672 3300025909 Unclassified 856
205 Ga0207684_10129074 3300025910 Bacteria 2170
206 Ga0207654_10026437 3300025911 Unclassified 3143
207 Ga0207654_10039626 3300025911 Bacteria 2651
208 Ga0207654_10339628 3300025911 Unclassified 1031
209 Ga0207707_10009909 3300025912 Bacteria 8263
210 Ga0207707_10022012 3300025912 Bacteria 5571
211 Ga0207695_10003590 3300025913 Bacteria 21707
212 Ga0207695_10016229 3300025913 Bacteria 8729
213 Ga0207695_10016511 3300025913 Bacteria 8632
214 Ga0207695_10173711 3300025913 Bacteria 2078
215 Ga0207695_10207986 3300025913 Unclassified 1869
216 Ga0207695_10245311 3300025913 Unclassified 1691
217 Ga0207695_10624066 3300025913 Unclassified 959
218 Ga0207671_10075537 3300025914 Bacteria 2520
219 Ga0207693_10139291 3300025915 Bacteria 1908
220 Ga0207660_10012357 3300025917 Bacteria 5585
221 Ga0207657_10015720 3300025919 Bacteria 7319
222 Ga0207657_10127166 3300025919 Bacteria 2092
223 Ga0207657_10130813 3300025919 Bacteria 2057
224 Ga0207657_10225207 3300025919 Bacteria 1501
225 Ga0207649_10000904 3300025920 Bacteria 18718
226 Ga0207649_10275261 3300025920 Unclassified 1222
227 Ga0207649_10313558 3300025920 Bacteria 1150
228 Ga0207652_10004201 3300025921 Bacteria 11752
229 Ga0207652_10033267 3300025921 Unclassified 4340
230 Ga0207652_10217135 3300025921 Unclassified 1723
231 Ga0207681_10054806 3300025923 Bacteria 2713
232 Ga0207694_10027758 3300025924 Bacteria 4312
233 Ga0207694_10062539 3300025924 Bacteria 2898
234 Ga0207694_10087110 3300025924 Bacteria 2460
235 Ga0207694_10148839 3300025924 Bacteria 1885
236 Ga0207650_10001237 3300025925 Bacteria 18593
237 Ga0207687_10001565 3300025927 Bacteria 15722
238 Ga0207687_10012710 3300025927 Bacteria 5501
239 Ga0207687_10251469 3300025927 Bacteria 1405
240 Ga0207700_10014798 3300025928 Bacteria 5123
241 Ga0207690_10189521 3300025932 Bacteria 1554
242 Ga0207709_10025972 3300025935 Bacteria 3359
243 Ga0207709_10185889 3300025935 Bacteria 1471
244 Ga0207670_10324998 3300025936 Bacteria 1211
245 Ga0207670_10466101 3300025936 Bacteria 1021
246 Ga0207669_10190277 3300025937 Bacteria 1480
247 Ga0207669_10287156 3300025937 Bacteria 1244
248 Ga0207711_10009144 3300025941 Bacteria 8276
249 Ga0207689_10103302 3300025942 Unclassified 2342
250 Ga0207661_10033157 3300025944 Bacteria 4007
251 Ga0207661_10043875 3300025944 Bacteria 3530
252 Ga0207661_10207041 3300025944 Bacteria 1727
253 Ga0207679_10400990 3300025945 Bacteria 1206
254 Ga0207667_10004410 3300025949 Bacteria 17234
255 Ga0207667_10048655 3300025949 Bacteria 4482
256 Ga0207667_10119288 3300025949 Bacteria 2718
257 Ga0207667_10402682 3300025949 Unclassified 1393
258 Ga0207667_10609620 3300025949 Unclassified 1100
259 Ga0207651_10350961 3300025960 Bacteria 1242
260 Ga0207712_10006439 3300025961 Bacteria 7404
261 Ga0207712_10099882 3300025961 Bacteria 2155
262 Ga0207640_10156944 3300025981 Bacteria 1678
263 Ga0207703_10051104 3300026035 Bacteria 3348
264 Ga0207703_10058035 3300026035 Bacteria 3158
265 Ga0207703_10232509 3300026035 Bacteria 1653
266 Ga0207639_10092189 3300026041 Bacteria 2428
267 Ga0207639_10102808 3300026041 Bacteria 2314
268 Ga0207639_10331578 3300026041 Bacteria 1354
269 Ga0207678_10068872 3300026067 Bacteria 3035
270 Ga0207678_10316081 3300026067 Bacteria 1343
271 Ga0207678_10406554 3300026067 Unclassified 1179
272 Ga0207708_10050440 3300026075 Bacteria 3167
273 Ga0207702_10009009 3300026078 Bacteria 8403
274 Ga0207702_10028410 3300026078 Bacteria 4650
275 Ga0207702_10035327 3300026078 Bacteria 4180
276 Ga0207702_10061195 3300026078 Unclassified 3211
277 Ga0207702_10072076 3300026078 Bacteria 2976
278 Ga0207702_10353913 3300026078 Bacteria 1406
279 Ga0207648_10113869 3300026089 Unclassified 2376
280 Ga0207648_10383167 3300026089 Bacteria 1272
281 Ga0207674_10020381 3300026116 Bacteria 7164
282 Ga0207674_10053812 3300026116 Bacteria 4101
283 Ga0207675_100055898 3300026118 Bacteria 3682
284 Ga0207683_10062271 3300026121 Bacteria 3286
285 Ga0207683_10536686 3300026121 Bacteria 1081
286 Ga0207698_10727608 3300026142 Bacteria 989
287 Ga0268266_10010357 3300028379 Bacteria 8156
288 Ga0268266_10704265 3300028379 Bacteria 973
289 Ga0265338_10335756 3300028800 Unclassified 1090
290 Ga0265338_10396073 3300028800 Bacteria 985
291 Ga0265325_10037120 3300031241 Unclassified 2577
292 Ga0265331_10000080 3300031250 Bacteria 137743
293 Ga0307513_10378256 3300031456 Unclassified 1156
294 Ga0265313_10105053 3300031595 Unclassified 1248
295 Ga0265314_10070638 3300031711 Unclassified 2339
296 Ga0307407_10152246 3300031903 Unclassified 1504
297 Ga0307416_100351313 3300032002 Unclassified 1492
298 Ga0307416_100857134 3300032002 Bacteria 1007
299 Ga0307411_10417481 3300032005 Bacteria 1114
300 Ga0307415_100238763 3300032126 Unclassified 1468
301 Ga0373949_0012061 3300035090 Bacteria 1909
302 Ga0373946_0141594 3300035171 Bacteria 1115
303 Ga0373933_0236667 3300035724 Unclassified 1174
304 Ga0373937_0312671 3300036401 Bacteria 1486
305 Ga0373937_0496211 3300036401 Unclassified 1160
306 Ga0373937_0542619 3300036401 Unclassified 1104
307 Ga0373925_0093420 3300037068 Bacteria 2302
308 Ga0395899_0063327 3300037312 Bacteria 2721
309 Ga0395900_0105348 3300037418 Bacteria 2897
310 Ga0395900_0356064 3300037418 Bacteria 1436
311 Ga0395898_0015735 3300037466 Bacteria 7752
312 Ga0395898_0100211 3300037466 Unclassified 2782
313 Ga0395901_0117346 3300038443 Bacteria 2796
314 Ga0395901_0385088 3300038443 Bacteria 1443
315 Ga0451789_0790574 3300041443 Unclassified 1019
316 Ga0451798_0806603 3300041458 Unclassified 1157
317 Ga0466960_0111573 3300044901 Bacteria 1421
318 Ga0466960_0198783 3300044901 Bacteria 1094
319 Ga0466967_0022093 3300045976 Bacteria 5184
320 Ga0466967_0034715 3300045976 Bacteria 4284
321 Ga0495651_0004676 3300046462 Bacteria 10479
322 Ga0495580_0224214 3300046472 Bacteria 1291
323 Ga0495664_0406821 3300046477 Unclassified 817
324 Ga0495628_0173195 3300046516 Bacteria 1636
325 Ga0495652_0035898 3300046529 Bacteria 4313
326 Ga0495645_0198722 3300046543 Unclassified 1362
327 Ga0495667_0033990 3300046559 Bacteria 3410
328 Ga0495656_0138496 3300046615 Bacteria 1165
329 Ga0495657_0337481 3300046675 Bacteria 894
330 Ga0495599_0128525 3300046678 Bacteria 1574
331 Ga0495623_0234552 3300046679 Bacteria 1039
332 Ga0495600_0029268 3300046809 Unclassified 3566
333 Ga0495680_0003341 3300047322 Bacteria 15863
334 Ga0495680_0258977 3300047322 Unclassified 1231
335 Ga0496100_0026183 3300048903 Bacteria 3574
336 Ga0496100_0033649 3300048903 Bacteria 3209
337 Ga0496101_0002643 3300048904 Bacteria 11006
338 Ga0496101_0035146 3300048904 Bacteria 3544
339 Ga0496102_0007780 3300048905 Bacteria 9159
340 Ga0496102_0017176 3300048905 Bacteria 6336
341 Ga0496102_0027837 3300048905 Bacteria 5048
342 Ga0496102_0163216 3300048905 Bacteria 2096
343 Ga0496102_0461289 3300048905 Bacteria 1191
344 Ga0496103_0005912 3300048906 Bacteria 7315
345 Ga0496103_0236859 3300048906 Bacteria 1174
346 Ga0496104_0006975 3300048907 Bacteria 9963
347 Ga0496104_0119347 3300048907 Bacteria 2532
348 Ga0496104_0169689 3300048907 Bacteria 2092
349 Ga0496105_0000055 3300048908 Bacteria 88389
350 Ga0496105_0130528 3300048908 Bacteria 2072
351 Ga0496106_0294776 3300048909 Bacteria 1300
352 Ga0496107_0022851 3300048910 Bacteria 4421
353 Ga0496107_0078657 3300048910 Bacteria 2403
354 Ga0496108_0004634 3300048911 Bacteria 11085
355 Ga0496108_0018474 3300048911 Bacteria 5708
356 Ga0496108_0292115 3300048911 Bacteria 1419
357 Ga0496108_0422630 3300048911 Bacteria 1164
358 Ga0496109_0013174 3300048912 Bacteria 7156
359 Ga0496109_0053774 3300048912 Bacteria 3673
360 Ga0496110_0010259 3300048913 Bacteria 7611
361 Ga0496110_0028834 3300048913 Bacteria 4771
362 Ga0496110_0130202 3300048913 Bacteria 2271
363 Ga0496111_0000092 3300048914 Bacteria 38172
364 Ga0496111_0124611 3300048914 Bacteria 1904
365 Ga0496111_0132913 3300048914 Bacteria 1842
366 Ga0496111_0269789 3300048914 Bacteria 1262
367 Ga0496111_0335050 3300048914 Bacteria 1120
368 Ga0496112_0065546 3300048915 Bacteria 3584
369 Ga0496112_0141705 3300048915 Bacteria 2373
370 Ga0496113_0067230 3300048916 Bacteria 2717
371 Ga0496113_0131656 3300048916 Bacteria 1963
372 Ga0496113_0526424 3300048916 Unclassified 949
373 Ga0496114_0000274 3300048917 Bacteria 37581
374 Ga0496114_0001461 3300048917 Bacteria 17956
375 Ga0496114_0022115 3300048917 Bacteria 5180
376 Ga0496114_0053082 3300048917 Bacteria 3378
377 Ga0496114_0056912 3300048917 Bacteria 3264
378 Ga0496115_0074891 3300048918 Bacteria 2749
379 Ga0496115_0106965 3300048918 Bacteria 2297
380 Ga0501032_0020807 3300049569 Bacteria 4567
381 Ga0501032_0078559 3300049569 Bacteria 2197
382 Ga0501033_0029609 3300049570 Bacteria 4114
383 Ga0501034_0024099 3300049571 Bacteria 6191
384 Ga0501036_0042743 3300049572 Bacteria 3836
385 Ga0501036_0078549 3300049572 Bacteria 2791
386 Ga0501037_0004138 3300049573 Bacteria 10527
387 Ga0501037_0130731 3300049573 Bacteria 1800
388 Ga0501038_0013930 3300049574 Bacteria 7329
389 Ga0501038_0033001 3300049574 Bacteria 4561
390 Ga0501039_0004124 3300049575 Bacteria 10926
391 Ga0501039_0021597 3300049575 Bacteria 4938
392 Ga0501040_0001647 3300049576 Bacteria 14254
393 Ga0501040_0141363 3300049576 Bacteria 1696
394 Ga0501041_0000451 3300049577 Bacteria 20829
395 Ga0501042_0002270 3300049578 Bacteria 11738
396 Ga0501042_0081356 3300049578 Bacteria 2321
397 Ga0501043_0027791 3300049579 Bacteria 4440
398 Ga0501046_0001168 3300049580 Bacteria 25539
399 Ga0501046_0049307 3300049580 Bacteria 3330
400 Ga0501047_0151407 3300049581 Bacteria 2195
401 Ga0501048_0044393 3300049582 Bacteria 3178
402 Ga0501067_0015532 3300049583 Bacteria 4214
403 Ga0501067_0048063 3300049583 Bacteria 2366
404 Ga0501068_0040250 3300049584 Bacteria 2805
405 Ga0501068_0090389 3300049584 Bacteria 1889
406 Ga0501069_0004736 3300049585 Bacteria 7038
407 Ga0501069_0017475 3300049585 Bacteria 3861
408 Ga0501069_0043752 3300049585 Bacteria 2479
409 Ga0501070_0024979 3300049586 Bacteria 5011
410 Ga0501070_0030199 3300049586 Bacteria 4541
411 Ga0501070_0447368 3300049586 Bacteria 1042
412 Ga0501071_0016009 3300049587 Bacteria 5152
413 Ga0501071_0227030 3300049587 Bacteria 1406
414 Ga0501072_0001708 3300049588 Bacteria 16339
415 Ga0501072_0138054 3300049588 Bacteria 1944
416 Ga0501073_0021941 3300049589 Bacteria 4599
417 Ga0501073_0385678 3300049589 Unclassified 968
418 Ga0501073_0511279 3300049589 Bacteria 830
419 Ga0501074_0032515 3300049590 Bacteria 3779
420 Ga0501075_0002815 3300049591 Bacteria 11665
421 Ga0501075_0337766 3300049591 Bacteria 1148
422 Ga0501076_0000881 3300049592 Bacteria 19517
423 Ga0501077_0073277 3300049593 Bacteria 2169
424 Ga0501079_0009771 3300049741 Bacteria 7273
425 Ga0501079_0368352 3300049741 Unclassified 1126
426 Ga0501079_0388828 3300049741 Bacteria 1094
427 Ga0501081_0002564 3300049743 Bacteria 11474
428 Ga0501083_0005264 3300049744 Bacteria 9153
429 Ga0501035_0006481 3300049822 Bacteria 10997
430 Ga0501035_0012514 3300049822 Bacteria 7837
431 Ga0501044_0163415 3300049823 Bacteria 2201
432 Ga0501044_0466119 3300049823 Bacteria 1168
433 Ga0501045_0025692 3300049824 Bacteria 4235
434 nmdc:mga05p37_737885_c1 3300050507 Bacteria 1088
435 nmdc:mga09592_91869_c1 3300050508 Bacteria 2594
436 nmdc:mga06r32_199999_c1 3300050510 Bacteria 1986
437 nmdc:mga08y16_74986_c1 3300050511 Bacteria 3526
438 nmdc:mga0n895_319088_c1 3300050512 Bacteria 1574
439 nmdc:mga0rr50_563313_c1 3300050513 Bacteria 970
440 nmdc:mga0rr50_677259_c1 3300050513 Unclassified 880
441 nmdc:mga0rr50_92645_c1 3300050513 Unclassified 2356
442 nmdc:mga0a205_335897_c1 3300050515 Unclassified 1380
443 nmdc:mga0a205_67731_c1 3300050515 Bacteria 3449
444 Ga0500643_000123 3300053087 Bacteria 80567
445 Ga0500554_107604 3300053102 Bacteria 936
446 Ga0500593_048286 3300053117 Unclassified 1893
447 Ga0500595_037013 3300053119 Bacteria 1595
448 Ga0500595_038824 3300053119 Unclassified 1545
449 Ga0500573_0000028 3300053140 Bacteria 142610
450 Ga0501084_0024769 3300054114 Bacteria 5007
451 Ga0501084_0036466 3300054114 Bacteria 4107
452 Ga0501082_0008759 3300060353 Bacteria 8721
453 Ga0501082_0046600 3300060353 Bacteria 3737
454 Ga0501082_0047647 3300060353 Bacteria 3693
455 Ga0530510_0006055 3300061734 Bacteria 8397
456 Ga0530510_0051361 3300061734 Bacteria 2979
457 Ga0068855_100214330
458 JGI25153J46596_10002424
459 Ga0070658_10000010
460 Ga0070658_10043263
461 Ga0070658_10249301
462 Ga0070658_10279799
463 Ga0070658_10375166
464 Ga0070658_10437667
465 Ga0070658_10482573
466 Ga0070676_10206197
467 Ga0070683_100133345
468 Ga0070683_100192789
469 Ga0070670_100158210
470 Ga0070680_100023498
471 Ga0070680_100066924
472 Ga0070680_100198378
473 Ga0070682_100049605
474 Ga0068868_100110684
475 Ga0068868_100399998
476 Ga0070660_100140780
477 Ga0070660_100183988
478 Ga0070689_100202991
479 Ga0070661_100001255
480 Ga0070661_100278787
481 Ga0070661_100685915
482 Ga0070692_10182354
483 Ga0070673_100661054
484 Ga0070688_100610360
485 Ga0070667_100246310
486 Ga0070711_100025666
487 Ga0070711_100816023
488 Ga0070708_100088041
489 Ga0070663_100114916
490 Ga0070663_100163045
491 Ga0070678_100007538
492 Ga0070678_100555952
493 Ga0070662_100150957
494 Ga0070681_10012979
495 Ga0070681_10014578
496 Ga0070681_10296575
497 Ga0068867_100338402
498 Ga0070706_100562810
499 Ga0070679_100005061
500 Ga0070679_100011822
501 Ga0070679_100113259
502 Ga0070679_100115573
503 Ga0070684_100011501
504 Ga0070684_100041787
505 Ga0070684_100045960
506 Ga0068853_100066767
507 Ga0068853_100081703
508 Ga0068853_100266986
509 Ga0070672_100734369
510 Ga0070686_100355146
511 Ga0070696_100084453
512 Ga0070696_100283443
513 Ga0070693_100041284
514 Ga0070665_100025169
515 Ga0070665_100747281
516 Ga0068855_100001139
517 Ga0068855_100044648
518 Ga0068855_100099186
519 Ga0068855_100913883
520 Ga0068855_100988318
521 Ga0070664_100126383
522 Ga0070664_100225733
523 Ga0068857_100013240
524 Ga0068857_100096319
525 Ga0068857_100143322
526 Ga0068854_100009062
527 Ga0068854_100538255
528 Ga0068856_100001921
529 Ga0068856_100042365
530 Ga0068856_100047258
531 Ga0068856_100079232
532 Ga0068856_100137366
533 Ga0068856_100175793
534 Ga0068856_100556068
535 Ga0070702_100145803
536 Ga0070702_100159786
537 Ga0068852_100120718
538 Ga0068852_100355319
539 Ga0068866_10107782
540 Ga0068861_100013891
541 Ga0068861_100693336
542 Ga0068870_10100323
543 Ga0068870_10119700
544 Ga0068863_100012470
545 Ga0068863_100838267
546 Ga0068858_100020550
547 Ga0068858_100088596
548 Ga0068858_100125022
549 Ga0068858_100156970
550 Ga0068860_100203616
551 Ga0068862_100373795
552 Ga0081455_10213981
553 Ga0070712_100124036
554 Ga0097621_100024302
555 Ga0097621_100209057
556 Ga0068871_100002693
557 Ga0068871_100218527
558 Ga0075428_100100447
559 Ga0075428_100109806
560 Ga0075431_100223654
561 Ga0075431_101035671
562 Ga0075433_10154035
563 Ga0075433_10483573
564 Ga0075434_100018150
565 Ga0075429_100145310
566 Ga0075429_100321736
567 Ga0075429_100714253
568 Ga0068865_100276735
569 Ga0075436_100133591
570 Ga0075435_100093616
571 Ga0075435_100255667
572 Ga0105240_10000386
573 Ga0105240_10060374
574 Ga0105240_10148507
575 Ga0105240_10159066
576 Ga0105240_10397208
577 Ga0105240_10458433
578 Ga0105245_10011788
579 Ga0105245_10016165
580 Ga0105245_10097499
581 Ga0105245_10345231
582 Ga0114129_10052085
583 Ga0114129_10728457
584 Ga0114129_11492379
585 Ga0105243_10293391
586 Ga0105243_10656081
587 Ga0105243_10965136
588 Ga0105241_10015797
589 Ga0105241_10043103
590 Ga0105241_10407584
591 Ga0105241_10708132
592 Ga0105242_10463368
593 Ga0105242_10578047
594 Ga0105248_10363427
595 Ga0105237_10027760
596 Ga0105237_10232024
597 Ga0105238_10003839
598 Ga0105238_10038339
599 Ga0105238_10046130
600 Ga0105238_10145776
601 Ga0105238_10193148
602 Ga0105249_10003513
603 Ga0105249_10012368
604 Ga0105249_10272835
605 Ga0105239_10030083
606 Ga0105239_10039766
607 Ga0105239_10389662
608 Ga0105239_10441915
609 Ga0105239_10767076
610 Ga0105239_10835240
611 Ga0105239_10881685
612 Ga0105246_10022345
613 Ga0105246_10234330
614 Ga0105246_10403725
615 Ga0105246_10737831
616 Ga0157371_10136241
617 Ga0157370_10003099
618 Ga0157370_10031259
619 Ga0157370_10034941
620 Ga0157370_10080970
621 Ga0157370_10094610
622 Ga0157370_10227525
623 Ga0157370_10293470
624 Ga0157369_10004760
625 Ga0157369_10012152
626 Ga0157369_10018012
627 Ga0157369_10069785
628 Ga0157369_10099315
629 Ga0157374_10102093
630 Ga0157374_10164508
631 Ga0157374_10270170
632 Ga0157378_11092795
633 Ga0163162_10407601
634 Ga0163162_10537678
635 Ga0157372_10125165
636 Ga0157372_10360399
637 Ga0157372_10660216
638 Ga0157375_10482559
639 Ga0157375_10491483
640 Ga0163163_10000016
641 Ga0163163_10063130
642 Ga0163163_10085645
643 Ga0157380_10021165
644 Ga0157380_10082672
645 Ga0157377_10047282
646 Ga0157379_10001624
647 Ga0157376_10084928
648 Ga0157376_10085965
649 Ga0209233_1007065
650 Ga0209758_1000032
651 Ga0207656_10085113
652 Ga0207688_10150763
653 Ga0207645_10248057
654 Ga0207643_10014639
655 Ga0207643_10017007
656 Ga0207705_10000016
657 Ga0207705_10049487
658 Ga0207705_10133570
659 Ga0207705_10205927
660 Ga0207705_10599672
661 Ga0207684_10129074
662 Ga0207654_10026437
663 Ga0207654_10039626
664 Ga0207654_10339628
665 Ga0207707_10009909
666 Ga0207707_10022012
667 Ga0207695_10003590
668 Ga0207695_10016229
669 Ga0207695_10016511
670 Ga0207695_10173711
671 Ga0207695_10207986
672 Ga0207695_10245311
673 Ga0207695_10624066
674 Ga0207671_10075537
675 Ga0207693_10139291
676 Ga0207660_10012357
677 Ga0207657_10015720
678 Ga0207657_10127166
679 Ga0207657_10130813
680 Ga0207657_10225207
681 Ga0207649_10000904
682 Ga0207649_10275261
683 Ga0207649_10313558
684 Ga0207652_10004201
685 Ga0207652_10033267
686 Ga0207652_10217135
687 Ga0207681_10054806
688 Ga0207694_10027758
689 Ga0207694_10062539
690 Ga0207694_10087110
691 Ga0207694_10148839
692 Ga0207650_10001237
693 Ga0207687_10001565
694 Ga0207687_10012710
695 Ga0207687_10251469
696 Ga0207700_10014798
697 Ga0207690_10189521
698 Ga0207709_10025972
699 Ga0207709_10185889
700 Ga0207670_10324998
701 Ga0207670_10466101
702 Ga0207669_10190277
703 Ga0207669_10287156
704 Ga0207711_10009144
705 Ga0207689_10103302
706 Ga0207661_10033157
707 Ga0207661_10043875
708 Ga0207661_10207041
709 Ga0207679_10400990
710 Ga0207667_10004410
711 Ga0207667_10048655
712 Ga0207667_10119288
713 Ga0207667_10402682
714 Ga0207667_10609620
715 Ga0207651_10350961
716 Ga0207712_10006439
717 Ga0207712_10099882
718 Ga0207640_10156944
719 Ga0207703_10051104
720 Ga0207703_10058035
721 Ga0207703_10232509
722 Ga0207639_10092189
723 Ga0207639_10102808
724 Ga0207639_10331578
725 Ga0207678_10068872
726 Ga0207678_10316081
727 Ga0207678_10406554
728 Ga0207708_10050440
729 Ga0207702_10009009
730 Ga0207702_10028410
731 Ga0207702_10035327
732 Ga0207702_10061195
733 Ga0207702_10072076
734 Ga0207702_10353913
735 Ga0207648_10113869
736 Ga0207648_10383167
737 Ga0207674_10020381
738 Ga0207674_10053812
739 Ga0207675_100055898
740 Ga0207683_10062271
741 Ga0207683_10536686
742 Ga0207698_10727608
743 Ga0268266_10010357
744 Ga0268266_10704265
745 Ga0265338_10335756
746 Ga0265338_10396073
747 Ga0265325_10037120
748 Ga0265331_10000080
749 Ga0307513_10378256
750 Ga0265313_10105053
751 Ga0265314_10070638
752 Ga0307407_10152246
753 Ga0307416_100351313
754 Ga0307416_100857134
755 Ga0307411_10417481
756 Ga0307415_100238763
757 Ga0373949_0012061
758 Ga0373946_0141594
759 Ga0373933_0236667
760 Ga0373937_0312671
761 Ga0373937_0496211
762 Ga0373937_0542619
763 Ga0373925_0093420
764 Ga0395899_0063327
765 Ga0395900_0105348
766 Ga0395900_0356064
767 Ga0395898_0015735
768 Ga0395898_0100211
769 Ga0395901_0117346
770 Ga0395901_0385088
771 Ga0451789_0790574
772 Ga0451798_0806603
773 Ga0466960_0111573
774 Ga0466960_0198783
775 Ga0466967_0022093
776 Ga0466967_0034715
777 Ga0495651_0004676
778 Ga0495580_0224214
779 Ga0495664_0406821
780 Ga0495628_0173195
781 Ga0495652_0035898
782 Ga0495645_0198722
783 Ga0495667_0033990
784 Ga0495656_0138496
785 Ga0495657_0337481
786 Ga0495599_0128525
787 Ga0495623_0234552
788 Ga0495600_0029268
789 Ga0495680_0003341
790 Ga0495680_0258977
791 Ga0496100_0026183
792 Ga0496100_0033649
793 Ga0496101_0002643
794 Ga0496101_0035146
795 Ga0496102_0007780
796 Ga0496102_0017176
797 Ga0496102_0027837
798 Ga0496102_0163216
799 Ga0496102_0461289
800 Ga0496103_0005912
801 Ga0496103_0236859
802 Ga0496104_0006975
803 Ga0496104_0119347
804 Ga0496104_0169689
805 Ga0496105_0000055
806 Ga0496105_0130528
807 Ga0496106_0294776
808 Ga0496107_0022851
809 Ga0496107_0078657
810 Ga0496108_0004634
811 Ga0496108_0018474
812 Ga0496108_0292115
813 Ga0496108_0422630
814 Ga0496109_0013174
815 Ga0496109_0053774
816 Ga0496110_0010259
817 Ga0496110_0028834
818 Ga0496110_0130202
819 Ga0496111_0000092
820 Ga0496111_0124611
821 Ga0496111_0132913
822 Ga0496111_0269789
823 Ga0496111_0335050
824 Ga0496112_0065546
825 Ga0496112_0141705
826 Ga0496113_0067230
827 Ga0496113_0131656
828 Ga0496113_0526424
829 Ga0496114_0000274
830 Ga0496114_0001461
831 Ga0496114_0022115
832 Ga0496114_0053082
833 Ga0496114_0056912
834 Ga0496115_0074891
835 Ga0496115_0106965
836 Ga0501032_0020807
837 Ga0501032_0078559
838 Ga0501033_0029609
839 Ga0501034_0024099
840 Ga0501036_0042743
841 Ga0501036_0078549
842 Ga0501037_0004138
843 Ga0501037_0130731
844 Ga0501038_0013930
845 Ga0501038_0033001
846 Ga0501039_0004124
847 Ga0501039_0021597
848 Ga0501040_0001647
849 Ga0501040_0141363
850 Ga0501041_0000451
851 Ga0501042_0002270
852 Ga0501042_0081356
853 Ga0501043_0027791
854 Ga0501046_0001168
855 Ga0501046_0049307
856 Ga0501047_0151407
857 Ga0501048_0044393
858 Ga0501067_0015532
859 Ga0501067_0048063
860 Ga0501068_0040250
861 Ga0501068_0090389
862 Ga0501069_0004736
863 Ga0501069_0017475
864 Ga0501069_0043752
865 Ga0501070_0024979
866 Ga0501070_0030199
867 Ga0501070_0447368
868 Ga0501071_0016009
869 Ga0501071_0227030
870 Ga0501072_0001708
871 Ga0501072_0138054
872 Ga0501073_0021941
873 Ga0501073_0385678
874 Ga0501073_0511279
875 Ga0501074_0032515
876 Ga0501075_0002815
877 Ga0501075_0337766
878 Ga0501076_0000881
879 Ga0501077_0073277
880 Ga0501079_0009771
881 Ga0501079_0368352
882 Ga0501079_0388828
883 Ga0501081_0002564
884 Ga0501083_0005264
885 Ga0501035_0006481
886 Ga0501035_0012514
887 Ga0501044_0163415
888 Ga0501044_0466119
889 Ga0501045_0025692
890 nmdc:mga05p37_737885_c1
891 nmdc:mga09592_91869_c1
892 nmdc:mga06r32_199999_c1
893 nmdc:mga08y16_74986_c1
894 nmdc:mga0n895_319088_c1
895 nmdc:mga0rr50_563313_c1
896 nmdc:mga0rr50_677259_c1
897 nmdc:mga0rr50_92645_c1
898 nmdc:mga0a205_335897_c1
899 nmdc:mga0a205_67731_c1
900 Ga0500643_000123
901 Ga0500554_107604
902 Ga0500593_048286
903 Ga0500595_037013
904 Ga0500595_038824
905 Ga0500573_0000028
906 Ga0501084_0024769
907 Ga0501084_0036466
908 Ga0501082_0008759
909 Ga0501082_0046600
910 Ga0501082_0047647
911 Ga0530510_0006055
912 Ga0530510_0051361

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

2

166

0.88

PF12146

Hydrolase_4

Serine aminopeptidase, S33

1

127

0.82

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

4

235

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hfw-assembly2.cif.gz_C-2 the crystal structure of alpha/beta fold hydrolase 0.9529 1 239
8hfw-assembly2.cif.gz_C-2 the crystal structure of alpha/beta fold hydrolase 0.9302 1 239
8hfw-assembly1.cif.gz_B the crystal structure of alpha/beta fold hydrolase 0.925 1 239
8hfw-assembly1.cif.gz_A the crystal structure of alpha/beta fold hydrolase 0.9229 1 239
5y57-assembly3.cif.gz_C crystal structure of a novel pyrethroid hydrolase from sphingobium faniae jz-2 0.9137 2 239
ID Description Score Start End Superfamily
af_A0A0N7KCX9_11_155_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.967 2 104 3.40.50.1820
af_F4JRA6_1_133_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.96 1 104 3.40.50.1820
af_Q54QE7_5_233_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9295 2 240 3.40.50.1820
af_Q9FVW3_95_346_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.929 1 238 3.40.50.1820
3styB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9111 2 240 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A2V8NPL8-F1-model_v4 Esterase 0.9945 1 241
AF-A0A7J9YU37-F1-model_v4 Alpha/beta fold hydrolase 0.9907 1 236 GO:0016787
AF-A0A3N5GHL4-F1-model_v4 Alpha/beta hydrolase 0.9881 39 243 GO:0016787
AF-A0A838VR30-F1-model_v4 Alpha/beta fold hydrolase 0.9877 1 111 GO:0080030
GO:0080032
AF-A0A2V2STX4-F1-model_v4 deleted 0.9829 1 244

Map