F447723

General Info

Members Datasets Scaffolds Average Seq Length
456 244 456 271

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100012404|Ga0070706_1000124044
Length 251
Sequence VTFSETEAGSSPAATTRIKRQLAEQAIASAAAGHWSEAADINRKLLELGPEADQAALALDPTNRIAERNIDRLRTLLVAAGEKTVAAIEGSKAPVRIFVEETGKTGFAHLLDLPDAKKLAQVNPGDTVELQPERNRLIAMSNGMRIGVVEPRVAARLLKLIADGNKYLAGVTSLGAQDVRIIIREVYQDPRNYGKVSFPTAAKSTDLRPYTKGTLLREDEELEITDLESVIPPEDTTEEAFVEEVXXVEEQ

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
126 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
127 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
128 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
129 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
130 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
131 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
132 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
133 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
134 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
135 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
136 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
137 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
138 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
139 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
140 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
141 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
142 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
143 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
144 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
153 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
154 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
155 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
156 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
161 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
165 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
166 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
167 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
168 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
169 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
170 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
171 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
172 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
175 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
176 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
177 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
178 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
179 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
180 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
181 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
182 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
183 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
184 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
187 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
188 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
189 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
215 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
216 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
217 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
218 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
219 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
222 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
223 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
224 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
227 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
228 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
236 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
237 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
238 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
239 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
240 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
241 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
242 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
244 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 9.43
Rhizosphere 89.47
Stem 0
Stem Tuber 0
Unclassified 0.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10016718 3300003203 Bacteria 3052
2 rootH1_10099171 3300003323 Bacteria 4205
3 Ga0070676_10071527 3300005328 Bacteria 2083
4 Ga0070676_10326036 3300005328 Bacteria 1049
5 Ga0070690_100022751 3300005330 Bacteria 3837
6 Ga0068869_100210887 3300005334 Bacteria 1535
7 Ga0070666_10147624 3300005335 Bacteria 1640
8 Ga0070680_100000017 3300005336 Bacteria 89028
9 Ga0068868_100326387 3300005338 Bacteria 1308
10 Ga0070660_100012570 3300005339 Bacteria 6047
11 Ga0070687_100021238 3300005343 Bacteria 3047
12 Ga0070661_100058715 3300005344 Bacteria 2819
13 Ga0070692_10007949 3300005345 Bacteria 4703
14 Ga0070692_10013055 3300005345 Unclassified 3864
15 Ga0070675_100034317 3300005354 Bacteria 4116
16 Ga0070675_100258001 3300005354 Bacteria 1527
17 Ga0070671_100438273 3300005355 Bacteria 1120
18 Ga0070674_100001664 3300005356 Bacteria 12000
19 Ga0070674_100002848 3300005356 Bacteria 9559
20 Ga0070659_100026197 3300005366 Unclassified 4485
21 Ga0070667_100132136 3300005367 Bacteria 2180
22 Ga0070709_10284859 3300005434 Unclassified 1202
23 Ga0070701_10068680 3300005438 Bacteria 1889
24 Ga0070705_100129308 3300005440 Bacteria 1645
25 Ga0070700_100087447 3300005441 Bacteria 2026
26 Ga0070700_100299649 3300005441 Unclassified 1173
27 Ga0070694_100004300 3300005444 Bacteria 8562
28 Ga0070694_100042348 3300005444 Bacteria 3041
29 Ga0070694_100140716 3300005444 Bacteria 1752
30 Ga0070708_100002176 3300005445 Bacteria 15132
31 Ga0070708_100021456 3300005445 Archaea 5461
32 Ga0070708_100037792 3300005445 Unclassified 4215
33 Ga0070678_100004755 3300005456 Bacteria 7744
34 Ga0070662_100060031 3300005457 Bacteria 2772
35 Ga0070685_10015562 3300005466 Bacteria 4041
36 Ga0070685_10142415 3300005466 Bacteria 1511
37 Ga0070706_100002897 3300005467 Bacteria 17079
38 Ga0070706_100012404 3300005467 Bacteria 7896
39 Ga0070706_100043417 3300005467 Bacteria 4154
40 Ga0070706_100097558 3300005467 Unclassified 2730
41 Ga0070707_100000801 3300005468 Bacteria 31024
42 Ga0070707_100010495 3300005468 Bacteria 8630
43 Ga0070707_100023963 3300005468 Bacteria 5774
44 Ga0070707_100028878 3300005468 Bacteria 5278
45 Ga0070707_100065936 3300005468 Bacteria 3479
46 Ga0070707_100075487 3300005468 Unclassified 3251
47 Ga0070698_100021137 3300005471 Bacteria 6818
48 Ga0070698_100144664 3300005471 Bacteria 2327
49 Ga0070698_100271225 3300005471 Unclassified 1628
50 Ga0070699_100010946 3300005518 Bacteria 7845
51 Ga0070699_100050845 3300005518 Bacteria 3588
52 Ga0070699_100059126 3300005518 Bacteria 3321
53 Ga0070699_100351477 3300005518 Bacteria 1328
54 Ga0070679_100184391 3300005530 Bacteria 2058
55 Ga0070684_100066858 3300005535 Unclassified 3156
56 Ga0070684_100133169 3300005535 Bacteria 2243
57 Ga0070697_100026970 3300005536 Unclassified 4594
58 Ga0070697_100139882 3300005536 Unclassified 2035
59 Ga0070672_100061659 3300005543 Bacteria 2957
60 Ga0070686_100044923 3300005544 Bacteria 2780
61 Ga0070686_100058166 3300005544 Unclassified 2486
62 Ga0070686_100112942 3300005544 Unclassified 1854
63 Ga0070686_100362144 3300005544 Unclassified 1093
64 Ga0070695_100034186 3300005545 Bacteria 3185
65 Ga0070695_100102881 3300005545 Bacteria 1926
66 Ga0070695_100126823 3300005545 Unclassified 1753
67 Ga0070695_100173647 3300005545 Unclassified 1522
68 Ga0070696_100006918 3300005546 Bacteria 7570
69 Ga0070696_100025696 3300005546 Bacteria 4005
70 Ga0070696_100065195 3300005546 Bacteria 2553
71 Ga0070693_100056430 3300005547 Unclassified 2266
72 Ga0070704_100035614 3300005549 Bacteria 3385
73 Ga0070704_100266020 3300005549 Bacteria 1414
74 Ga0070664_100004621 3300005564 Bacteria 11052
75 Ga0070664_100152223 3300005564 Bacteria 2043
76 Ga0070702_100000928 3300005615 Bacteria 11471
77 Ga0070702_100173487 3300005615 Bacteria 1405
78 Ga0068852_100028786 3300005616 Bacteria 4552
79 Ga0068859_100013378 3300005617 Bacteria 8228
80 Ga0068859_100363358 3300005617 Bacteria 1543
81 Ga0068864_100004723 3300005618 Bacteria 11160
82 Ga0068864_100049142 3300005618 Bacteria 3629
83 Ga0068864_100151256 3300005618 Bacteria 2102
84 Ga0068864_100364856 3300005618 Bacteria 1366
85 Ga0068864_100473055 3300005618 Bacteria 1202
86 Ga0068866_10077567 3300005718 Bacteria 1775
87 Ga0068851_10075465 3300005834 Bacteria 1752
88 Ga0068858_100473355 3300005842 Bacteria 1208
89 Ga0068860_100078412 3300005843 Bacteria 3141
90 Ga0068860_100381490 3300005843 Unclassified 1391
91 Ga0068860_100729593 3300005843 Bacteria 1002
92 Ga0081455_10065577 3300005937 Bacteria 3036
93 Ga0081455_10295775 3300005937 Bacteria 1164
94 Ga0081539_10002426 3300005985 Bacteria 26337
95 Ga0081539_10034321 3300005985 Bacteria 3070
96 Ga0081539_10037284 3300005985 Unclassified 2898
97 Ga0075365_10057702 3300006038 Bacteria 2583
98 Ga0068871_100396407 3300006358 Bacteria 1228
99 Ga0075428_100000325 3300006844 Bacteria 47369
100 Ga0075433_10018187 3300006852 Bacteria 5838
101 Ga0075433_10144263 3300006852 Bacteria 2117
102 Ga0075433_10208759 3300006852 Bacteria 1736
103 Ga0075434_100105280 3300006871 Bacteria 2831
104 Ga0075429_100058529 3300006880 Bacteria 3356
105 Ga0068865_100087106 3300006881 Bacteria 2256
106 Ga0097620_100013378 3300006931 Bacteria 8228
107 Ga0097620_100363319 3300006931 Bacteria 1543
108 Ga0075435_100127125 3300007076 Bacteria 2131
109 Ga0075435_100379834 3300007076 Bacteria 1213
110 Ga0105251_10146542 3300009011 Unclassified 1067
111 Ga0111539_10144752 3300009094 Bacteria 2782
112 Ga0111539_10485844 3300009094 Bacteria 1438
113 Ga0105245_10003134 3300009098 Bacteria 14797
114 Ga0105245_10390437 3300009098 Bacteria 1388
115 Ga0114129_10000230 3300009147 Bacteria 62383
116 Ga0114129_10068139 3300009147 Bacteria 4962
117 Ga0114129_10445588 3300009147 Bacteria 1699
118 Ga0105243_10285836 3300009148 Bacteria 1488
119 Ga0105243_10532027 3300009148 Bacteria 1120
120 Ga0105242_10212312 3300009176 Bacteria 1726
121 Ga0105248_10053835 3300009177 Bacteria 4514
122 Ga0105248_10135980 3300009177 Bacteria 2772
123 Ga0105238_10082301 3300009551 Bacteria 3209
124 Ga0105249_10003437 3300009553 Bacteria 13716
125 Ga0105249_10018853 3300009553 Bacteria 6149
126 Ga0105249_10433570 3300009553 Unclassified 1350
127 Ga0105239_10013355 3300010375 Bacteria 9123
128 Ga0105239_10233500 3300010375 Bacteria 2064
129 Ga0105246_10013021 3300011119 Bacteria 5204
130 Ga0105246_10108661 3300011119 Bacteria 2033
131 Ga0157370_10628066 3300013104 Unclassified 982
132 Ga0157374_10423463 3300013296 Unclassified 1330
133 Ga0157374_10479522 3300013296 Bacteria 1247
134 Ga0157378_10024456 3300013297 Bacteria 5315
135 Ga0157378_10032223 3300013297 Bacteria 4630
136 Ga0157378_10243621 3300013297 Bacteria 1718
137 Ga0163162_10182197 3300013306 Unclassified 2227
138 Ga0163162_10619048 3300013306 Bacteria 1208
139 Ga0163163_10041644 3300014325 Bacteria 4493
140 Ga0163163_10054337 3300014325 Bacteria 3957
141 Ga0163163_10139102 3300014325 Bacteria 2470
142 Ga0157380_10057793 3300014326 Bacteria 3090
143 Ga0157377_10011061 3300014745 Bacteria 4490
144 Ga0157379_10072136 3300014968 Unclassified 3089
145 Ga0157376_10147771 3300014969 Bacteria 2116
146 Ga0157376_10636672 3300014969 Bacteria 1065
147 Ga0163161_10136956 3300017792 Bacteria 1852
148 Ga0213876_10117185 3300021384 Bacteria 1414
149 Ga0207642_10025030 3300025899 Bacteria 2408
150 Ga0207688_10002347 3300025901 Bacteria 10170
151 Ga0207647_10185401 3300025904 Bacteria 1207
152 Ga0207647_10258883 3300025904 Bacteria 997
153 Ga0207645_10015669 3300025907 Bacteria 5029
154 Ga0207645_10105284 3300025907 Bacteria 1823
155 Ga0207684_10000712 3300025910 Bacteria 39185
156 Ga0207684_10004784 3300025910 Bacteria 12681
157 Ga0207684_10010743 3300025910 Bacteria 8038
158 Ga0207684_10035430 3300025910 Bacteria 4238
159 Ga0207684_10078840 3300025910 Unclassified 2802
160 Ga0207707_10204886 3300025912 Bacteria 1719
161 Ga0207660_10000002 3300025917 Bacteria 883566
162 Ga0207662_10000529 3300025918 Bacteria 16963
163 Ga0207662_10087705 3300025918 Bacteria 1909
164 Ga0207652_10249232 3300025921 Bacteria 1601
165 Ga0207646_10002848 3300025922 Bacteria 20107
166 Ga0207646_10006928 3300025922 Bacteria 11636
167 Ga0207646_10008615 3300025922 Bacteria 10193
168 Ga0207646_10011343 3300025922 Bacteria 8647
169 Ga0207646_10117723 3300025922 Bacteria 2386
170 Ga0207681_10344524 3300025923 Bacteria 1191
171 Ga0207694_10528073 3300025924 Bacteria 989
172 Ga0207687_10037022 3300025927 Bacteria 3327
173 Ga0207644_10393993 3300025931 Bacteria 1131
174 Ga0207690_10027671 3300025932 Unclassified 3585
175 Ga0207690_10098884 3300025932 Bacteria 2079
176 Ga0207706_10251365 3300025933 Bacteria 1544
177 Ga0207686_10080467 3300025934 Unclassified 2124
178 Ga0207709_10239949 3300025935 Bacteria 1318
179 Ga0207670_10335655 3300025936 Bacteria 1193
180 Ga0207704_10018543 3300025938 Bacteria 3635
181 Ga0207704_10090788 3300025938 Unclassified 2006
182 Ga0207691_10084897 3300025940 Bacteria 2842
183 Ga0207711_10065954 3300025941 Bacteria 3130
184 Ga0207689_10006768 3300025942 Bacteria 10090
185 Ga0207689_10127655 3300025942 Unclassified 2091
186 Ga0207689_10209920 3300025942 Bacteria 1608
187 Ga0207661_10150281 3300025944 Bacteria 2013
188 Ga0207651_10052791 3300025960 Bacteria 2774
189 Ga0207651_10172857 3300025960 Unclassified 1706
190 Ga0207712_10004562 3300025961 Bacteria 8738
191 Ga0207712_10014655 3300025961 Bacteria 5048
192 Ga0207712_10173286 3300025961 Bacteria 1688
193 Ga0207668_10300861 3300025972 Unclassified 1324
194 Ga0207640_10054307 3300025981 Bacteria 2618
195 Ga0207677_10043835 3300026023 Bacteria 2977
196 Ga0207677_10138978 3300026023 Bacteria 1857
197 Ga0207703_10235282 3300026035 Bacteria 1644
198 Ga0207703_10588677 3300026035 Bacteria 1051
199 Ga0207639_10419501 3300026041 Bacteria 1209
200 Ga0207678_10430180 3300026067 Archaea 1145
201 Ga0207708_10009321 3300026075 Bacteria 7266
202 Ga0207708_10228018 3300026075 Bacteria 1495
203 Ga0207708_10296017 3300026075 Bacteria 1315
204 Ga0207708_10299751 3300026075 Bacteria 1307
205 Ga0207648_10009433 3300026089 Bacteria 9351
206 Ga0207674_10010160 3300026116 Bacteria 10702
207 Ga0207674_10373499 3300026116 Bacteria 1378
208 Ga0207675_100427650 3300026118 Unclassified 1309
209 Ga0207683_10009373 3300026121 Bacteria 8339
210 Ga0209969_1015607 3300027360 Unclassified 1110
211 Ga0209971_1009099 3300027682 Bacteria 2356
212 Ga0209998_10001613 3300027717 Bacteria 5410
213 Ga0209974_10023032 3300027876 Bacteria 2062
214 Ga0207428_10045466 3300027907 Bacteria 3536
215 Ga0268265_10473223 3300028380 Bacteria 1175
216 Ga0265337_1016163 3300028556 Bacteria 2420
217 Ga0265326_10012548 3300028558 Bacteria 2489
218 Ga0265326_10040978 3300028558 Unclassified 1315
219 Ga0265319_1000873 3300028563 Bacteria 19174
220 Ga0265319_1003684 3300028563 Bacteria 7887
221 Ga0265334_10021191 3300028573 Bacteria 2655
222 Ga0265334_10039087 3300028573 Bacteria 1863
223 Ga0265318_10007658 3300028577 Unclassified 4861
224 Ga0265318_10007995 3300028577 Bacteria 4741
225 Ga0265322_10021760 3300028654 Bacteria 1836
226 Ga0265322_10054147 3300028654 Bacteria 1138
227 Ga0265338_10077502 3300028800 Bacteria 2809
228 Ga0265338_10118660 3300028800 Unclassified 2114
229 Ga0265324_10003668 3300029957 Bacteria 7203
230 Ga0265324_10047628 3300029957 Unclassified 1474
231 Ga0265324_10067049 3300029957 Bacteria 1224
232 Ga0265330_10019852 3300031235 Bacteria 3073
233 Ga0265330_10163204 3300031235 Bacteria 946
234 Ga0265320_10008306 3300031240 Bacteria 6358
235 Ga0265320_10012317 3300031240 Bacteria 4986
236 Ga0265320_10147675 3300031240 Bacteria 1063
237 Ga0265325_10021129 3300031241 Bacteria 3581
238 Ga0265325_10051184 3300031241 Bacteria 2124
239 Ga0265325_10076922 3300031241 Bacteria 1664
240 Ga0265340_10002781 3300031247 Bacteria 9976
241 Ga0265340_10007956 3300031247 Bacteria 5747
242 Ga0265339_10012075 3300031249 Bacteria 5293
243 Ga0265339_10096056 3300031249 Unclassified 1547
244 Ga0265331_10026745 3300031250 Bacteria 2897
245 Ga0265331_10046811 3300031250 Bacteria 2084
246 Ga0265316_10013517 3300031344 Bacteria 7245
247 Ga0265316_10042337 3300031344 Bacteria 3641
248 Ga0265316_10052157 3300031344 Bacteria 3209
249 Ga0265316_10101860 3300031344 Unclassified 2181
250 Ga0265313_10011289 3300031595 Bacteria 5564
251 Ga0316579_10145489 3300031691 Unclassified 1143
252 Ga0265314_10009343 3300031711 Bacteria 8295
253 Ga0265314_10045584 3300031711 Bacteria 3099
254 Ga0265314_10072259 3300031711 Bacteria 2305
255 Ga0265342_10047873 3300031712 Unclassified 2565
256 Ga0316576_10042412 3300031727 Bacteria 3279
257 Ga0316576_10106815 3300031727 Bacteria 2096
258 Ga0307405_10031787 3300031731 Bacteria 3112
259 Ga0316577_10002560 3300031733 Bacteria 9040
260 Ga0307409_100024262 3300031995 Unclassified 4226
261 Ga0307409_100270721 3300031995 Bacteria 1564
262 Ga0307416_100173937 3300032002 Bacteria 2009
263 Ga0307416_100234402 3300032002 Bacteria 1772
264 Ga0307411_10110910 3300032005 Bacteria 1963
265 Ga0307415_100002413 3300032126 Bacteria 9318
266 Ga0307415_100058159 3300032126 Unclassified 2660
267 Ga0316596_1038925 3300033541 Bacteria 1247
268 Ga0373938_0007550 3300034957 Bacteria 1916
269 Ga0373944_0101235 3300035089 Unclassified 974
270 Ga0373955_0220872 3300035172 Bacteria 1132
271 Ga0373961_0019488 3300035241 Bacteria 1783
272 Ga0316574_0208949 3300035398 Bacteria 1253
273 Ga0373931_0008369 3300035691 Bacteria 4903
274 Ga0373947_0068744 3300035725 Unclassified 2167
275 Ga0373937_0136798 3300036401 Bacteria 2291
276 Ga0373937_0392959 3300036401 Unclassified 1316
277 Ga0373937_0561970 3300036401 Unclassified 1084
278 Ga0316582_0034496 3300036647 Bacteria 3117
279 Ga0316584_0124349 3300036712 Bacteria 1927
280 Ga0316584_0195686 3300036712 Bacteria 1493
281 Ga0395901_0327643 3300038443 Bacteria 1584
282 Ga0436365_1179950 3300039437 Bacteria 2702
283 Ga0439438_023046 3300041405 Bacteria 1721
284 Ga0451787_504911 3300041441 Unclassified 1102
285 Ga0451853_1137783 3300041512 Bacteria 2630
286 Ga0450910_004649 3300042147 Unclassified 1857
287 Ga0450910_013392 3300042147 Bacteria 1193
288 Ga0439446_0025913 3300042156 Bacteria 1678
289 Ga0439434_0076315 3300042435 Bacteria 1059
290 Ga0451577_0225172 3300042876 Bacteria 1695
291 Ga0453683_0035695 3300044673 Bacteria 3132
292 Ga0453684_0113218 3300044712 Bacteria 3292
293 Ga0451576_0406566 3300045051 Bacteria 1427
294 Ga0495603_0078527 3300046455 Unclassified 1936
295 Ga0495603_0122698 3300046455 Bacteria 1514
296 Ga0495641_0110604 3300046461 Bacteria 1226
297 Ga0495651_0082789 3300046462 Bacteria 2421
298 Ga0495584_0179582 3300046491 Unclassified 1076
299 Ga0495630_0094594 3300046517 Bacteria 2259
300 Ga0495630_0222256 3300046517 Unclassified 1442
301 Ga0495586_0156385 3300046535 Bacteria 1284
302 Ga0495645_0114857 3300046543 Bacteria 1902
303 Ga0495634_0065596 3300046642 Bacteria 2406
304 Ga0495634_0123001 3300046642 Bacteria 1661
305 Ga0495599_0123152 3300046678 Bacteria 1612
306 Ga0495647_0074307 3300046681 Bacteria 1366
307 Ga0495604_0232080 3300047317 Bacteria 1265
308 Ga0495674_0333682 3300047319 Bacteria 1233
309 Ga0495676_0128715 3300047321 Bacteria 1831
310 Ga0495675_0155486 3300047444 Bacteria 1411
311 Ga0495684_0218182 3300047471 Bacteria 1400
312 Ga0496100_0174909 3300048903 Bacteria 1549
313 Ga0496101_0507199 3300048904 Bacteria 953
314 Ga0496102_0029889 3300048905 Bacteria 4876
315 Ga0496102_0278402 3300048905 Unclassified 1577
316 Ga0496102_0301860 3300048905 Unclassified 1509
317 Ga0496103_0037630 3300048906 Bacteria 2965
318 Ga0496104_0018479 3300048907 Bacteria 6360
319 Ga0496104_0050001 3300048907 Bacteria 3944
320 Ga0496104_0181138 3300048907 Bacteria 2017
321 Ga0496105_0007111 3300048908 Bacteria 8634
322 Ga0496105_0108189 3300048908 Bacteria 2295
323 Ga0496105_0389515 3300048908 Unclassified 1108
324 Ga0496106_0036349 3300048909 Unclassified 3685
325 Ga0496106_0066274 3300048909 Unclassified 2750
326 Ga0496107_0159858 3300048910 Bacteria 1669
327 Ga0496108_0006817 3300048911 Bacteria 9242
328 Ga0496108_0096894 3300048911 Bacteria 2513
329 Ga0496108_0123690 3300048911 Unclassified 2220
330 Ga0496108_0652720 3300048911 Bacteria 914
331 Ga0496109_0001774 3300048912 Bacteria 17925
332 Ga0496109_0022259 3300048912 Bacteria 5613
333 Ga0496109_0023817 3300048912 Bacteria 5435
334 Ga0496109_0127795 3300048912 Bacteria 2370
335 Ga0496109_0515589 3300048912 Unclassified 1128
336 Ga0496109_0525726 3300048912 Bacteria 1116
337 Ga0496110_0005084 3300048913 Bacteria 10279
338 Ga0496110_0347930 3300048913 Unclassified 1350
339 Ga0496110_0517650 3300048913 Unclassified 1085
340 Ga0496110_0581251 3300048913 Bacteria 1017
341 Ga0496111_0004475 3300048914 Bacteria 8841
342 Ga0496111_0012841 3300048914 Bacteria 5683
343 Ga0496111_0353726 3300048914 Bacteria 1087
344 Ga0496112_0000001 3300048915 Bacteria 1346031
345 Ga0496112_0183914 3300048915 Bacteria 2053
346 Ga0496112_0347849 3300048915 Bacteria 1425
347 Ga0496112_0372113 3300048915 Bacteria 1370
348 Ga0496112_0426291 3300048915 Bacteria 1265
349 Ga0496113_0001609 3300048916 Bacteria 12701
350 Ga0496113_0072310 3300048916 Bacteria 2624
351 Ga0496113_0491836 3300048916 Unclassified 985
352 Ga0496113_0525898 3300048916 Bacteria 949
353 Ga0496113_0544307 3300048916 Bacteria 931
354 Ga0501031_0002555 3300049568 Bacteria 11596
355 Ga0501031_0126913 3300049568 Bacteria 1666
356 Ga0501032_0035857 3300049569 Bacteria 3389
357 Ga0501036_0035005 3300049572 Bacteria 4248
358 Ga0501036_0043326 3300049572 Bacteria 3810
359 Ga0501037_0099139 3300049573 Bacteria 2104
360 Ga0501038_0151359 3300049574 Bacteria 1891
361 Ga0501038_0176140 3300049574 Bacteria 1728
362 Ga0501039_0009864 3300049575 Bacteria 7283
363 Ga0501039_0021914 3300049575 Bacteria 4902
364 Ga0501040_0011595 3300049576 Bacteria 5770
365 Ga0501040_0031677 3300049576 Bacteria 3575
366 Ga0501040_0151478 3300049576 Bacteria 1636
367 Ga0501041_0012874 3300049577 Unclassified 4956
368 Ga0501041_0028975 3300049577 Bacteria 3340
369 Ga0501041_0044266 3300049577 Bacteria 2706
370 Ga0501041_0328448 3300049577 Bacteria 965
371 Ga0501042_0005614 3300049578 Bacteria 8089
372 Ga0501042_0031067 3300049578 Bacteria 3778
373 Ga0501042_0146524 3300049578 Bacteria 1702
374 Ga0501046_0035163 3300049580 Bacteria 4038
375 Ga0501048_0044534 3300049582 Bacteria 3172
376 Ga0501048_0090023 3300049582 Bacteria 2165
377 Ga0501067_0017361 3300049583 Bacteria 3978
378 Ga0501069_0003102 3300049585 Bacteria 8519
379 Ga0501069_0032625 3300049585 Bacteria 2867
380 Ga0501070_0036773 3300049586 Bacteria 4089
381 Ga0501071_0028001 3300049587 Bacteria 3968
382 Ga0501071_0061524 3300049587 Unclassified 2719
383 Ga0501071_0209103 3300049587 Bacteria 1467
384 Ga0501072_0003871 3300049588 Bacteria 11316
385 Ga0501072_0031085 3300049588 Bacteria 4177
386 Ga0501072_0033717 3300049588 Bacteria 4012
387 Ga0501072_0056424 3300049588 Bacteria 3095
388 Ga0501072_0125738 3300049588 Bacteria 2043
389 Ga0501072_0169206 3300049588 Bacteria 1744
390 Ga0501072_0338929 3300049588 Bacteria 1194
391 Ga0501073_0020518 3300049589 Bacteria 4765
392 Ga0501073_0226996 3300049589 Bacteria 1290
393 Ga0501074_0038375 3300049590 Unclassified 3472
394 Ga0501074_0120536 3300049590 Bacteria 1876
395 Ga0501074_0213497 3300049590 Bacteria 1374
396 Ga0501075_0003794 3300049591 Bacteria 10165
397 Ga0501075_0007319 3300049591 Bacteria 7656
398 Ga0501075_0010262 3300049591 Bacteria 6579
399 Ga0501076_0003176 3300049592 Bacteria 11464
400 Ga0501076_0014439 3300049592 Bacteria 5950
401 Ga0501076_0041084 3300049592 Bacteria 3636
402 Ga0501076_0085038 3300049592 Bacteria 2541
403 Ga0501077_0141878 3300049593 Bacteria 1524
404 Ga0501079_0007047 3300049741 Bacteria 8479
405 Ga0501079_0049310 3300049741 Unclassified 3249
406 Ga0501080_0008464 3300049742 Bacteria 9320
407 Ga0501080_0042130 3300049742 Bacteria 4253
408 Ga0501080_0243811 3300049742 Unclassified 1640
409 Ga0501080_0548191 3300049742 Bacteria 1030
410 Ga0501080_0589983 3300049742 Unclassified 987
411 Ga0501081_0012379 3300049743 Bacteria 5604
412 Ga0501081_0027166 3300049743 Unclassified 3862
413 Ga0501081_0099861 3300049743 Bacteria 2051
414 Ga0501081_0306421 3300049743 Bacteria 1165
415 Ga0501081_0310726 3300049743 Unclassified 1157
416 Ga0501083_0028846 3300049744 Bacteria 3823
417 Ga0501083_0141971 3300049744 Bacteria 1573
418 Ga0501035_0112589 3300049822 Bacteria 2384
419 Ga0501035_0330506 3300049822 Bacteria 1279
420 Ga0501044_0086827 3300049823 Bacteria 3160
421 Ga0501044_0551316 3300049823 Bacteria 1050
422 Ga0501045_0012147 3300049824 Bacteria 6062
423 Ga0501045_0026615 3300049824 Bacteria 4162
424 Ga0501045_0321551 3300049824 Bacteria 1151
425 Ga0501045_0357125 3300049824 Bacteria 1087
426 nmdc:mga05p37_211535_c1 3300050507 Bacteria 2344
427 nmdc:mga05p37_560_c1 3300050507 Bacteria 40876
428 nmdc:mga09592_57224_c1 3300050508 Bacteria 3295
429 nmdc:mga08y16_38125_c1 3300050511 Bacteria 5047
430 nmdc:mga0n895_731112_c1 3300050512 Bacteria 984
431 nmdc:mga08x19_267742_c1 3300050514 Unclassified 1182
432 nmdc:mga0a205_204171_c1 3300050515 Bacteria 1866
433 nmdc:mga0a205_206699_c1 3300050515 Bacteria 1852
434 nmdc:mga0a205_247978_c1 3300050515 Bacteria 1661
435 nmdc:mga0a205_301124_c1 3300050515 Bacteria 1476
436 nmdc:mga0a205_53710_c1 3300050515 Bacteria 3889
437 Ga0495601_0023592 3300053077 Bacteria 3781
438 Ga0495601_0053090 3300053077 Bacteria 2561
439 Ga0495601_0172079 3300053077 Bacteria 1415
440 Ga0495612_0000202 3300053078 Bacteria 25471
441 Ga0495612_0064632 3300053078 Bacteria 1519
442 Ga0495595_0002936 3300053084 Bacteria 6727
443 Ga0495619_0005887 3300053085 Bacteria 7768
444 Ga0501084_0014845 3300054114 Bacteria 6459
445 Ga0501084_0050843 3300054114 Bacteria 3468
446 Ga0501084_0051988 3300054114 Bacteria 3428
447 Ga0501084_0183194 3300054114 Bacteria 1768
448 Ga0590077_001690 3300059426 Bacteria 5038
449 Ga0501082_0034101 3300060353 Bacteria 4391
450 Ga0501082_0035192 3300060353 Bacteria 4316
451 Ga0501082_0112976 3300060353 Bacteria 2352
452 Ga0501082_0335759 3300060353 Bacteria 1317
453 Ga0501082_0382362 3300060353 Bacteria 1228
454 Ga0530510_0000395 3300061734 Bacteria 28388
455 Ga0530510_0023769 3300061734 Bacteria 4368
456 Ga0530510_0222459 3300061734 Bacteria 1403

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005467 Ga0070706_100012404 Ga0070706_1000124044 245
2 3300005468 Ga0070707_100028878 Ga0070707_1000288783 245
3 3300005471 Ga0070698_100021137 Ga0070698_1000211374 245
4 3300025910 Ga0207684_10010743 Ga0207684_100107435 245
5 3300025922 Ga0207646_10117723 Ga0207646_101177232 245
6 3300005336 Ga0070680_100000017 Ga0070680_10000001779 247
7 3300025917 Ga0207660_10000002 Ga0207660_10000002655 248
8 3300035398 Ga0316574_0208949 Ga0316574_0208949_326_1189 249
9 3300049587 Ga0501071_0061524 Ga0501071_0061524_457_1443 250
10 3300005467 Ga0070706_100097558 Ga0070706_1000975582 252
11 3300005468 Ga0070707_100075487 Ga0070707_1000754873 252
12 3300025910 Ga0207684_10078840 Ga0207684_100788403 252
13 3300035725 Ga0373947_0068744 Ga0373947_0068744_611_1483 253
14 3300005471 Ga0070698_100144664 Ga0070698_1001446643 254
15 3300005466 Ga0070685_10142415 Ga0070685_101424152 255
16 3300005617 Ga0068859_100363358 Ga0068859_1003633581 255
17 3300006931 Ga0097620_100363319 Ga0097620_1003633191 255
18 3300028380 Ga0268265_10473223 Ga0268265_104732231 255
19 3300031344 Ga0265316_10101860 Ga0265316_101018602 255
20 3300031727 Ga0316576_10106815 Ga0316576_101068152 255
21 3300005441 Ga0070700_100087447 Ga0070700_1000874472 256
22 3300025961 Ga0207712_10173286 Ga0207712_101732861 256
23 3300026075 Ga0207708_10228018 Ga0207708_102280182 256
24 3300027907 Ga0207428_10045466 Ga0207428_100454662 256
25 3300049590 Ga0501074_0213497 Ga0501074_0213497_344_1198 256
26 3300050511 nmdc:mga08y16_38125_c1 nmdc:mga08y16_38125_c1_1119_1976 256
27 3300042147 Ga0450910_004649 Ga0450910_004649_905_1765 257
28 3300044712 Ga0453684_0113218 Ga0453684_0113218_1934_2806 260
29 3300041441 Ga0451787_504911 Ga0451787_504911_88_948 261
30 3300027717 Ga0209998_10001613 Ga0209998_100016132 262
31 3300029957 Ga0265324_10003668 Ga0265324_100036683 263
32 3300031241 Ga0265325_10021129 Ga0265325_100211292 263
33 3300031250 Ga0265331_10046811 Ga0265331_100468112 263
34 3300031344 Ga0265316_10042337 Ga0265316_100423372 263
35 3300031595 Ga0265313_10011289 Ga0265313_100112894 263
36 3300031711 Ga0265314_10072259 Ga0265314_100722592 263
37 3300033541 Ga0316596_1038925 Ga0316596_10389251 263
38 3300028573 Ga0265334_10021191 Ga0265334_100211911 265
39 3300031235 Ga0265330_10163204 Ga0265330_101632041 265
40 3300027360 Ga0209969_1015607 Ga0209969_10156071 266
41 3300028556 Ga0265337_1016163 Ga0265337_10161632 266
42 3300028558 Ga0265326_10012548 Ga0265326_100125482 266
43 3300028573 Ga0265334_10039087 Ga0265334_100390872 266
44 3300031240 Ga0265320_10147675 Ga0265320_101476751 266
45 3300031344 Ga0265316_10052157 Ga0265316_100521572 266
46 3300031691 Ga0316579_10145489 Ga0316579_101454891 266
47 3300031727 Ga0316576_10042412 Ga0316576_100424121 266
48 3300031733 Ga0316577_10002560 Ga0316577_100025604 266
49 3300036647 Ga0316582_0034496 Ga0316582_0034496_1605_2456 266
50 3300036712 Ga0316584_0195686 Ga0316584_0195686_351_1202 266
51 3300046543 Ga0495645_0114857 Ga0495645_0114857_802_1680 266
52 3300046642 Ga0495634_0065596 Ga0495634_0065596_1493_2371 266
53 3300048914 Ga0496111_0012841 Ga0496111_0012841_4078_4938 266
54 3300049568 Ga0501031_0126913 Ga0501031_0126913_34_888 266
55 3300049574 Ga0501038_0151359 Ga0501038_0151359_399_1253 266
56 3300049576 Ga0501040_0011595 Ga0501040_0011595_2826_3680 266
57 3300049576 Ga0501040_0031677 Ga0501040_0031677_2036_2890 266
58 3300049577 Ga0501041_0012874 Ga0501041_0012874_822_1676 266
59 3300049577 Ga0501041_0044266 Ga0501041_0044266_1607_2461 266
60 3300049578 Ga0501042_0005614 Ga0501042_0005614_1526_2380 266
61 3300049582 Ga0501048_0090023 Ga0501048_0090023_1165_2019 266
62 3300049588 Ga0501072_0003871 Ga0501072_0003871_6963_7817 266
63 3300049588 Ga0501072_0169206 Ga0501072_0169206_752_1606 266
64 3300049588 Ga0501072_0338929 Ga0501072_0338929_153_1007 266
65 3300049589 Ga0501073_0226996 Ga0501073_0226996_325_1179 266
66 3300049590 Ga0501074_0038375 Ga0501074_0038375_165_1034 266
67 3300049591 Ga0501075_0003794 Ga0501075_0003794_6647_7501 266
68 3300049591 Ga0501075_0007319 Ga0501075_0007319_2702_3556 266
69 3300049592 Ga0501076_0003176 Ga0501076_0003176_5886_6740 266
70 3300049592 Ga0501076_0085038 Ga0501076_0085038_1150_2004 266
71 3300049593 Ga0501077_0141878 Ga0501077_0141878_356_1210 266
72 3300049741 Ga0501079_0049310 Ga0501079_0049310_1106_1960 266
73 3300049742 Ga0501080_0008464 Ga0501080_0008464_3977_4831 266
74 3300049742 Ga0501080_0548191 Ga0501080_0548191_24_893 266
75 3300049742 Ga0501080_0589983 Ga0501080_0589983_48_917 266
76 3300049743 Ga0501081_0027166 Ga0501081_0027166_1111_1965 266
77 3300049743 Ga0501081_0306421 Ga0501081_0306421_174_1028 266
78 3300049822 Ga0501035_0330506 Ga0501035_0330506_290_1144 266
79 3300049823 Ga0501044_0551316 Ga0501044_0551316_63_917 266
80 3300049824 Ga0501045_0012147 Ga0501045_0012147_4898_5752 266
81 3300049824 Ga0501045_0321551 Ga0501045_0321551_187_1041 266
82 3300049824 Ga0501045_0357125 Ga0501045_0357125_170_1024 266
83 3300050514 nmdc:mga08x19_267742_c1 nmdc:mga08x19_267742_c1_262_1113 266
84 3300053077 Ga0495601_0172079 Ga0495601_0172079_59_937 266
85 3300053084 Ga0495595_0002936 Ga0495595_0002936_4045_4923 266
86 3300053085 Ga0495619_0005887 Ga0495619_0005887_351_1229 266
87 3300054114 Ga0501084_0014845 Ga0501084_0014845_4604_5458 266
88 3300060353 Ga0501082_0034101 Ga0501082_0034101_3000_3854 266
89 3300060353 Ga0501082_0335759 Ga0501082_0335759_95_949 266
90 3300060353 Ga0501082_0382362 Ga0501082_0382362_261_1115 266
91 3300061734 Ga0530510_0222459 Ga0530510_0222459_136_990 266
92 3300003323 rootH1_10099171 rootH1_100991713 267
93 3300005328 Ga0070676_10071527 Ga0070676_100715272 267
94 3300005330 Ga0070690_100022751 Ga0070690_1000227512 267
95 3300005335 Ga0070666_10147624 Ga0070666_101476243 267
96 3300005338 Ga0068868_100326387 Ga0068868_1003263871 267
97 3300005339 Ga0070660_100012570 Ga0070660_1000125705 267
98 3300005343 Ga0070687_100021238 Ga0070687_1000212383 267
99 3300005344 Ga0070661_100058715 Ga0070661_1000587153 267
100 3300005345 Ga0070692_10007949 Ga0070692_100079492 267
101 3300005345 Ga0070692_10013055 Ga0070692_100130551 267
102 3300005354 Ga0070675_100034317 Ga0070675_1000343174 267
103 3300005355 Ga0070671_100438273 Ga0070671_1004382731 267
104 3300005356 Ga0070674_100001664 Ga0070674_1000016646 267
105 3300005366 Ga0070659_100026197 Ga0070659_1000261972 267
106 3300005367 Ga0070667_100132136 Ga0070667_1001321362 267
107 3300005434 Ga0070709_10284859 Ga0070709_102848591 267
108 3300005438 Ga0070701_10068680 Ga0070701_100686802 267
109 3300005440 Ga0070705_100129308 Ga0070705_1001293081 267
110 3300005456 Ga0070678_100004755 Ga0070678_1000047552 267
111 3300005457 Ga0070662_100060031 Ga0070662_1000600311 267
112 3300005466 Ga0070685_10015562 Ga0070685_100155622 267
113 3300005467 Ga0070706_100002897 Ga0070706_1000028971 267
114 3300005518 Ga0070699_100050845 Ga0070699_1000508452 267
115 3300005535 Ga0070684_100066858 Ga0070684_1000668582 267
116 3300005535 Ga0070684_100133169 Ga0070684_1001331692 267
117 3300005543 Ga0070672_100061659 Ga0070672_1000616592 267
118 3300005544 Ga0070686_100044923 Ga0070686_1000449233 267
119 3300005544 Ga0070686_100058166 Ga0070686_1000581661 267
120 3300005544 Ga0070686_100112942 Ga0070686_1001129422 267
121 3300005545 Ga0070695_100102881 Ga0070695_1001028812 267
122 3300005545 Ga0070695_100126823 Ga0070695_1001268232 267
123 3300005546 Ga0070696_100006918 Ga0070696_1000069184 267
124 3300005546 Ga0070696_100025696 Ga0070696_1000256963 267
125 3300005547 Ga0070693_100056430 Ga0070693_1000564302 267
126 3300005549 Ga0070704_100266020 Ga0070704_1002660201 267
127 3300005564 Ga0070664_100004621 Ga0070664_1000046217 267
128 3300005615 Ga0070702_100000928 Ga0070702_1000009283 267
129 3300005616 Ga0068852_100028786 Ga0068852_1000287862 267
130 3300005617 Ga0068859_100013378 Ga0068859_1000133782 267
131 3300005618 Ga0068864_100004723 Ga0068864_1000047233 267
132 3300005718 Ga0068866_10077567 Ga0068866_100775672 267
133 3300005834 Ga0068851_10075465 Ga0068851_100754651 267
134 3300005842 Ga0068858_100473355 Ga0068858_1004733551 267
135 3300005843 Ga0068860_100078412 Ga0068860_1000784122 267
136 3300005843 Ga0068860_100729593 Ga0068860_1007295931 267
137 3300005985 Ga0081539_10034321 Ga0081539_100343213 267
138 3300006038 Ga0075365_10057702 Ga0075365_100577022 267
139 3300006852 Ga0075433_10208759 Ga0075433_102087591 267
140 3300006871 Ga0075434_100105280 Ga0075434_1001052803 267
141 3300006881 Ga0068865_100087106 Ga0068865_1000871063 267
142 3300006931 Ga0097620_100013378 Ga0097620_1000133782 267
143 3300009094 Ga0111539_10485844 Ga0111539_104858441 267
144 3300009098 Ga0105245_10003134 Ga0105245_100031345 267
145 3300009147 Ga0114129_10068139 Ga0114129_100681392 267
146 3300009177 Ga0105248_10053835 Ga0105248_100538352 267
147 3300009551 Ga0105238_10082301 Ga0105238_100823012 267
148 3300009553 Ga0105249_10003437 Ga0105249_100034378 267
149 3300010375 Ga0105239_10013355 Ga0105239_100133554 267
150 3300011119 Ga0105246_10108661 Ga0105246_101086612 267
151 3300013296 Ga0157374_10479522 Ga0157374_104795222 267
152 3300013297 Ga0157378_10024456 Ga0157378_100244562 267
153 3300013306 Ga0163162_10182197 Ga0163162_101821972 267
154 3300014325 Ga0163163_10041644 Ga0163163_100416443 267
155 3300014325 Ga0163163_10054337 Ga0163163_100543372 267
156 3300014326 Ga0157380_10057793 Ga0157380_100577932 267
157 3300014745 Ga0157377_10011061 Ga0157377_100110613 267
158 3300017792 Ga0163161_10136956 Ga0163161_101369562 267
159 3300021384 Ga0213876_10117185 Ga0213876_101171852 267
160 3300025899 Ga0207642_10025030 Ga0207642_100250302 267
161 3300025901 Ga0207688_10002347 Ga0207688_100023477 267
162 3300025904 Ga0207647_10185401 Ga0207647_101854011 267
163 3300025904 Ga0207647_10258883 Ga0207647_102588831 267
164 3300025907 Ga0207645_10015669 Ga0207645_100156693 267
165 3300025918 Ga0207662_10000529 Ga0207662_100005293 267
166 3300025923 Ga0207681_10344524 Ga0207681_103445241 267
167 3300025924 Ga0207694_10528073 Ga0207694_105280731 267
168 3300025927 Ga0207687_10037022 Ga0207687_100370222 267
169 3300025931 Ga0207644_10393993 Ga0207644_103939931 267
170 3300025932 Ga0207690_10027671 Ga0207690_100276712 267
171 3300025932 Ga0207690_10098884 Ga0207690_100988842 267
172 3300025933 Ga0207706_10251365 Ga0207706_102513651 267
173 3300025936 Ga0207670_10335655 Ga0207670_103356551 267
174 3300025938 Ga0207704_10018543 Ga0207704_100185432 267
175 3300025940 Ga0207691_10084897 Ga0207691_100848972 267
176 3300025941 Ga0207711_10065954 Ga0207711_100659542 267
177 3300025942 Ga0207689_10006768 Ga0207689_100067686 267
178 3300025944 Ga0207661_10150281 Ga0207661_101502812 267
179 3300025960 Ga0207651_10052791 Ga0207651_100527911 267
180 3300025961 Ga0207712_10004562 Ga0207712_100045622 267
181 3300025961 Ga0207712_10014655 Ga0207712_100146553 267
182 3300025981 Ga0207640_10054307 Ga0207640_100543072 267
183 3300026023 Ga0207677_10043835 Ga0207677_100438352 267
184 3300026035 Ga0207703_10235282 Ga0207703_102352821 267
185 3300026041 Ga0207639_10419501 Ga0207639_104195012 267
186 3300026075 Ga0207708_10009321 Ga0207708_100093213 267
187 3300026075 Ga0207708_10299751 Ga0207708_102997511 267
188 3300026089 Ga0207648_10009433 Ga0207648_100094337 267
189 3300026116 Ga0207674_10010160 Ga0207674_100101605 267
190 3300027876 Ga0209974_10023032 Ga0209974_100230322 267
191 3300029957 Ga0265324_10047628 Ga0265324_100476281 267
192 3300031731 Ga0307405_10031787 Ga0307405_100317872 267
193 3300031995 Ga0307409_100024262 Ga0307409_1000242622 267
194 3300032002 Ga0307416_100234402 Ga0307416_1002344022 267
195 3300032126 Ga0307415_100002413 Ga0307415_1000024133 267
196 3300032126 Ga0307415_100058159 Ga0307415_1000581592 267
197 3300034957 Ga0373938_0007550 Ga0373938_0007550_353_1210 267
198 3300035241 Ga0373961_0019488 Ga0373961_0019488_797_1654 267
199 3300035691 Ga0373931_0008369 Ga0373931_0008369_2187_3044 267
200 3300036401 Ga0373937_0561970 Ga0373937_0561970_17_871 267
201 3300036712 Ga0316584_0124349 Ga0316584_0124349_293_1246 267
202 3300039437 Ga0436365_1179950 Ga0436365_1179950_845_1702 267
203 3300041405 Ga0439438_023046 Ga0439438_023046_251_1111 267
204 3300042147 Ga0450910_013392 Ga0450910_013392_303_1163 267
205 3300042156 Ga0439446_0025913 Ga0439446_0025913_588_1448 267
206 3300042435 Ga0439434_0076315 Ga0439434_0076315_128_988 267
207 3300044673 Ga0453683_0035695 Ga0453683_0035695_1591_2445 267
208 3300045051 Ga0451576_0406566 Ga0451576_0406566_413_1267 267
209 3300046491 Ga0495584_0179582 Ga0495584_0179582_82_936 267
210 3300048903 Ga0496100_0174909 Ga0496100_0174909_445_1302 267
211 3300048905 Ga0496102_0029889 Ga0496102_0029889_2831_3688 267
212 3300048909 Ga0496106_0036349 Ga0496106_0036349_1609_2466 267
213 3300048912 Ga0496109_0022259 Ga0496109_0022259_1302_2159 267
214 3300048914 Ga0496111_0004475 Ga0496111_0004475_1533_2390 267
215 3300048915 Ga0496112_0000001 Ga0496112_0000001_204206_205060 267
216 3300049572 Ga0501036_0035005 Ga0501036_0035005_1832_2689 267
217 3300049575 Ga0501039_0009864 Ga0501039_0009864_1561_2418 267
218 3300049576 Ga0501040_0151478 Ga0501040_0151478_642_1499 267
219 3300049578 Ga0501042_0146524 Ga0501042_0146524_782_1639 267
220 3300049588 Ga0501072_0033717 Ga0501072_0033717_2809_3666 267
221 3300049588 Ga0501072_0056424 Ga0501072_0056424_1496_2353 267
222 3300049590 Ga0501074_0120536 Ga0501074_0120536_315_1172 267
223 3300049592 Ga0501076_0014439 Ga0501076_0014439_458_1315 267
224 3300049743 Ga0501081_0099861 Ga0501081_0099861_944_1801 267
225 3300049744 Ga0501083_0141971 Ga0501083_0141971_676_1533 267
226 3300050507 nmdc:mga05p37_211535_c1 nmdc:mga05p37_211535_c1_1221_2078 267
227 3300050515 nmdc:mga0a205_204171_c1 nmdc:mga0a205_204171_c1_147_1004 267
228 3300050515 nmdc:mga0a205_206699_c1 nmdc:mga0a205_206699_c1_538_1392 267
229 3300054114 Ga0501084_0050843 Ga0501084_0050843_1358_2215 267
230 3300054114 Ga0501084_0183194 Ga0501084_0183194_104_961 267
231 3300060353 Ga0501082_0112976 Ga0501082_0112976_241_1098 267
232 3300061734 Ga0530510_0000395 Ga0530510_0000395_7687_8544 267
233 3300005328 Ga0070676_10326036 Ga0070676_103260361 268
234 3300005334 Ga0068869_100210887 Ga0068869_1002108872 268
235 3300005354 Ga0070675_100258001 Ga0070675_1002580011 268
236 3300005356 Ga0070674_100002848 Ga0070674_1000028485 268
237 3300005441 Ga0070700_100299649 Ga0070700_1002996491 268
238 3300005444 Ga0070694_100042348 Ga0070694_1000423482 268
239 3300005444 Ga0070694_100140716 Ga0070694_1001407162 268
240 3300005445 Ga0070708_100002176 Ga0070708_1000021761 268
241 3300005445 Ga0070708_100037792 Ga0070708_1000377923 268
242 3300005467 Ga0070706_100043417 Ga0070706_1000434173 268
243 3300005468 Ga0070707_100010495 Ga0070707_1000104952 268
244 3300005468 Ga0070707_100023963 Ga0070707_1000239634 268
245 3300005471 Ga0070698_100271225 Ga0070698_1002712251 268
246 3300005518 Ga0070699_100059126 Ga0070699_1000591262 268
247 3300005536 Ga0070697_100026970 Ga0070697_1000269702 268
248 3300005536 Ga0070697_100139882 Ga0070697_1001398822 268
249 3300005544 Ga0070686_100362144 Ga0070686_1003621441 268
250 3300005545 Ga0070695_100034186 Ga0070695_1000341862 268
251 3300005545 Ga0070695_100173647 Ga0070695_1001736472 268
252 3300005546 Ga0070696_100065195 Ga0070696_1000651952 268
253 3300005549 Ga0070704_100035614 Ga0070704_1000356142 268
254 3300005564 Ga0070664_100152223 Ga0070664_1001522232 268
255 3300005615 Ga0070702_100173487 Ga0070702_1001734872 268
256 3300005618 Ga0068864_100049142 Ga0068864_1000491422 268
257 3300005618 Ga0068864_100151256 Ga0068864_1001512562 268
258 3300005618 Ga0068864_100364856 Ga0068864_1003648561 268
259 3300005618 Ga0068864_100473055 Ga0068864_1004730551 268
260 3300005843 Ga0068860_100381490 Ga0068860_1003814901 268
261 3300005937 Ga0081455_10065577 Ga0081455_100655774 268
262 3300005937 Ga0081455_10295775 Ga0081455_102957751 268
263 3300005985 Ga0081539_10002426 Ga0081539_100024262 268
264 3300005985 Ga0081539_10037284 Ga0081539_100372843 268
265 3300006358 Ga0068871_100396407 Ga0068871_1003964071 268
266 3300006844 Ga0075428_100000325 Ga0075428_10000032527 268
267 3300006852 Ga0075433_10018187 Ga0075433_100181874 268
268 3300006852 Ga0075433_10144263 Ga0075433_101442632 268
269 3300006880 Ga0075429_100058529 Ga0075429_1000585294 268
270 3300007076 Ga0075435_100127125 Ga0075435_1001271252 268
271 3300007076 Ga0075435_100379834 Ga0075435_1003798342 268
272 3300009011 Ga0105251_10146542 Ga0105251_101465421 268
273 3300009094 Ga0111539_10144752 Ga0111539_101447522 268
274 3300009098 Ga0105245_10390437 Ga0105245_103904372 268
275 3300009147 Ga0114129_10000230 Ga0114129_1000023042 268
276 3300009147 Ga0114129_10445588 Ga0114129_104455882 268
277 3300009148 Ga0105243_10285836 Ga0105243_102858362 268
278 3300009148 Ga0105243_10532027 Ga0105243_105320271 268
279 3300009176 Ga0105242_10212312 Ga0105242_102123122 268
280 3300009177 Ga0105248_10135980 Ga0105248_101359801 268
281 3300009553 Ga0105249_10433570 Ga0105249_104335702 268
282 3300010375 Ga0105239_10233500 Ga0105239_102335002 268
283 3300011119 Ga0105246_10013021 Ga0105246_100130211 268
284 3300013104 Ga0157370_10628066 Ga0157370_106280661 268
285 3300013296 Ga0157374_10423463 Ga0157374_104234631 268
286 3300013297 Ga0157378_10032223 Ga0157378_100322233 268
287 3300013297 Ga0157378_10243621 Ga0157378_102436212 268
288 3300013306 Ga0163162_10619048 Ga0163162_106190481 268
289 3300014325 Ga0163163_10139102 Ga0163163_101391023 268
290 3300014968 Ga0157379_10072136 Ga0157379_100721362 268
291 3300014969 Ga0157376_10147771 Ga0157376_101477711 268
292 3300014969 Ga0157376_10636672 Ga0157376_106366721 268
293 3300025907 Ga0207645_10105284 Ga0207645_101052844 268
294 3300025910 Ga0207684_10004784 Ga0207684_100047843 268
295 3300025912 Ga0207707_10204886 Ga0207707_102048861 268
296 3300025918 Ga0207662_10087705 Ga0207662_100877053 268
297 3300025921 Ga0207652_10249232 Ga0207652_102492322 268
298 3300025922 Ga0207646_10002848 Ga0207646_100028484 268
299 3300025922 Ga0207646_10008615 Ga0207646_100086154 268
300 3300025922 Ga0207646_10011343 Ga0207646_100113431 268
301 3300025934 Ga0207686_10080467 Ga0207686_100804672 268
302 3300025935 Ga0207709_10239949 Ga0207709_102399492 268
303 3300025938 Ga0207704_10090788 Ga0207704_100907882 268
304 3300025942 Ga0207689_10127655 Ga0207689_101276552 268
305 3300025942 Ga0207689_10209920 Ga0207689_102099201 268
306 3300025960 Ga0207651_10172857 Ga0207651_101728572 268
307 3300025972 Ga0207668_10300861 Ga0207668_103008611 268
308 3300026023 Ga0207677_10138978 Ga0207677_101389782 268
309 3300026035 Ga0207703_10588677 Ga0207703_105886771 268
310 3300026067 Ga0207678_10430180 Ga0207678_104301801 268
311 3300026075 Ga0207708_10296017 Ga0207708_102960171 268
312 3300026118 Ga0207675_100427650 Ga0207675_1004276501 268
313 3300026121 Ga0207683_10009373 Ga0207683_100093735 268
314 3300027682 Ga0209971_1009099 Ga0209971_10090993 268
315 3300028563 Ga0265319_1003684 Ga0265319_10036843 268
316 3300028577 Ga0265318_10007658 Ga0265318_100076583 268
317 3300028654 Ga0265322_10021760 Ga0265322_100217602 268
318 3300028654 Ga0265322_10054147 Ga0265322_100541471 268
319 3300028800 Ga0265338_10077502 Ga0265338_100775021 268
320 3300029957 Ga0265324_10067049 Ga0265324_100670492 268
321 3300031240 Ga0265320_10008306 Ga0265320_100083062 268
322 3300031241 Ga0265325_10051184 Ga0265325_100511842 268
323 3300031247 Ga0265340_10007956 Ga0265340_100079565 268
324 3300031249 Ga0265339_10012075 Ga0265339_100120752 268
325 3300031711 Ga0265314_10009343 Ga0265314_100093434 268
326 3300031712 Ga0265342_10047873 Ga0265342_100478732 268
327 3300031995 Ga0307409_100270721 Ga0307409_1002707211 268
328 3300032002 Ga0307416_100173937 Ga0307416_1001739372 268
329 3300035089 Ga0373944_0101235 Ga0373944_0101235_39_896 268
330 3300035172 Ga0373955_0220872 Ga0373955_0220872_113_970 268
331 3300036401 Ga0373937_0136798 Ga0373937_0136798_1244_2101 268
332 3300036401 Ga0373937_0392959 Ga0373937_0392959_201_1058 268
333 3300038443 Ga0395901_0327643 Ga0395901_0327643_127_984 268
334 3300041512 Ga0451853_1137783 Ga0451853_1137783_457_1314 268
335 3300042876 Ga0451577_0225172 Ga0451577_0225172_695_1552 268
336 3300046455 Ga0495603_0078527 Ga0495603_0078527_370_1227 268
337 3300046455 Ga0495603_0122698 Ga0495603_0122698_453_1310 268
338 3300046462 Ga0495651_0082789 Ga0495651_0082789_1091_1948 268
339 3300046517 Ga0495630_0094594 Ga0495630_0094594_129_986 268
340 3300046517 Ga0495630_0222256 Ga0495630_0222256_511_1368 268
341 3300046642 Ga0495634_0123001 Ga0495634_0123001_40_897 268
342 3300046678 Ga0495599_0123152 Ga0495599_0123152_741_1598 268
343 3300047317 Ga0495604_0232080 Ga0495604_0232080_296_1153 268
344 3300047319 Ga0495674_0333682 Ga0495674_0333682_261_1118 268
345 3300047444 Ga0495675_0155486 Ga0495675_0155486_106_963 268
346 3300047471 Ga0495684_0218182 Ga0495684_0218182_283_1140 268
347 3300048904 Ga0496101_0507199 Ga0496101_0507199_85_942 268
348 3300048905 Ga0496102_0278402 Ga0496102_0278402_431_1288 268
349 3300048905 Ga0496102_0301860 Ga0496102_0301860_592_1449 268
350 3300048906 Ga0496103_0037630 Ga0496103_0037630_1081_1938 268
351 3300048907 Ga0496104_0018479 Ga0496104_0018479_4739_5596 268
352 3300048907 Ga0496104_0050001 Ga0496104_0050001_1284_2141 268
353 3300048907 Ga0496104_0181138 Ga0496104_0181138_255_1112 268
354 3300048908 Ga0496105_0007111 Ga0496105_0007111_5801_6658 268
355 3300048908 Ga0496105_0108189 Ga0496105_0108189_1412_2269 268
356 3300048908 Ga0496105_0389515 Ga0496105_0389515_163_1020 268
357 3300048909 Ga0496106_0066274 Ga0496106_0066274_557_1414 268
358 3300048910 Ga0496107_0159858 Ga0496107_0159858_244_1101 268
359 3300048911 Ga0496108_0006817 Ga0496108_0006817_3818_4675 268
360 3300048911 Ga0496108_0096894 Ga0496108_0096894_449_1306 268
361 3300048911 Ga0496108_0123690 Ga0496108_0123690_1187_2053 268
362 3300048911 Ga0496108_0652720 Ga0496108_0652720_24_881 268
363 3300048912 Ga0496109_0001774 Ga0496109_0001774_27_884 268
364 3300048912 Ga0496109_0127795 Ga0496109_0127795_783_1640 268
365 3300048912 Ga0496109_0515589 Ga0496109_0515589_132_989 268
366 3300048912 Ga0496109_0525726 Ga0496109_0525726_151_1008 268
367 3300048913 Ga0496110_0005084 Ga0496110_0005084_3090_3947 268
368 3300048913 Ga0496110_0347930 Ga0496110_0347930_262_1119 268
369 3300048913 Ga0496110_0517650 Ga0496110_0517650_109_975 268
370 3300048913 Ga0496110_0581251 Ga0496110_0581251_43_900 268
371 3300048914 Ga0496111_0353726 Ga0496111_0353726_62_919 268
372 3300048915 Ga0496112_0183914 Ga0496112_0183914_34_891 268
373 3300048915 Ga0496112_0347849 Ga0496112_0347849_191_1048 268
374 3300048915 Ga0496112_0372113 Ga0496112_0372113_496_1353 268
375 3300048916 Ga0496113_0001609 Ga0496113_0001609_8609_9466 268
376 3300048916 Ga0496113_0072310 Ga0496113_0072310_250_1107 268
377 3300048916 Ga0496113_0491836 Ga0496113_0491836_21_878 268
378 3300048916 Ga0496113_0525898 Ga0496113_0525898_60_917 268
379 3300048916 Ga0496113_0544307 Ga0496113_0544307_33_890 268
380 3300049568 Ga0501031_0002555 Ga0501031_0002555_2887_3744 268
381 3300049569 Ga0501032_0035857 Ga0501032_0035857_1864_2721 268
382 3300049572 Ga0501036_0043326 Ga0501036_0043326_2084_2941 268
383 3300049573 Ga0501037_0099139 Ga0501037_0099139_70_927 268
384 3300049574 Ga0501038_0176140 Ga0501038_0176140_602_1459 268
385 3300049575 Ga0501039_0021914 Ga0501039_0021914_922_1779 268
386 3300049577 Ga0501041_0028975 Ga0501041_0028975_633_1490 268
387 3300049577 Ga0501041_0328448 Ga0501041_0328448_66_923 268
388 3300049578 Ga0501042_0031067 Ga0501042_0031067_1995_2852 268
389 3300049580 Ga0501046_0035163 Ga0501046_0035163_187_1044 268
390 3300049582 Ga0501048_0044534 Ga0501048_0044534_2046_2903 268
391 3300049583 Ga0501067_0017361 Ga0501067_0017361_1431_2288 268
392 3300049585 Ga0501069_0003102 Ga0501069_0003102_3273_4130 268
393 3300049585 Ga0501069_0032625 Ga0501069_0032625_59_916 268
394 3300049586 Ga0501070_0036773 Ga0501070_0036773_3076_3933 268
395 3300049587 Ga0501071_0028001 Ga0501071_0028001_2799_3656 268
396 3300049587 Ga0501071_0209103 Ga0501071_0209103_84_1019 268
397 3300049588 Ga0501072_0031085 Ga0501072_0031085_1956_2813 268
398 3300049588 Ga0501072_0125738 Ga0501072_0125738_86_943 268
399 3300049589 Ga0501073_0020518 Ga0501073_0020518_3036_3893 268
400 3300049591 Ga0501075_0010262 Ga0501075_0010262_3246_4103 268
401 3300049592 Ga0501076_0041084 Ga0501076_0041084_1858_2715 268
402 3300049741 Ga0501079_0007047 Ga0501079_0007047_4220_5077 268
403 3300049742 Ga0501080_0042130 Ga0501080_0042130_561_1418 268
404 3300049743 Ga0501081_0012379 Ga0501081_0012379_3599_4456 268
405 3300049743 Ga0501081_0310726 Ga0501081_0310726_228_1085 268
406 3300049744 Ga0501083_0028846 Ga0501083_0028846_2795_3652 268
407 3300049822 Ga0501035_0112589 Ga0501035_0112589_822_1679 268
408 3300049823 Ga0501044_0086827 Ga0501044_0086827_781_1638 268
409 3300049824 Ga0501045_0026615 Ga0501045_0026615_2818_3675 268
410 3300050507 nmdc:mga05p37_560_c1 nmdc:mga05p37_560_c1_33084_33941 268
411 3300050508 nmdc:mga09592_57224_c1 nmdc:mga09592_57224_c1_1390_2247 268
412 3300050512 nmdc:mga0n895_731112_c1 nmdc:mga0n895_731112_c1_77_934 268
413 3300050515 nmdc:mga0a205_247978_c1 nmdc:mga0a205_247978_c1_373_1230 268
414 3300050515 nmdc:mga0a205_301124_c1 nmdc:mga0a205_301124_c1_465_1322 268
415 3300050515 nmdc:mga0a205_53710_c1 nmdc:mga0a205_53710_c1_1626_2483 268
416 3300053077 Ga0495601_0023592 Ga0495601_0023592_641_1498 268
417 3300053077 Ga0495601_0053090 Ga0495601_0053090_302_1159 268
418 3300053078 Ga0495612_0064632 Ga0495612_0064632_607_1464 268
419 3300054114 Ga0501084_0051988 Ga0501084_0051988_488_1345 268
420 3300059426 Ga0590077_001690 Ga0590077_001690_3417_4274 268
421 3300060353 Ga0501082_0035192 Ga0501082_0035192_1612_2469 268
422 3300061734 Ga0530510_0023769 Ga0530510_0023769_2019_2876 268
423 3300026116 Ga0207674_10373499 Ga0207674_103734992 270
424 3300028558 Ga0265326_10040978 Ga0265326_100409782 273
425 3300028563 Ga0265319_1000873 Ga0265319_100087316 273
426 3300028577 Ga0265318_10007995 Ga0265318_100079952 273
427 3300028800 Ga0265338_10118660 Ga0265338_101186602 273
428 3300031235 Ga0265330_10019852 Ga0265330_100198521 273
429 3300031240 Ga0265320_10012317 Ga0265320_100123173 273
430 3300031241 Ga0265325_10076922 Ga0265325_100769222 273
431 3300031247 Ga0265340_10002781 Ga0265340_100027812 273
432 3300031249 Ga0265339_10096056 Ga0265339_100960561 273
433 3300031250 Ga0265331_10026745 Ga0265331_100267452 273
434 3300031344 Ga0265316_10013517 Ga0265316_100135172 273
435 3300031711 Ga0265314_10045584 Ga0265314_100455842 273
436 3300048915 Ga0496112_0426291 Ga0496112_0426291_214_1101 274
437 3300005530 Ga0070679_100184391 Ga0070679_1001843912 275
438 3300046461 Ga0495641_0110604 Ga0495641_0110604_308_1213 277
439 3300005445 Ga0070708_100021456 Ga0070708_1000214563 279
440 3300049742 Ga0501080_0243811 Ga0501080_0243811_417_1391 279
441 3300005518 Ga0070699_100010946 Ga0070699_1000109461 280
442 3300005468 Ga0070707_100065936 Ga0070707_1000659362 282
443 3300025910 Ga0207684_10035430 Ga0207684_100354303 282
444 3300005444 Ga0070694_100004300 Ga0070694_1000043003 283
445 3300005468 Ga0070707_100000801 Ga0070707_1000008014 283
446 3300005518 Ga0070699_100351477 Ga0070699_1003514772 283
447 3300009553 Ga0105249_10018853 Ga0105249_100188533 283
448 3300025910 Ga0207684_10000712 Ga0207684_100007121 283
449 3300025922 Ga0207646_10006928 Ga0207646_100069283 283
450 3300032005 Ga0307411_10110910 Ga0307411_101109101 283
451 3300053078 Ga0495612_0000202 Ga0495612_0000202_8935_9885 283
452 3300003203 JGI25406J46586_10016718 JGI25406J46586_100167182 284
453 3300046535 Ga0495586_0156385 Ga0495586_0156385_133_1077 284
454 3300046681 Ga0495647_0074307 Ga0495647_0074307_32_976 284
455 3300047321 Ga0495676_0128715 Ga0495676_0128715_768_1712 284
456 3300048912 Ga0496109_0023817 Ga0496109_0023817_812_1756 284

Feature Viewer

pLDDT pTM Quality
70.26 0.37 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map