F447718

General Info

Members Datasets Scaffolds Average Seq Length
456 149 912 194

Family's Representative Sequence

Representative Sequence 3300005440|Ga0070705_100116542|Ga0070705_1001165422
Length 209
Sequence MAAPGSAATRTPEPPVAPGMKPEEILKLIAAARGTAICVPTMTTSPSWRTIAPDDLSVGCVGFMGGASSLGLGLALARPDRRVIVFDGDGSLLMQLGTLATIAGAAPRNLTHLLFKNGVYHTSGAQGIPGGFDVDFVMMAKGAGYRNAYAIGEIEEFKRRLPTMLTEEGPVFVELHTGLAEQTPMTVRGGGVPFPQQVETLRTKLVRPR

Samples

Sample ID Description Type Environment
1 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
85 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
89 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
94 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
95 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
96 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
97 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
98 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
99 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
102 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
103 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
104 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
107 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
108 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
109 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
110 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
111 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
112 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
113 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
114 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
115 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
116 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
117 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
118 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
119 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
126 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
127 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
128 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
129 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
130 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
131 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
132 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
133 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
134 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
135 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
136 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
137 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
138 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
139 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
140 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
141 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
142 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
143 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
144 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
145 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
146 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
147 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
148 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
149 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.1
Rhizosphere 98.9
Stem 0
Stem Tuber 0
Unclassified 9.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070705_100116542 3300005440 Bacteria 1717
2 Ga0065707_10108265 3300005295 Bacteria 2517
3 Ga0065707_10650556 3300005295 Bacteria 663
4 Ga0068869_100150508 3300005334 Bacteria 1804
5 Ga0070680_100051432 3300005336 Bacteria 3361
6 Ga0068868_100389028 3300005338 Bacteria 1201
7 Ga0070692_10048888 3300005345 Bacteria 2192
8 Ga0070692_10159092 3300005345 Bacteria 1292
9 Ga0070669_100067713 3300005353 Bacteria 2635
10 Ga0070669_100171706 3300005353 Bacteria 1691
11 Ga0070671_100659503 3300005355 Bacteria 906
12 Ga0070667_101214078 3300005367 Unclassified 706
13 Ga0070701_10133897 3300005438 Unclassified 1411
14 Ga0070705_100015253 3300005440 Bacteria 3967
15 Ga0070705_100020744 3300005440 Bacteria 3484
16 Ga0070705_100366084 3300005440 Unclassified 1056
17 Ga0070705_100411165 3300005440 Bacteria 1004
18 Ga0070700_100740169 3300005441 Bacteria 786
19 Ga0070708_100001573 3300005445 Bacteria 17485
20 Ga0070708_100037388 3300005445 Bacteria 4234
21 Ga0070708_100044508 3300005445 Bacteria 3903
22 Ga0070708_100094059 3300005445 Bacteria 2734
23 Ga0070708_100100109 3300005445 Bacteria 2652
24 Ga0070708_100132591 3300005445 Unclassified 2307
25 Ga0070708_100330211 3300005445 Bacteria 1437
26 Ga0070708_100457811 3300005445 Bacteria 1204
27 Ga0070708_100460567 3300005445 Unclassified 1200
28 Ga0070708_100692122 3300005445 Unclassified 960
29 Ga0068867_100223128 3300005459 Bacteria 1520
30 Ga0068867_100984835 3300005459 Bacteria 764
31 Ga0068867_100990495 3300005459 Bacteria 761
32 Ga0070706_100004618 3300005467 Bacteria 13217
33 Ga0070706_100014443 3300005467 Bacteria 7295
34 Ga0070706_100083233 3300005467 Unclassified 2964
35 Ga0070706_100215297 3300005467 Bacteria 1793
36 Ga0070706_100304077 3300005467 Bacteria 1488
37 Ga0070706_101011855 3300005467 Bacteria 766
38 Ga0070707_100002520 3300005468 Bacteria 17446
39 Ga0070707_100035878 3300005468 Bacteria 4731
40 Ga0070707_100039006 3300005468 Bacteria 4538
41 Ga0070707_100120025 3300005468 Bacteria 2553
42 Ga0070707_100368933 3300005468 Bacteria 1394
43 Ga0070707_101572458 3300005468 Bacteria 624
44 Ga0070698_100041186 3300005471 Bacteria 4743
45 Ga0070698_100116470 3300005471 Unclassified 2635
46 Ga0070698_100399453 3300005471 Bacteria 1308
47 Ga0070698_100590291 3300005471 Bacteria 1051
48 Ga0070698_100903499 3300005471 Unclassified 829
49 Ga0070699_100009806 3300005518 Bacteria 8288
50 Ga0070699_100036801 3300005518 Bacteria 4234
51 Ga0070699_100172454 3300005518 Bacteria 1917
52 Ga0070699_100492616 3300005518 Bacteria 1113
53 Ga0070699_100910782 3300005518 Bacteria 805
54 Ga0070679_101182366 3300005530 Bacteria 710
55 Ga0070697_100027873 3300005536 Bacteria 4521
56 Ga0070697_100087637 3300005536 Unclassified 2570
57 Ga0070697_100094971 3300005536 Bacteria 2471
58 Ga0070697_100114135 3300005536 Bacteria 2254
59 Ga0070697_100140493 3300005536 Bacteria 2031
60 Ga0070697_100338008 3300005536 Bacteria 1299
61 Ga0070686_100144312 3300005544 Bacteria 1661
62 Ga0070695_100119271 3300005545 Bacteria 1802
63 Ga0070696_100104440 3300005546 Bacteria 2034
64 Ga0070696_100400473 3300005546 Bacteria 1074
65 Ga0070696_100464837 3300005546 Bacteria 1001
66 Ga0070704_100272994 3300005549 Bacteria 1398
67 Ga0068857_100209593 3300005577 Bacteria 1778
68 Ga0068857_100509670 3300005577 Bacteria 1130
69 Ga0068854_100254905 3300005578 Bacteria 1402
70 Ga0070702_100047061 3300005615 Bacteria 2448
71 Ga0068859_100809114 3300005617 Bacteria 1024
72 Ga0068864_100149341 3300005618 Bacteria 2115
73 Ga0068866_10304203 3300005718 Bacteria 997
74 Ga0068861_100552950 3300005719 Bacteria 1049
75 Ga0068861_100558680 3300005719 Bacteria 1044
76 Ga0068870_10015625 3300005840 Bacteria 3607
77 Ga0068870_10569890 3300005840 Bacteria 765
78 Ga0068863_100133272 3300005841 Bacteria 2373
79 Ga0068860_100225573 3300005843 Bacteria 1820
80 Ga0068860_100261190 3300005843 Bacteria 1688
81 Ga0068860_100391411 3300005843 Bacteria 1373
82 Ga0068860_100408228 3300005843 Bacteria 1345
83 Ga0068862_100005154 3300005844 Bacteria 10989
84 Ga0068862_100162402 3300005844 Bacteria 1995
85 Ga0081540_1026152 3300005983 Bacteria 3338
86 Ga0070716_101102288 3300006173 Bacteria 633
87 Ga0070712_100015658 3300006175 Bacteria 4889
88 Ga0075428_100005765 3300006844 Bacteria 13753
89 Ga0075428_100037205 3300006844 Bacteria 5359
90 Ga0075428_100240006 3300006844 Bacteria 1955
91 Ga0075428_100427011 3300006844 Bacteria 1420
92 Ga0075428_101104079 3300006844 Bacteria 838
93 Ga0075430_100004023 3300006846 Bacteria 12400
94 Ga0075430_100006198 3300006846 Bacteria 10082
95 Ga0075430_100019003 3300006846 Bacteria 5846
96 Ga0075430_100032987 3300006846 Bacteria 4395
97 Ga0075430_100070727 3300006846 Bacteria 2927
98 Ga0075430_100145645 3300006846 Bacteria 1973
99 Ga0075430_100160235 3300006846 Bacteria 1873
100 Ga0075430_100277405 3300006846 Bacteria 1387
101 Ga0075430_100450835 3300006846 Bacteria 1062
102 Ga0075430_100641484 3300006846 Bacteria 876
103 Ga0075430_100924072 3300006846 Bacteria 719
104 Ga0075431_100000224 3300006847 Bacteria 42279
105 Ga0075431_100000380 3300006847 Bacteria 35549
106 Ga0075431_100003864 3300006847 Bacteria 14566
107 Ga0075431_100006907 3300006847 Bacteria 11282
108 Ga0075431_100046724 3300006847 Bacteria 4464
109 Ga0075431_100049840 3300006847 Bacteria 4317
110 Ga0075431_100055191 3300006847 Bacteria 4098
111 Ga0075431_100106055 3300006847 Bacteria 2899
112 Ga0075431_100243431 3300006847 Bacteria 1829
113 Ga0075431_100253055 3300006847 Bacteria 1789
114 Ga0075431_100289770 3300006847 Bacteria 1656
115 Ga0075431_100634375 3300006847 Bacteria 1050
116 Ga0075433_10001452 3300006852 Bacteria 17498
117 Ga0075433_10003632 3300006852 Bacteria 11919
118 Ga0075433_10028453 3300006852 Bacteria 4751
119 Ga0075433_10034048 3300006852 Bacteria 4372
120 Ga0075433_10035060 3300006852 Bacteria 4313
121 Ga0075433_10177609 3300006852 Unclassified 1894
122 Ga0075433_10237162 3300006852 Bacteria 1619
123 Ga0075433_10279343 3300006852 Unclassified 1479
124 Ga0075433_10336618 3300006852 Bacteria 1334
125 Ga0075433_10417881 3300006852 Archaea 1183
126 Ga0075434_100005976 3300006871 Bacteria 11141
127 Ga0075434_100016555 3300006871 Bacteria 7089
128 Ga0075434_100034145 3300006871 Bacteria 5022
129 Ga0075434_100034661 3300006871 Bacteria 4986
130 Ga0075434_100072972 3300006871 Bacteria 3424
131 Ga0075434_100195812 3300006871 Bacteria 2041
132 Ga0075434_100216376 3300006871 Bacteria 1936
133 Ga0075434_100382885 3300006871 Bacteria 1427
134 Ga0075434_100449883 3300006871 Bacteria 1309
135 Ga0075434_100673404 3300006871 Unclassified 1052
136 Ga0075434_100781325 3300006871 Bacteria 971
137 Ga0075434_101209209 3300006871 Bacteria 768
138 Ga0075429_100000055 3300006880 Bacteria 55152
139 Ga0075429_100013689 3300006880 Bacteria 7035
140 Ga0075429_100049570 3300006880 Bacteria 3652
141 Ga0075429_100050504 3300006880 Bacteria 3618
142 Ga0075429_100052022 3300006880 Bacteria 3563
143 Ga0075429_100086685 3300006880 Bacteria 2729
144 Ga0075429_100295700 3300006880 Bacteria 1418
145 Ga0075429_100343398 3300006880 Bacteria 1307
146 Ga0075429_100416390 3300006880 Bacteria 1177
147 Ga0075429_100575997 3300006880 Unclassified 986
148 Ga0075436_100002574 3300006914 Bacteria 12474
149 Ga0075436_100109014 3300006914 Bacteria 1932
150 Ga0075436_100132432 3300006914 Bacteria 1749
151 Ga0075436_100283074 3300006914 Archaea 1186
152 Ga0075436_100385210 3300006914 Unclassified 1014
153 Ga0075436_100528340 3300006914 Bacteria 865
154 Ga0097620_100809102 3300006931 Bacteria 1024
155 Ga0075435_100001853 3300007076 Bacteria 13728
156 Ga0075435_100004049 3300007076 Bacteria 10023
157 Ga0075435_100046989 3300007076 Bacteria 3465
158 Ga0075435_100050573 3300007076 Bacteria 3345
159 Ga0075435_100117606 3300007076 Bacteria 2215
160 Ga0075435_100155332 3300007076 Bacteria 1925
161 Ga0075435_100174358 3300007076 Unclassified 1815
162 Ga0075435_100214492 3300007076 Unclassified 1633
163 Ga0075435_100223666 3300007076 Bacteria 1598
164 Ga0075435_100264902 3300007076 Bacteria 1465
165 Ga0075435_100283171 3300007076 Bacteria 1415
166 Ga0099794_10007862 3300007265 Bacteria 4405
167 Ga0099794_10011840 3300007265 Bacteria 3747
168 Ga0099794_10045213 3300007265 Bacteria 2107
169 Ga0111539_10000343 3300009094 Bacteria 57201
170 Ga0111539_10017121 3300009094 Bacteria 8972
171 Ga0111539_10821635 3300009094 Bacteria 1081
172 Ga0105247_10036812 3300009101 Unclassified 2983
173 Ga0114129_10000795 3300009147 Bacteria 40478
174 Ga0114129_10001541 3300009147 Bacteria 31237
175 Ga0114129_10001763 3300009147 Bacteria 29488
176 Ga0114129_10003602 3300009147 Bacteria 21778
177 Ga0114129_10056374 3300009147 Bacteria 5504
178 Ga0114129_10094516 3300009147 Bacteria 4140
179 Ga0114129_10096308 3300009147 Bacteria 4097
180 Ga0114129_10113907 3300009147 Bacteria 3729
181 Ga0114129_10161390 3300009147 Bacteria 3061
182 Ga0114129_10169921 3300009147 Bacteria 2973
183 Ga0114129_10200444 3300009147 Bacteria 2704
184 Ga0114129_10478281 3300009147 Archaea 1630
185 Ga0114129_10876104 3300009147 Unclassified 1139
186 Ga0114129_11084792 3300009147 Bacteria 1003
187 Ga0114129_11939047 3300009147 Bacteria 713
188 Ga0105243_10280938 3300009148 Bacteria 1499
189 Ga0105241_10107580 3300009174 Unclassified 2227
190 Ga0105242_10001981 3300009176 Bacteria 16096
191 Ga0105242_10173383 3300009176 Bacteria 1897
192 Ga0105248_10016145 3300009177 Bacteria 8216
193 Ga0105248_11514011 3300009177 Bacteria 760
194 Ga0105238_11703744 3300009551 Bacteria 661
195 Ga0105249_10071071 3300009553 Bacteria 3214
196 Ga0105249_10664321 3300009553 Bacteria 1100
197 Ga0105249_10833172 3300009553 Unclassified 987
198 Ga0163162_10028276 3300013306 Bacteria 5547
199 Ga0163162_10116428 3300013306 Bacteria 2773
200 Ga0157375_10577222 3300013308 Bacteria 1285
201 Ga0157380_10281946 3300014326 Bacteria 1521
202 Ga0157379_10288259 3300014968 Bacteria 1495
203 Ga0207642_10036303 3300025899 Bacteria 2114
204 Ga0207642_10115760 3300025899 Bacteria 1373
205 Ga0207643_10266972 3300025908 Bacteria 1058
206 Ga0207684_10000408 3300025910 Bacteria 57555
207 Ga0207684_10002411 3300025910 Bacteria 18877
208 Ga0207684_10015992 3300025910 Bacteria 6445
209 Ga0207684_10118948 3300025910 Bacteria 2264
210 Ga0207684_10329909 3300025910 Bacteria 1315
211 Ga0207684_10352938 3300025910 Bacteria 1266
212 Ga0207684_10863735 3300025910 Bacteria 762
213 Ga0207654_10457497 3300025911 Bacteria 896
214 Ga0207693_10004036 3300025915 Bacteria 12477
215 Ga0207660_10039286 3300025917 Bacteria 3308
216 Ga0207660_10059467 3300025917 Bacteria 2744
217 Ga0207660_10115817 3300025917 Bacteria 2023
218 Ga0207662_10156661 3300025918 Unclassified 1452
219 Ga0207646_10006356 3300025922 Bacteria 12224
220 Ga0207646_10033285 3300025922 Bacteria 4663
221 Ga0207646_10036874 3300025922 Bacteria 4411
222 Ga0207646_10038059 3300025922 Bacteria 4334
223 Ga0207646_10266217 3300025922 Bacteria 1549
224 Ga0207646_11097720 3300025922 Unclassified 700
225 Ga0207681_10194677 3300025923 Bacteria 1553
226 Ga0207706_10013825 3300025933 Bacteria 7324
227 Ga0207706_10378539 3300025933 Bacteria 1228
228 Ga0207686_10004177 3300025934 Bacteria 7747
229 Ga0207686_10417947 3300025934 Unclassified 1025
230 Ga0207709_10048121 3300025935 Bacteria 2597
231 Ga0207709_10361794 3300025935 Bacteria 1099
232 Ga0207704_10376250 3300025938 Bacteria 1113
233 Ga0207665_10571575 3300025939 Bacteria 880
234 Ga0207689_10015348 3300025942 Bacteria 6485
235 Ga0207689_10131372 3300025942 Bacteria 2061
236 Ga0207689_10819227 3300025942 Bacteria 786
237 Ga0207712_10122532 3300025961 Bacteria 1969
238 Ga0207712_10415083 3300025961 Bacteria 1134
239 Ga0207640_10215713 3300025981 Bacteria 1465
240 Ga0207708_10081325 3300026075 Bacteria 2490
241 Ga0207708_10133720 3300026075 Bacteria 1941
242 Ga0207708_10684543 3300026075 Bacteria 875
243 Ga0207641_10097995 3300026088 Bacteria 2578
244 Ga0207648_10149000 3300026089 Bacteria 2064
245 Ga0207648_10203451 3300026089 Bacteria 1757
246 Ga0207648_10241214 3300026089 Bacteria 1609
247 Ga0207674_10063400 3300026116 Bacteria 3731
248 Ga0207674_10242689 3300026116 Bacteria 1749
249 Ga0207674_10391170 3300026116 Bacteria 1344
250 Ga0207675_100450378 3300026118 Bacteria 1275
251 Ga0207675_100482053 3300026118 Bacteria 1233
252 Ga0209998_10006948 3300027717 Bacteria 2347
253 Ga0207428_10000013 3300027907 Bacteria 346742
254 Ga0207428_10000368 3300027907 Bacteria 57659
255 Ga0268265_10053259 3300028380 Bacteria 3065
256 Ga0268265_10481308 3300028380 Bacteria 1166
257 Ga0268265_10914896 3300028380 Bacteria 862
258 Ga0268264_10147736 3300028381 Bacteria 2104
259 Ga0268264_10153622 3300028381 Bacteria 2066
260 Ga0268264_10265915 3300028381 Bacteria 1600
261 Ga0268264_11052949 3300028381 Unclassified 821
262 Ga0268264_11104862 3300028381 Bacteria 801
263 Ga0307408_100007915 3300031548 Bacteria 7027
264 Ga0307408_100019893 3300031548 Bacteria 4523
265 Ga0307408_100100929 3300031548 Bacteria 2198
266 Ga0307405_10504639 3300031731 Bacteria 970
267 Ga0307405_10742330 3300031731 Bacteria 817
268 Ga0307410_10439619 3300031852 Bacteria 1062
269 Ga0307406_10172774 3300031901 Bacteria 1566
270 Ga0307412_10121788 3300031911 Bacteria 1879
271 Ga0307416_100048318 3300032002 Bacteria 3375
272 Ga0307416_100252072 3300032002 Unclassified 1719
273 Ga0307411_10285195 3300032005 Bacteria 1316
274 Ga0373940_0003740 3300035088 Bacteria 3142
275 Ga0373932_0023139 3300035112 Bacteria 1659
276 Ga0373932_0137325 3300035112 Bacteria 829
277 Ga0373960_0038639 3300035121 Bacteria 1369
278 Ga0373960_0097045 3300035121 Bacteria 950
279 Ga0373961_0039418 3300035241 Bacteria 1358
280 Ga0373961_0116077 3300035241 Bacteria 882
281 Ga0373931_0014531 3300035691 Bacteria 3850
282 Ga0373931_0021390 3300035691 Bacteria 3245
283 Ga0316582_0253192 3300036647 Bacteria 1207
284 Ga0395901_0017258 3300038443 Bacteria 7367
285 Ga0439434_0064057 3300042435 Bacteria 1152
286 Ga0451577_0182137 3300042876 Bacteria 1894
287 Ga0453683_0050457 3300044673 Bacteria 2607
288 Ga0453684_0046888 3300044712 Bacteria 5740
289 Ga0451576_0017192 3300045051 Bacteria 7956
290 Ga0451576_0078260 3300045051 Bacteria 3441
291 Ga0451576_0098518 3300045051 Bacteria 3041
292 Ga0451576_0126795 3300045051 Bacteria 2659
293 Ga0451576_0571723 3300045051 Unclassified 1187
294 Ga0495603_0182704 3300046455 Unclassified 1213
295 Ga0495580_0002899 3300046472 Bacteria 14745
296 Ga0495584_0305705 3300046491 Bacteria 808
297 Ga0495594_0143109 3300046499 Bacteria 1357
298 Ga0495594_0297767 3300046499 Bacteria 919
299 Ga0495656_0075908 3300046615 Bacteria 1505
300 Ga0495659_0055853 3300046664 Bacteria 1448
301 Ga0495669_0012029 3300046684 Bacteria 3681
302 Ga0495636_0026072 3300047318 Bacteria 2376
303 Ga0496100_0748790 3300048903 Bacteria 764
304 Ga0496102_0305066 3300048905 Bacteria 1500
305 Ga0496103_0332617 3300048906 Bacteria 977
306 Ga0496106_0219626 3300048909 Bacteria 1516
307 Ga0496107_0605203 3300048910 Bacteria 810
308 Ga0501036_0151525 3300049572 Bacteria 1956
309 Ga0501036_0382397 3300049572 Unclassified 1175
310 Ga0501040_0217391 3300049576 Bacteria 1359
311 Ga0501040_0232371 3300049576 Unclassified 1313
312 Ga0501041_0055860 3300049577 Bacteria 2411
313 Ga0501041_0271863 3300049577 Unclassified 1066
314 Ga0501042_0050081 3300049578 Bacteria 2979
315 Ga0501042_0096296 3300049578 Bacteria 2126
316 Ga0501042_0324927 3300049578 Bacteria 1112
317 Ga0501042_0346530 3300049578 Unclassified 1074
318 Ga0501046_0096125 3300049580 Bacteria 2276
319 Ga0501046_0220112 3300049580 Bacteria 1406
320 Ga0501046_0326932 3300049580 Bacteria 1116
321 Ga0501048_0278211 3300049582 Unclassified 1190
322 Ga0501067_0052021 3300049583 Bacteria 2269
323 Ga0501069_0020809 3300049585 Bacteria 3557
324 Ga0501069_0145135 3300049585 Bacteria 1362
325 Ga0501071_0036874 3300049587 Bacteria 3488
326 Ga0501071_0292283 3300049587 Bacteria 1234
327 Ga0501072_0021373 3300049588 Bacteria 5019
328 Ga0501072_0050009 3300049588 Bacteria 3291
329 Ga0501072_0109975 3300049588 Bacteria 2193
330 Ga0501072_0297133 3300049588 Bacteria 1284
331 Ga0501072_0380688 3300049588 Bacteria 1120
332 Ga0501072_0587083 3300049588 Bacteria 879
333 Ga0501073_0167401 3300049589 Unclassified 1522
334 Ga0501074_0027634 3300049590 Bacteria 4114
335 Ga0501074_0081464 3300049590 Bacteria 2321
336 Ga0501075_0014609 3300049591 Bacteria 5626
337 Ga0501075_0061447 3300049591 Bacteria 2831
338 Ga0501075_1030730 3300049591 Unclassified 625
339 Ga0501076_0062536 3300049592 Bacteria 2965
340 Ga0501076_0065085 3300049592 Bacteria 2906
341 Ga0501076_0298164 3300049592 Unclassified 1321
342 Ga0501076_0456795 3300049592 Unclassified 1052
343 Ga0501077_0007232 3300049593 Bacteria 6848
344 Ga0501077_0083791 3300049593 Bacteria 2020
345 Ga0501077_0323811 3300049593 Bacteria 983
346 Ga0501079_0003641 3300049741 Bacteria 11348
347 Ga0501079_0049311 3300049741 Bacteria 3249
348 Ga0501079_0051979 3300049741 Bacteria 3164
349 Ga0501079_0076699 3300049741 Bacteria 2585
350 Ga0501079_0135543 3300049741 Bacteria 1917
351 Ga0501079_0904564 3300049741 Bacteria 695
352 Ga0501081_0078306 3300049743 Bacteria 2310
353 Ga0501081_0097936 3300049743 Bacteria 2070
354 Ga0501081_0163606 3300049743 Bacteria 1604
355 Ga0501081_0248057 3300049743 Bacteria 1299
356 Ga0501081_0306094 3300049743 Bacteria 1166
357 Ga0501081_0477804 3300049743 Unclassified 927
358 Ga0501081_0656997 3300049743 Bacteria 786
359 Ga0501045_0023406 3300049824 Bacteria 4427
360 Ga0501045_0119000 3300049824 Bacteria 1961
361 nmdc:mga05p37_103482_c1 3300050507 Bacteria 3505
362 nmdc:mga05p37_12224_c1 3300050507 Bacteria 10252
363 nmdc:mga05p37_1288868_c1 3300050507 Bacteria 746
364 nmdc:mga05p37_17531_c1 3300050507 Bacteria 8644
365 nmdc:mga05p37_234455_c1 3300050507 Bacteria 2210
366 nmdc:mga05p37_25687_c1 3300050507 Bacteria 7165
367 nmdc:mga05p37_259048_c1 3300050507 Bacteria 2083
368 nmdc:mga05p37_292720_c1 3300050507 Bacteria 1937
369 nmdc:mga05p37_331150_c1 3300050507 Bacteria 1799
370 nmdc:mga05p37_47181_c1 3300050507 Bacteria 5297
371 nmdc:mga05p37_532168_c1 3300050507 Bacteria 1342
372 nmdc:mga05p37_65395_c1 3300050507 Bacteria 4474
373 nmdc:mga05p37_736940_c1 3300050507 Bacteria 1089
374 nmdc:mga05p37_741716_c1 3300050507 Unclassified 1084
375 nmdc:mga05p37_81091_c1 3300050507 Bacteria 3996
376 nmdc:mga05p37_875_c1 3300050507 Bacteria 33909
377 nmdc:mga09592_10344_c1 3300050508 Bacteria 7591
378 nmdc:mga09592_13106_c1 3300050508 Bacteria 6766
379 nmdc:mga09592_148544_c1 3300050508 Bacteria 2021
380 nmdc:mga09592_2408_c1 3300050508 Bacteria 15100
381 nmdc:mga09592_333691_c1 3300050508 Bacteria 1313
382 nmdc:mga09592_40639_c1 3300050508 Bacteria 3907
383 nmdc:mga09592_48049_c1 3300050508 Bacteria 3597
384 nmdc:mga09592_5156_c1 3300050508 Bacteria 10616
385 nmdc:mga09592_686348_c1 3300050508 Bacteria 872
386 nmdc:mga09592_769594_c1 3300050508 Bacteria 816
387 nmdc:mga0qj67_140149_c1 3300050509 Bacteria 1960
388 nmdc:mga0qj67_172440_c1 3300050509 Bacteria 1757
389 nmdc:mga0qj67_30237_c1 3300050509 Bacteria 4213
390 nmdc:mga0qj67_3668_c1 3300050509 Bacteria 11081
391 nmdc:mga0qj67_609_c1 3300050509 Bacteria 24498
392 nmdc:mga0qj67_639948_c1 3300050509 Bacteria 849
393 nmdc:mga0qj67_726701_c1 3300050509 Bacteria 789
394 nmdc:mga06r32_106318_c1 3300050510 Bacteria 2757
395 nmdc:mga06r32_11174_c1 3300050510 Bacteria 8087
396 nmdc:mga06r32_177_c2 3300050510 Bacteria 42810
397 nmdc:mga06r32_22157_c1 3300050510 Bacteria 5870
398 nmdc:mga06r32_24183_c1 3300050510 Bacteria 5634
399 nmdc:mga06r32_343704_c1 3300050510 Bacteria 1477
400 nmdc:mga06r32_443437_c1 3300050510 Bacteria 1278
401 nmdc:mga06r32_45561_c1 3300050510 Bacteria 4182
402 nmdc:mga06r32_50967_c1 3300050510 Bacteria 3961
403 nmdc:mga06r32_69596_c1 3300050510 Bacteria 3401
404 nmdc:mga08y16_124342_c1 3300050511 Bacteria 2684
405 nmdc:mga08y16_1841_c1 3300050511 Bacteria 21510
406 nmdc:mga08y16_412549_c1 3300050511 Bacteria 1381
407 nmdc:mga0n895_14360_c1 3300050512 Bacteria 7191
408 nmdc:mga0n895_217985_c1 3300050512 Unclassified 1938
409 nmdc:mga0n895_223475_c1 3300050512 Bacteria 1911
410 nmdc:mga0n895_27551_c1 3300050512 Bacteria 5400
411 nmdc:mga0n895_27977_c1 3300050512 Bacteria 5359
412 nmdc:mga0n895_317270_c1 3300050512 Bacteria 1579
413 nmdc:mga0n895_38136_c1 3300050512 Bacteria 4654
414 nmdc:mga0n895_4288_c1 3300050512 Bacteria 11677
415 nmdc:mga0n895_434428_c1 3300050512 Bacteria 1326
416 nmdc:mga0rr50_124039_c1 3300050513 Bacteria 2060
417 nmdc:mga0rr50_169140_c1 3300050513 Archaea 1780
418 nmdc:mga0rr50_176055_c1 3300050513 Bacteria 1746
419 nmdc:mga0rr50_193312_c1 3300050513 Bacteria 1669
420 nmdc:mga0rr50_246208_c1 3300050513 Bacteria 1483
421 nmdc:mga0rr50_24990_c1 3300050513 Bacteria 4148
422 nmdc:mga0rr50_2552_c1 3300050513 Bacteria 10313
423 nmdc:mga0rr50_46251_c1 3300050513 Bacteria 3204
424 nmdc:mga0rr50_509506_c1 3300050513 Bacteria 1023
425 nmdc:mga0rr50_8382_c1 3300050513 Bacteria 6433
426 nmdc:mga0rr50_970_c1 3300050513 Bacteria 15577
427 nmdc:mga08x19_121308_c1 3300050514 Bacteria 1753
428 nmdc:mga08x19_1848_c1 3300050514 Bacteria 12976
429 nmdc:mga08x19_187328_c1 3300050514 Bacteria 1415
430 nmdc:mga08x19_50213_c1 3300050514 Bacteria 2676
431 nmdc:mga0a205_103403_c1 3300050515 Bacteria 2747
432 nmdc:mga0a205_11285_c1 3300050515 Bacteria 8226
433 nmdc:mga0a205_13013_c1 3300050515 Bacteria 7724
434 nmdc:mga0a205_1787_c1 3300050515 Bacteria 16271
435 nmdc:mga0a205_211644_c1 3300050515 Bacteria 1827
436 nmdc:mga0a205_223033_c1 3300050515 Bacteria 1770
437 nmdc:mga0a205_26751_c1 3300050515 Bacteria 5504
438 nmdc:mga0a205_281099_c1 3300050515 Unclassified 1540
439 nmdc:mga0a205_495_c1 3300050515 Bacteria 30853
440 nmdc:mga0a205_51233_c1 3300050515 Bacteria 3985
441 nmdc:mga0a205_689_c1 3300050515 Bacteria 27003
442 Ga0501084_0035354 3300054114 Bacteria 4177
443 Ga0501084_0102003 3300054114 Bacteria 2410
444 Ga0501084_0178178 3300054114 Bacteria 1794
445 Ga0590077_013423 3300059426 Bacteria 1703
446 Ga0501082_0069234 3300060353 Bacteria 3038
447 Ga0501082_0145104 3300060353 Bacteria 2060
448 Ga0501082_0203390 3300060353 Bacteria 1723
449 Ga0501082_0427348 3300060353 Bacteria 1157
450 Ga0530510_0030949 3300061734 Bacteria 3846
451 Ga0530510_0037937 3300061734 Bacteria 3476
452 Ga0530510_0061393 3300061734 Unclassified 2721
453 Ga0530510_0112862 3300061734 Bacteria 1991
454 Ga0530510_0166945 3300061734 Bacteria 1630
455 Ga0530510_0228350 3300061734 Unclassified 1384
456 Ga0530510_0874181 3300061734 Bacteria 687
457 Ga0070705_100116542
458 Ga0065707_10108265
459 Ga0065707_10650556
460 Ga0068869_100150508
461 Ga0070680_100051432
462 Ga0068868_100389028
463 Ga0070692_10048888
464 Ga0070692_10159092
465 Ga0070669_100067713
466 Ga0070669_100171706
467 Ga0070671_100659503
468 Ga0070667_101214078
469 Ga0070701_10133897
470 Ga0070705_100015253
471 Ga0070705_100020744
472 Ga0070705_100366084
473 Ga0070705_100411165
474 Ga0070700_100740169
475 Ga0070708_100001573
476 Ga0070708_100037388
477 Ga0070708_100044508
478 Ga0070708_100094059
479 Ga0070708_100100109
480 Ga0070708_100132591
481 Ga0070708_100330211
482 Ga0070708_100457811
483 Ga0070708_100460567
484 Ga0070708_100692122
485 Ga0068867_100223128
486 Ga0068867_100984835
487 Ga0068867_100990495
488 Ga0070706_100004618
489 Ga0070706_100014443
490 Ga0070706_100083233
491 Ga0070706_100215297
492 Ga0070706_100304077
493 Ga0070706_101011855
494 Ga0070707_100002520
495 Ga0070707_100035878
496 Ga0070707_100039006
497 Ga0070707_100120025
498 Ga0070707_100368933
499 Ga0070707_101572458
500 Ga0070698_100041186
501 Ga0070698_100116470
502 Ga0070698_100399453
503 Ga0070698_100590291
504 Ga0070698_100903499
505 Ga0070699_100009806
506 Ga0070699_100036801
507 Ga0070699_100172454
508 Ga0070699_100492616
509 Ga0070699_100910782
510 Ga0070679_101182366
511 Ga0070697_100027873
512 Ga0070697_100087637
513 Ga0070697_100094971
514 Ga0070697_100114135
515 Ga0070697_100140493
516 Ga0070697_100338008
517 Ga0070686_100144312
518 Ga0070695_100119271
519 Ga0070696_100104440
520 Ga0070696_100400473
521 Ga0070696_100464837
522 Ga0070704_100272994
523 Ga0068857_100209593
524 Ga0068857_100509670
525 Ga0068854_100254905
526 Ga0070702_100047061
527 Ga0068859_100809114
528 Ga0068864_100149341
529 Ga0068866_10304203
530 Ga0068861_100552950
531 Ga0068861_100558680
532 Ga0068870_10015625
533 Ga0068870_10569890
534 Ga0068863_100133272
535 Ga0068860_100225573
536 Ga0068860_100261190
537 Ga0068860_100391411
538 Ga0068860_100408228
539 Ga0068862_100005154
540 Ga0068862_100162402
541 Ga0081540_1026152
542 Ga0070716_101102288
543 Ga0070712_100015658
544 Ga0075428_100005765
545 Ga0075428_100037205
546 Ga0075428_100240006
547 Ga0075428_100427011
548 Ga0075428_101104079
549 Ga0075430_100004023
550 Ga0075430_100006198
551 Ga0075430_100019003
552 Ga0075430_100032987
553 Ga0075430_100070727
554 Ga0075430_100145645
555 Ga0075430_100160235
556 Ga0075430_100277405
557 Ga0075430_100450835
558 Ga0075430_100641484
559 Ga0075430_100924072
560 Ga0075431_100000224
561 Ga0075431_100000380
562 Ga0075431_100003864
563 Ga0075431_100006907
564 Ga0075431_100046724
565 Ga0075431_100049840
566 Ga0075431_100055191
567 Ga0075431_100106055
568 Ga0075431_100243431
569 Ga0075431_100253055
570 Ga0075431_100289770
571 Ga0075431_100634375
572 Ga0075433_10001452
573 Ga0075433_10003632
574 Ga0075433_10028453
575 Ga0075433_10034048
576 Ga0075433_10035060
577 Ga0075433_10177609
578 Ga0075433_10237162
579 Ga0075433_10279343
580 Ga0075433_10336618
581 Ga0075433_10417881
582 Ga0075434_100005976
583 Ga0075434_100016555
584 Ga0075434_100034145
585 Ga0075434_100034661
586 Ga0075434_100072972
587 Ga0075434_100195812
588 Ga0075434_100216376
589 Ga0075434_100382885
590 Ga0075434_100449883
591 Ga0075434_100673404
592 Ga0075434_100781325
593 Ga0075434_101209209
594 Ga0075429_100000055
595 Ga0075429_100013689
596 Ga0075429_100049570
597 Ga0075429_100050504
598 Ga0075429_100052022
599 Ga0075429_100086685
600 Ga0075429_100295700
601 Ga0075429_100343398
602 Ga0075429_100416390
603 Ga0075429_100575997
604 Ga0075436_100002574
605 Ga0075436_100109014
606 Ga0075436_100132432
607 Ga0075436_100283074
608 Ga0075436_100385210
609 Ga0075436_100528340
610 Ga0097620_100809102
611 Ga0075435_100001853
612 Ga0075435_100004049
613 Ga0075435_100046989
614 Ga0075435_100050573
615 Ga0075435_100117606
616 Ga0075435_100155332
617 Ga0075435_100174358
618 Ga0075435_100214492
619 Ga0075435_100223666
620 Ga0075435_100264902
621 Ga0075435_100283171
622 Ga0099794_10007862
623 Ga0099794_10011840
624 Ga0099794_10045213
625 Ga0111539_10000343
626 Ga0111539_10017121
627 Ga0111539_10821635
628 Ga0105247_10036812
629 Ga0114129_10000795
630 Ga0114129_10001541
631 Ga0114129_10001763
632 Ga0114129_10003602
633 Ga0114129_10056374
634 Ga0114129_10094516
635 Ga0114129_10096308
636 Ga0114129_10113907
637 Ga0114129_10161390
638 Ga0114129_10169921
639 Ga0114129_10200444
640 Ga0114129_10478281
641 Ga0114129_10876104
642 Ga0114129_11084792
643 Ga0114129_11939047
644 Ga0105243_10280938
645 Ga0105241_10107580
646 Ga0105242_10001981
647 Ga0105242_10173383
648 Ga0105248_10016145
649 Ga0105248_11514011
650 Ga0105238_11703744
651 Ga0105249_10071071
652 Ga0105249_10664321
653 Ga0105249_10833172
654 Ga0163162_10028276
655 Ga0163162_10116428
656 Ga0157375_10577222
657 Ga0157380_10281946
658 Ga0157379_10288259
659 Ga0207642_10036303
660 Ga0207642_10115760
661 Ga0207643_10266972
662 Ga0207684_10000408
663 Ga0207684_10002411
664 Ga0207684_10015992
665 Ga0207684_10118948
666 Ga0207684_10329909
667 Ga0207684_10352938
668 Ga0207684_10863735
669 Ga0207654_10457497
670 Ga0207693_10004036
671 Ga0207660_10039286
672 Ga0207660_10059467
673 Ga0207660_10115817
674 Ga0207662_10156661
675 Ga0207646_10006356
676 Ga0207646_10033285
677 Ga0207646_10036874
678 Ga0207646_10038059
679 Ga0207646_10266217
680 Ga0207646_11097720
681 Ga0207681_10194677
682 Ga0207706_10013825
683 Ga0207706_10378539
684 Ga0207686_10004177
685 Ga0207686_10417947
686 Ga0207709_10048121
687 Ga0207709_10361794
688 Ga0207704_10376250
689 Ga0207665_10571575
690 Ga0207689_10015348
691 Ga0207689_10131372
692 Ga0207689_10819227
693 Ga0207712_10122532
694 Ga0207712_10415083
695 Ga0207640_10215713
696 Ga0207708_10081325
697 Ga0207708_10133720
698 Ga0207708_10684543
699 Ga0207641_10097995
700 Ga0207648_10149000
701 Ga0207648_10203451
702 Ga0207648_10241214
703 Ga0207674_10063400
704 Ga0207674_10242689
705 Ga0207674_10391170
706 Ga0207675_100450378
707 Ga0207675_100482053
708 Ga0209998_10006948
709 Ga0207428_10000013
710 Ga0207428_10000368
711 Ga0268265_10053259
712 Ga0268265_10481308
713 Ga0268265_10914896
714 Ga0268264_10147736
715 Ga0268264_10153622
716 Ga0268264_10265915
717 Ga0268264_11052949
718 Ga0268264_11104862
719 Ga0307408_100007915
720 Ga0307408_100019893
721 Ga0307408_100100929
722 Ga0307405_10504639
723 Ga0307405_10742330
724 Ga0307410_10439619
725 Ga0307406_10172774
726 Ga0307412_10121788
727 Ga0307416_100048318
728 Ga0307416_100252072
729 Ga0307411_10285195
730 Ga0373940_0003740
731 Ga0373932_0023139
732 Ga0373932_0137325
733 Ga0373960_0038639
734 Ga0373960_0097045
735 Ga0373961_0039418
736 Ga0373961_0116077
737 Ga0373931_0014531
738 Ga0373931_0021390
739 Ga0316582_0253192
740 Ga0395901_0017258
741 Ga0439434_0064057
742 Ga0451577_0182137
743 Ga0453683_0050457
744 Ga0453684_0046888
745 Ga0451576_0017192
746 Ga0451576_0078260
747 Ga0451576_0098518
748 Ga0451576_0126795
749 Ga0451576_0571723
750 Ga0495603_0182704
751 Ga0495580_0002899
752 Ga0495584_0305705
753 Ga0495594_0143109
754 Ga0495594_0297767
755 Ga0495656_0075908
756 Ga0495659_0055853
757 Ga0495669_0012029
758 Ga0495636_0026072
759 Ga0496100_0748790
760 Ga0496102_0305066
761 Ga0496103_0332617
762 Ga0496106_0219626
763 Ga0496107_0605203
764 Ga0501036_0151525
765 Ga0501036_0382397
766 Ga0501040_0217391
767 Ga0501040_0232371
768 Ga0501041_0055860
769 Ga0501041_0271863
770 Ga0501042_0050081
771 Ga0501042_0096296
772 Ga0501042_0324927
773 Ga0501042_0346530
774 Ga0501046_0096125
775 Ga0501046_0220112
776 Ga0501046_0326932
777 Ga0501048_0278211
778 Ga0501067_0052021
779 Ga0501069_0020809
780 Ga0501069_0145135
781 Ga0501071_0036874
782 Ga0501071_0292283
783 Ga0501072_0021373
784 Ga0501072_0050009
785 Ga0501072_0109975
786 Ga0501072_0297133
787 Ga0501072_0380688
788 Ga0501072_0587083
789 Ga0501073_0167401
790 Ga0501074_0027634
791 Ga0501074_0081464
792 Ga0501075_0014609
793 Ga0501075_0061447
794 Ga0501075_1030730
795 Ga0501076_0062536
796 Ga0501076_0065085
797 Ga0501076_0298164
798 Ga0501076_0456795
799 Ga0501077_0007232
800 Ga0501077_0083791
801 Ga0501077_0323811
802 Ga0501079_0003641
803 Ga0501079_0049311
804 Ga0501079_0051979
805 Ga0501079_0076699
806 Ga0501079_0135543
807 Ga0501079_0904564
808 Ga0501081_0078306
809 Ga0501081_0097936
810 Ga0501081_0163606
811 Ga0501081_0248057
812 Ga0501081_0306094
813 Ga0501081_0477804
814 Ga0501081_0656997
815 Ga0501045_0023406
816 Ga0501045_0119000
817 nmdc:mga05p37_103482_c1
818 nmdc:mga05p37_12224_c1
819 nmdc:mga05p37_1288868_c1
820 nmdc:mga05p37_17531_c1
821 nmdc:mga05p37_234455_c1
822 nmdc:mga05p37_25687_c1
823 nmdc:mga05p37_259048_c1
824 nmdc:mga05p37_292720_c1
825 nmdc:mga05p37_331150_c1
826 nmdc:mga05p37_47181_c1
827 nmdc:mga05p37_532168_c1
828 nmdc:mga05p37_65395_c1
829 nmdc:mga05p37_736940_c1
830 nmdc:mga05p37_741716_c1
831 nmdc:mga05p37_81091_c1
832 nmdc:mga05p37_875_c1
833 nmdc:mga09592_10344_c1
834 nmdc:mga09592_13106_c1
835 nmdc:mga09592_148544_c1
836 nmdc:mga09592_2408_c1
837 nmdc:mga09592_333691_c1
838 nmdc:mga09592_40639_c1
839 nmdc:mga09592_48049_c1
840 nmdc:mga09592_5156_c1
841 nmdc:mga09592_686348_c1
842 nmdc:mga09592_769594_c1
843 nmdc:mga0qj67_140149_c1
844 nmdc:mga0qj67_172440_c1
845 nmdc:mga0qj67_30237_c1
846 nmdc:mga0qj67_3668_c1
847 nmdc:mga0qj67_609_c1
848 nmdc:mga0qj67_639948_c1
849 nmdc:mga0qj67_726701_c1
850 nmdc:mga06r32_106318_c1
851 nmdc:mga06r32_11174_c1
852 nmdc:mga06r32_177_c2
853 nmdc:mga06r32_22157_c1
854 nmdc:mga06r32_24183_c1
855 nmdc:mga06r32_343704_c1
856 nmdc:mga06r32_443437_c1
857 nmdc:mga06r32_45561_c1
858 nmdc:mga06r32_50967_c1
859 nmdc:mga06r32_69596_c1
860 nmdc:mga08y16_124342_c1
861 nmdc:mga08y16_1841_c1
862 nmdc:mga08y16_412549_c1
863 nmdc:mga0n895_14360_c1
864 nmdc:mga0n895_217985_c1
865 nmdc:mga0n895_223475_c1
866 nmdc:mga0n895_27551_c1
867 nmdc:mga0n895_27977_c1
868 nmdc:mga0n895_317270_c1
869 nmdc:mga0n895_38136_c1
870 nmdc:mga0n895_4288_c1
871 nmdc:mga0n895_434428_c1
872 nmdc:mga0rr50_124039_c1
873 nmdc:mga0rr50_169140_c1
874 nmdc:mga0rr50_176055_c1
875 nmdc:mga0rr50_193312_c1
876 nmdc:mga0rr50_246208_c1
877 nmdc:mga0rr50_24990_c1
878 nmdc:mga0rr50_2552_c1
879 nmdc:mga0rr50_46251_c1
880 nmdc:mga0rr50_509506_c1
881 nmdc:mga0rr50_8382_c1
882 nmdc:mga0rr50_970_c1
883 nmdc:mga08x19_121308_c1
884 nmdc:mga08x19_1848_c1
885 nmdc:mga08x19_187328_c1
886 nmdc:mga08x19_50213_c1
887 nmdc:mga0a205_103403_c1
888 nmdc:mga0a205_11285_c1
889 nmdc:mga0a205_13013_c1
890 nmdc:mga0a205_1787_c1
891 nmdc:mga0a205_211644_c1
892 nmdc:mga0a205_223033_c1
893 nmdc:mga0a205_26751_c1
894 nmdc:mga0a205_281099_c1
895 nmdc:mga0a205_495_c1
896 nmdc:mga0a205_51233_c1
897 nmdc:mga0a205_689_c1
898 Ga0501084_0035354
899 Ga0501084_0102003
900 Ga0501084_0178178
901 Ga0590077_013423
902 Ga0501082_0069234
903 Ga0501082_0145104
904 Ga0501082_0203390
905 Ga0501082_0427348
906 Ga0530510_0030949
907 Ga0530510_0037937
908 Ga0530510_0061393
909 Ga0530510_0112862
910 Ga0530510_0166945
911 Ga0530510_0228350
912 Ga0530510_0874181

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02775

TPP_enzyme_C

Thiamine pyrophosphate enzyme, C-terminal TPP binding domain

40

175

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jub-assembly1.cif.gz_C crystal structure of the his70thr mutant of benzoylformate decarboxylase from pseudomonas putida 0.8117 2 154
3eya-assembly1.cif.gz_B structural basis for membrane binding and catalytic activation of the peripheral membrane enzyme pyruvate oxidase from escherichia coli 0.8093 2 157
4k9q-assembly1.cif.gz_A the crystal structure of benzoylformate decarboxylase from polynucleobacter necessarius 0.8081 1 154
6qsi-assembly1.cif.gz_A pseudomonas fluorescens pf-5 thiamine diphosphate-dependent 4-hydroxybenzoylformate decarboxylase 0.804 1 153
4gm4-assembly1.cif.gz_A crystal structure of benzoylformate decarboxylase mutant l403i 0.8011 2 155
ID Description Score Start End Superfamily
4k9qB03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8415 4 154 3.40.50.970
af_P58416_5_175_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8389 6 169 3.40.50.970
af_A4I3N7_199_405_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8198 3 174 3.40.50.970
af_P58416_5_175_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8033 6 169 3.40.50.970
af_Q4D595_238_443_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.7992 3 175 3.40.50.970
ID Description Score Start End GO Terms
AF-A0A2V7E9T8-F1-model_v4 Thiamine pyrophosphate-binding protein 0.9433 3 180 GO:0000287
GO:0016831
GO:0030976
AF-A0A2V7VFZ1-F1-model_v4 Thiamine pyrophosphate-binding protein 0.9366 1 160 GO:0000287
GO:0016020
GO:0016831
GO:0030976
AF-A0A2D6GCH3-F1-model_v4 Thiamine pyrophosphate-binding protein 0.9304 3 184 GO:0016831
GO:0030976
AF-A0A7V3BH93-F1-model_v4 Thiamine pyrophosphate-binding protein 0.9282 3 183 GO:0000287
GO:0016831
GO:0030976
AF-A0A7C7T7N0-F1-model_v4 Thiamine pyrophosphate-binding protein 0.9197 3 178 GO:0000287
GO:0016831
GO:0030976

Map