F447571

General Info

Members Datasets Scaffolds Average Seq Length
455 319 384 371

Family's Representative Sequence

Representative Sequence 3300010159|Ga0099796_10017980|Ga0099796_100179802
Length 443
Sequence MQQMCQKLRQMRQKLGNRNVPEERPPSPIQFGEAVAATCISAIGDAGGRYGLPYPFVGPKMLKGKSMCTTSVNVVRIATKGPGDVSGMLSLIEQGKIDPKSIVAILGKTEGNGGVNDFTREYAVSALSAALAPYVGLPPHQVEQRIAFVMSGGTEGVLSPHITVFTRNGVANRCSEAVSGKRLSIGMAQTRDFLPEELGRSAQIRETARAVTAAMADAAIVDPQDVHFVQIKCPLLTSDRVEAAAARGNRTVTNSAYGSMAYSRGASALGVAVALREIEGEIDDKSVLSRFDFFSSVASTSAGIELMHNVVIVLGNSTSSAAPFEIGHAVMRDAIDSTAVIRALKSVGLHIEDGSGPATASRQLVNIFAKAEASPNGSIRGFRHIMLEDTDISSTRHARAAVGGLIAGLSGTGAIYVSGGAEHQGPPGGGPVAVIARLSNSSG

Samples

Sample ID Description Type Environment
1 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
2 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
3 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
4 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
5 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
6 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
7 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
8 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
9 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
10 2738541277 Variovorax sp. GV051 Isolate Unclassified
11 2738541307 Variovorax sp. GV008 Isolate Unclassified
12 2738543019 Variovorax sp. GV040 Isolate Unclassified
13 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
14 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
15 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
16 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
17 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
18 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
19 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
20 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
21 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
22 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
23 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
24 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
25 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
26 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
27 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
28 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
29 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
30 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
31 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
32 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
33 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
34 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
35 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
36 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
37 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
38 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
39 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
40 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
41 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
42 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
43 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
44 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
45 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
46 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
47 2922425934
48 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
49 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
50 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
51 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
52 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
53 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
54 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
55 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
56 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
57 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
58 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
59 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
60 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
61 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
62 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
63 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
64 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
65 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
66 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
67 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
68 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
69 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
70 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
71 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
72 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
73 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
74 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
75 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
76 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
77 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
78 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
79 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
80 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
81 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
82 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
83 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
84 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
85 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
86 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
87 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
88 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
89 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
90 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
91 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
92 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
93 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
94 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
95 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
96 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
97 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
98 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
99 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
100 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
101 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
102 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
103 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
106 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
107 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
117 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
118 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
119 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
120 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
121 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
122 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
123 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
125 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
128 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
130 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
154 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
155 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
156 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
157 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
161 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
162 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
163 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
164 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
165 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
166 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
167 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
168 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
169 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
170 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
171 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
174 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
180 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
181 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
182 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
183 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
184 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
185 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
186 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
187 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
188 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
189 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
190 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
191 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
192 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
193 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
194 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
195 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
196 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
197 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
198 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
199 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
200 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
201 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
202 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
203 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
204 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
205 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
206 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
207 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
208 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
209 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
210 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
211 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
212 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
213 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
214 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
215 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
216 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
217 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
218 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
219 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
220 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
221 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
222 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
223 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
224 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
225 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
226 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
227 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
228 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
229 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
230 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
231 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
232 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
233 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
234 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
235 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
236 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
237 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
238 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
239 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
240 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
241 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
242 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
243 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
244 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
245 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
246 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
247 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
248 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
249 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
250 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
251 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
252 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
253 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
254 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
255 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
256 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
257 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
258 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
259 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
260 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
261 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
262 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
263 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
264 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
265 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
266 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
267 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
268 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
269 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
270 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
271 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
273 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
274 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
275 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
276 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
277 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
278 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
279 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
280 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
281 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
282 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
283 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
284 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
285 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
286 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
287 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
288 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
289 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
290 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
291 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
292 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
293 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
294 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
295 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
296 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
297 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
298 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
299 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
300 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
301 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
302 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
303 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
304 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
305 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
306 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
307 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
308 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
309 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
310 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
311 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
312 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
313 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
314 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
315 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
316 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
317 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
318 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
319 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.58
Metatranscriptomes 0
Isolates 15.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.36
Nodule 9.45
Rhizoplane 5.49
Rhizosphere 50.33
Stem 0
Stem Tuber 0
Unclassified 17.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10002853 3300003215 Bacteria 9813
2 JGI25153J46596_10008802 3300003215 Bacteria 4776
3 JGI25153J46596_10016800 3300003215 Bacteria 2914
4 JGI25153J46596_10021256 3300003215 Bacteria 2424
5 JGI25160J50197_1002373 3300003354 Bacteria 8795
6 Ga0055531_10007800 3300003794 Bacteria 5765
7 Ga0055531_10010492 3300003794 Bacteria 4596
8 Ga0065165_1000704 3300005262 Bacteria 47537
9 Ga0065165_1010204 3300005262 Bacteria 4095
10 Ga0065165_1010683 3300005262 Bacteria 3931
11 Ga0070667_100111219 3300005367 Bacteria 2376
12 Ga0070709_10002668 3300005434 Bacteria 9636
13 Ga0070709_10005113 3300005434 Bacteria 7092
14 Ga0070709_10006033 3300005434 Bacteria 6589
15 Ga0070709_10074340 3300005434 Bacteria 2202
16 Ga0070714_100011992 3300005435 Bacteria 6897
17 Ga0070714_100063532 3300005435 Bacteria 3176
18 Ga0070713_100003901 3300005436 Bacteria 9889
19 Ga0070713_100004191 3300005436 Bacteria 9623
20 Ga0070713_100287594 3300005436 Bacteria 1510
21 Ga0070710_10001880 3300005437 Bacteria 9919
22 Ga0070710_10002372 3300005437 Bacteria 8918
23 Ga0070710_10008339 3300005437 Bacteria 5044
24 Ga0070711_100005028 3300005439 Bacteria 7863
25 Ga0070711_100007501 3300005439 Bacteria 6637
26 Ga0070711_100020339 3300005439 Bacteria 4276
27 Ga0070678_100017754 3300005456 Bacteria 4590
28 Ga0070662_100058474 3300005457 Bacteria 2805
29 Ga0070706_100005252 3300005467 Bacteria 12351
30 Ga0070706_100104631 3300005467 Bacteria 2633
31 Ga0070706_100216244 3300005467 Bacteria 1789
32 Ga0070707_100312552 3300005468 Bacteria 1527
33 Ga0070698_100015609 3300005471 Bacteria 8022
34 Ga0070698_100039959 3300005471 Bacteria 4823
35 Ga0070697_100000934 3300005536 Bacteria 21968
36 Ga0070665_100028600 3300005548 Bacteria 5613
37 Ga0070665_100041857 3300005548 Bacteria 4605
38 Ga0068859_100057614 3300005617 Bacteria 3914
39 Ga0068861_100146067 3300005719 Bacteria 1936
40 Ga0068860_100368321 3300005843 Bacteria 1416
41 Ga0068862_100162504 3300005844 Bacteria 1994
42 Ga0081540_1003913 3300005983 Bacteria 11600
43 Ga0070717_10003568 3300006028 Bacteria 11152
44 Ga0070717_10003698 3300006028 Bacteria 10991
45 Ga0070717_10172299 3300006028 Bacteria 1883
46 Ga0075364_10005186 3300006051 Bacteria 7558
47 Ga0075364_10102185 3300006051 Bacteria 1909
48 Ga0070715_10001833 3300006163 Bacteria 6347
49 Ga0070715_10084838 3300006163 Bacteria 1445
50 Ga0070716_100018059 3300006173 Bacteria 3669
51 Ga0070716_100099383 3300006173 Bacteria 1780
52 Ga0070712_100028225 3300006175 Bacteria 3752
53 Ga0070712_100033556 3300006175 Bacteria 3474
54 Ga0070712_100077948 3300006175 Bacteria 2390
55 Ga0070712_100136113 3300006175 Bacteria 1868
56 Ga0075362_10058931 3300006177 Bacteria 1733
57 Ga0075369_10006245 3300006186 Bacteria 4502
58 Ga0075369_10107340 3300006186 Bacteria 1256
59 Ga0075366_10013779 3300006195 Bacteria 4608
60 Ga0075366_10018558 3300006195 Bacteria 4018
61 Ga0075366_10049230 3300006195 Bacteria 2501
62 Ga0075370_10023182 3300006353 Bacteria 3416
63 Ga0075428_100020774 3300006844 Bacteria 7270
64 Ga0075428_100067572 3300006844 Bacteria 3912
65 Ga0075431_100004599 3300006847 Bacteria 13542
66 Ga0075433_10001276 3300006852 Bacteria 18416
67 Ga0075433_10201000 3300006852 Bacteria 1772
68 Ga0075434_100002724 3300006871 Bacteria 15605
69 Ga0075434_100004379 3300006871 Bacteria 12719
70 Ga0075434_100048666 3300006871 Bacteria 4207
71 Ga0075429_100003776 3300006880 Bacteria 12918
72 Ga0068865_100190883 3300006881 Bacteria 1584
73 Ga0097620_100057614 3300006931 Bacteria 3914
74 Ga0075435_100021502 3300007076 Bacteria 4963
75 Ga0099794_10001307 3300007265 Bacteria 8658
76 Ga0105250_10021450 3300009092 Bacteria 2607
77 Ga0114129_10010311 3300009147 Bacteria 13333
78 Ga0114129_10015415 3300009147 Bacteria 10874
79 Ga0105242_10301471 3300009176 Bacteria 1463
80 Ga0099796_10017980 3300010159 Bacteria 2115
81 Ga0099796_10027350 3300010159 Bacteria 1821
82 Ga0163162_10100617 3300013306 Bacteria 2982
83 Ga0157375_10157452 3300013308 Bacteria 2411
84 Ga0163163_10211176 3300014325 Bacteria 1990
85 Ga0182007_10000258 3300015262 Bacteria 35539
86 Ga0163161_10000561 3300017792 Bacteria 29982
87 Ga0163161_10028754 3300017792 Bacteria 3949
88 Ga0163161_10182184 3300017792 Bacteria 1611
89 Ga0214544_1000578 3300021320 Bacteria 68951
90 Ga0214542_1000338 3300021321 Bacteria 80765
91 Ga0214545_1000186 3300021324 Bacteria 80765
92 Ga0214543_1000271 3300021327 Bacteria 80766
93 Ga0214543_1041406 3300021327 Bacteria 1191
94 Ga0213874_10009267 3300021377 Bacteria 2428
95 Ga0213876_10000531 3300021384 Bacteria 28855
96 Ga0213876_10028562 3300021384 Bacteria 2941
97 Ga0213876_10038957 3300021384 Bacteria 2510
98 Ga0207425_1019844 3300025245 Bacteria 1444
99 Ga0209148_1000445 3300025254 Bacteria 45388
100 Ga0209233_1004289 3300025261 Bacteria 4877
101 Ga0209233_1010726 3300025261 Bacteria 2728
102 Ga0209455_1002155 3300025272 Bacteria 7804
103 Ga0209564_1007915 3300025295 Bacteria 5363
104 Ga0209758_1000109 3300025297 Bacteria 214759
105 Ga0209758_1000176 3300025297 Bacteria 143504
106 Ga0209758_1001659 3300025297 Bacteria 25224
107 Ga0209758_1002229 3300025297 Bacteria 20140
108 Ga0209758_1003698 3300025297 Bacteria 13571
109 Ga0209758_1015309 3300025297 Bacteria 3985
110 Ga0209256_1011161 3300025299 Bacteria 3633
111 Ga0209256_1014122 3300025299 Bacteria 2904
112 Ga0207426_1000522 3300025302 Bacteria 55802
113 Ga0207426_1000635 3300025302 Bacteria 44397
114 Ga0209257_1000781 3300025304 Bacteria 46905
115 Ga0207692_10003821 3300025898 Bacteria 5920
116 Ga0207692_10004026 3300025898 Bacteria 5785
117 Ga0207680_10051253 3300025903 Bacteria 2467
118 Ga0207680_10123599 3300025903 Bacteria 1696
119 Ga0207699_10002225 3300025906 Bacteria 9151
120 Ga0207699_10054711 3300025906 Bacteria 2372
121 Ga0207699_10072876 3300025906 Bacteria 2105
122 Ga0207684_10006677 3300025910 Bacteria 10484
123 Ga0207684_10255261 3300025910 Bacteria 1513
124 Ga0207671_10134067 3300025914 Bacteria 1903
125 Ga0207693_10004244 3300025915 Bacteria 12153
126 Ga0207693_10016892 3300025915 Bacteria 5827
127 Ga0207693_10037955 3300025915 Bacteria 3795
128 Ga0207693_10199688 3300025915 Bacteria 1573
129 Ga0207663_10002039 3300025916 Bacteria 9607
130 Ga0207663_10013434 3300025916 Bacteria 4452
131 Ga0207663_10021314 3300025916 Bacteria 3687
132 Ga0207646_10003508 3300025922 Bacteria 17671
133 Ga0207700_10025721 3300025928 Bacteria 4093
134 Ga0207700_10048319 3300025928 Bacteria 3159
135 Ga0207700_10122964 3300025928 Bacteria 2107
136 Ga0207664_10005949 3300025929 Bacteria 8351
137 Ga0207664_10052336 3300025929 Bacteria 3229
138 Ga0207664_10067630 3300025929 Bacteria 2868
139 Ga0207706_10155715 3300025933 Bacteria 2010
140 Ga0207706_10191630 3300025933 Bacteria 1794
141 Ga0207704_10055969 3300025938 Bacteria 2413
142 Ga0207665_10007339 3300025939 Bacteria 7288
143 Ga0207689_10028674 3300025942 Bacteria 4655
144 Ga0207651_10048172 3300025960 Bacteria 2879
145 Ga0207658_10023459 3300025986 Bacteria 4307
146 Ga0207658_10096474 3300025986 Bacteria 2306
147 Ga0207639_10118774 3300026041 Bacteria 2169
148 Ga0207678_10016716 3300026067 Bacteria 6444
149 Ga0207708_10078649 3300026075 Bacteria 2533
150 Ga0207702_10208726 3300026078 Bacteria 1815
151 Ga0207675_100056901 3300026118 Bacteria 3648
152 Ga0207683_10008440 3300026121 Bacteria 8817
153 Ga0209389_1000045 3300027296 Bacteria 118598
154 Ga0209389_1000355 3300027296 Bacteria 27572
155 Ga0209589_1003826 3300027357 Bacteria 26213
156 Ga0209489_100110 3300027361 Bacteria 117680
157 Ga0209489_100210 3300027361 Bacteria 96217
158 Ga0209700_100116 3300027363 Bacteria 115661
159 Ga0209588_1005429 3300027671 Bacteria 3655
160 Ga0268266_10005077 3300028379 Bacteria 12414
161 Ga0268266_10429614 3300028379 Bacteria 1253
162 Ga0268265_10276475 3300028380 Bacteria 1500
163 Ga0307517_10000008 3300028786 Bacteria 243202
164 Ga0307515_10227102 3300028794 Bacteria 1669
165 Ga0265325_10017619 3300031241 Bacteria 3969
166 Ga0265339_10040853 3300031249 Bacteria 2577
167 Ga0265316_10232456 3300031344 Bacteria 1357
168 Ga0307513_10053702 3300031456 Bacteria 4328
169 Ga0307513_10099941 3300031456 Bacteria 2928
170 Ga0307513_10116626 3300031456 Bacteria 2649
171 Ga0307513_10269254 3300031456 Bacteria 1488
172 Ga0307509_10122578 3300031507 Bacteria 2574
173 Ga0265313_10061306 3300031595 Bacteria 1761
174 Ga0307508_10037396 3300031616 Bacteria 4366
175 Ga0265314_10067897 3300031711 Bacteria 2399
176 Ga0265342_10123601 3300031712 Bacteria 1455
177 Ga0307516_10003542 3300031730 Bacteria 19966
178 Ga0307516_10014375 3300031730 Bacteria 8377
179 Ga0307516_10032629 3300031730 Bacteria 5243
180 Ga0307415_100205905 3300032126 Bacteria 1565
181 Ga0307510_10027613 3300033180 Bacteria 6497
182 Ga0307510_10115702 3300033180 Bacteria 2405
183 Ga0373954_0019530 3300035118 Bacteria 3058
184 Ga0373931_0080997 3300035691 Bacteria 1792
185 Ga0395900_0452983 3300037418 Bacteria 1239
186 Ga0395905_0000548 3300037471 Bacteria 51350
187 Ga0395905_0447774 3300037471 Bacteria 1189
188 Ga0395901_0107274 3300038443 Bacteria 2931
189 Ga0436365_0012708 3300039437 Bacteria 3642
190 Ga0436365_0612221 3300039437 Bacteria 8371
191 Ga0436363_1602871 3300039450 Bacteria 4949
192 Ga0439436_0000089 3300041404 Bacteria 21892
193 Ga0439461_0009636 3300041410 Bacteria 1756
194 Ga0439466_0008222 3300041411 Bacteria 3934
195 Ga0439465_0000306 3300041413 Bacteria 13858
196 Ga0451833_0358655 3300041491 Bacteria 1428
197 Ga0439431_0000537 3300041997 Bacteria 8043
198 Ga0439433_0007118 3300041999 Bacteria 2415
199 Ga0439442_000868 3300042002 Bacteria 6221
200 Ga0439445_0000482 3300042004 Bacteria 8089
201 Ga0439432_000424 3300042006 Bacteria 15760
202 Ga0439449_0000280 3300042007 Bacteria 18428
203 Ga0439452_000869 3300042010 Bacteria 13980
204 Ga0439457_019034 3300042014 Bacteria 1525
205 Ga0439462_0037053 3300042015 Bacteria 1298
206 Ga0439446_0000322 3300042156 Bacteria 9178
207 Ga0439434_0001202 3300042435 Bacteria 7458
208 Ga0451577_0193234 3300042876 Bacteria 1836
209 Ga0466972_0001838 3300044658 Bacteria 10389
210 Ga0466972_0013922 3300044658 Bacteria 4034
211 Ga0466966_0014385 3300044684 Bacteria 5239
212 Ga0466963_0006291 3300044694 Bacteria 7021
213 Ga0466957_0020281 3300044842 Bacteria 3911
214 Ga0466959_0033938 3300045049 Bacteria 3775
215 Ga0466959_0064865 3300045049 Bacteria 2651
216 Ga0451576_0370965 3300045051 Bacteria 1499
217 Ga0466967_0020653 3300045976 Bacteria 5329
218 Ga0495617_037388 3300046452 Bacteria 1626
219 Ga0495627_008960 3300046453 Bacteria 3700
220 Ga0495592_0220939 3300046454 Bacteria 1267
221 Ga0495603_0009099 3300046455 Bacteria 6004
222 Ga0495603_0170390 3300046455 Bacteria 1261
223 Ga0495638_0008675 3300046460 Bacteria 7190
224 Ga0495638_0015731 3300046460 Bacteria 5072
225 Ga0495638_0127485 3300046460 Bacteria 1498
226 Ga0495651_0058888 3300046462 Bacteria 2947
227 Ga0495651_0059689 3300046462 Bacteria 2924
228 Ga0495651_0161564 3300046462 Bacteria 1604
229 Ga0495653_0044682 3300046463 Bacteria 3438
230 Ga0495653_0143436 3300046463 Bacteria 1677
231 Ga0495639_0096887 3300046475 Bacteria 1389
232 Ga0495662_0129003 3300046476 Bacteria 1243
233 Ga0495607_0000060 3300046501 Bacteria 108449
234 Ga0495606_0019863 3300046507 Bacteria 4975
235 Ga0495606_0187385 3300046507 Bacteria 1188
236 Ga0495608_0147187 3300046511 Bacteria 1502
237 Ga0495616_0000562 3300046513 Bacteria 28069
238 Ga0495618_0039747 3300046514 Bacteria 2958
239 Ga0495620_0015159 3300046515 Bacteria 3898
240 Ga0495620_0028018 3300046515 Bacteria 2626
241 Ga0495631_0071426 3300046518 Bacteria 1500
242 Ga0495632_0010701 3300046519 Bacteria 5407
243 Ga0495637_0019284 3300046520 Bacteria 3155
244 Ga0495643_0032779 3300046522 Bacteria 2881
245 Ga0495648_0075806 3300046524 Bacteria 1933
246 Ga0495663_0037193 3300046525 Bacteria 1467
247 Ga0495642_0078582 3300046528 Bacteria 1387
248 Ga0495654_0003171 3300046530 Bacteria 10202
249 Ga0495654_0007228 3300046530 Bacteria 6227
250 Ga0495640_0032211 3300046533 Bacteria 3735
251 Ga0495587_0054906 3300046536 Bacteria 2347
252 Ga0495621_0008436 3300046539 Bacteria 3090
253 Ga0495622_0004569 3300046557 Bacteria 6409
254 Ga0495667_0081636 3300046559 Bacteria 2101
255 Ga0495656_0000198 3300046615 Bacteria 21587
256 Ga0495668_0035944 3300046616 Bacteria 2777
257 Ga0495668_0093282 3300046616 Bacteria 1649
258 Ga0495611_0056954 3300046648 Bacteria 1771
259 Ga0495625_0011649 3300046660 Bacteria 7154
260 Ga0495635_0041397 3300046663 Bacteria 3182
261 Ga0495657_0007621 3300046675 Bacteria 8338
262 Ga0495646_0105476 3300046680 Bacteria 1610
263 Ga0495613_0177390 3300046689 Bacteria 1510
264 Ga0495613_0185174 3300046689 Bacteria 1473
265 Ga0495624_0059421 3300046690 Bacteria 2399
266 Ga0495670_0092256 3300046691 Bacteria 1551
267 Ga0495600_0183621 3300046809 Bacteria 1347
268 Ga0495581_0019611 3300047315 Bacteria 3925
269 Ga0495672_0020076 3300047320 Bacteria 4388
270 Ga0495676_0023112 3300047321 Bacteria 5400
271 Ga0495676_0167492 3300047321 Bacteria 1549
272 Ga0495673_0030904 3300047469 Bacteria 2511
273 Ga0495673_0081026 3300047469 Bacteria 1345
274 Ga0495686_0112575 3300047472 Bacteria 1630
275 Ga0495593_0025679 3300047673 Bacteria 3260
276 Ga0495593_0099672 3300047673 Bacteria 1491
277 Ga0495615_0004234 3300048090 Bacteria 2486
278 Ga0496100_0003079 3300048903 Bacteria 8626
279 Ga0496100_0067682 3300048903 Bacteria 2373
280 Ga0496101_0008166 3300048904 Bacteria 6835
281 Ga0496102_0003422 3300048905 Bacteria 13462
282 Ga0496102_0390517 3300048905 Bacteria 1309
283 Ga0496104_0001742 3300048907 Bacteria 18797
284 Ga0496104_0008069 3300048907 Bacteria 9340
285 Ga0496104_0185598 3300048907 Bacteria 1990
286 Ga0496105_0001065 3300048908 Bacteria 18990
287 Ga0496105_0014413 3300048908 Bacteria 6293
288 Ga0496106_0026058 3300048909 Bacteria 4351
289 Ga0496106_0220673 3300048909 Bacteria 1512
290 Ga0496109_0133311 3300048912 Bacteria 2320
291 Ga0496109_0195177 3300048912 Bacteria 1903
292 Ga0496110_0014308 3300048913 Bacteria 6583
293 Ga0496110_0079971 3300048913 Bacteria 2911
294 Ga0496110_0311662 3300048913 Bacteria 1433
295 Ga0496114_0010148 3300048917 Bacteria 7495
296 Ga0496114_0068563 3300048917 Bacteria 2978
297 Ga0496114_0117385 3300048917 Bacteria 2286
298 Ga0496114_0202941 3300048917 Bacteria 1737
299 Ga0496114_0363148 3300048917 Bacteria 1281
300 Ga0496115_0110231 3300048918 Bacteria 2261
301 Ga0496115_0142006 3300048918 Bacteria 1981
302 Ga0496117_0072555 3300048920 Bacteria 2300
303 Ga0496118_0045939 3300048921 Bacteria 3402
304 Ga0496118_0047065 3300048921 Bacteria 3348
305 Ga0496119_0111361 3300048922 Bacteria 1519
306 Ga0496120_0024157 3300048923 Bacteria 3793
307 Ga0496120_0063511 3300048923 Bacteria 2054
308 Ga0496121_0078391 3300048924 Bacteria 2626
309 Ga0496121_0139088 3300048924 Bacteria 1804
310 Ga0496122_0010784 3300048925 Bacteria 9368
311 Ga0496122_0060404 3300048925 Bacteria 2792
312 Ga0496122_0088314 3300048925 Bacteria 2125
313 Ga0496123_0068433 3300048926 Bacteria 2236
314 Ga0496124_0064469 3300048927 Bacteria 3058
315 Ga0496124_0180776 3300048927 Bacteria 1623
316 Ga0496125_0025027 3300048928 Bacteria 5476
317 Ga0496125_0033810 3300048928 Bacteria 4517
318 Ga0496125_0137916 3300048928 Bacteria 1702
319 Ga0496126_0018069 3300048929 Bacteria 7004
320 Ga0496126_0023637 3300048929 Bacteria 5954
321 Ga0496126_0032695 3300048929 Bacteria 4898
322 Ga0496126_0086606 3300048929 Bacteria 2761
323 Ga0496126_0136439 3300048929 Bacteria 2116
324 Ga0501034_0141259 3300049571 Bacteria 2387
325 Ga0501072_0117045 3300049588 Bacteria 2123
326 Ga0501076_0258007 3300049592 Bacteria 1427
327 nmdc:mga00v17_177539_c1 3300050491 Bacteria 1374
328 nmdc:mga00v17_9032_c1 3300050491 Bacteria 5378
329 nmdc:mga00v17_97259_c1 3300050491 Bacteria 1855
330 nmdc:mga0yw44_24969_c1 3300050492 Bacteria 3391
331 nmdc:mga0k408_41914_c1 3300050493 Bacteria 2636
332 nmdc:mga05p37_2581_c1 3300050507 Bacteria 21054
333 nmdc:mga05p37_78589_c1 3300050507 Bacteria 4063
334 nmdc:mga05p37_88256_c1 3300050507 Bacteria 3823
335 nmdc:mga06r32_14727_c1 3300050510 Bacteria 7098
336 nmdc:mga06r32_147320_c1 3300050510 Bacteria 2332
337 nmdc:mga06r32_210667_c1 3300050510 Bacteria 1931
338 nmdc:mga08y16_111375_c1 3300050511 Bacteria 2849
339 nmdc:mga0n895_186954_c1 3300050512 Bacteria 2102
340 nmdc:mga0n895_29055_c1 3300050512 Bacteria 5268
341 nmdc:mga0n895_302446_c1 3300050512 Bacteria 1621
342 nmdc:mga0rr50_20064_c1 3300050513 Bacteria 4529
343 nmdc:mga0rr50_36647_c1 3300050513 Bacteria 3534
344 nmdc:mga08x19_222316_c1 3300050514 Bacteria 1298
345 nmdc:mga0a205_190866_c1 3300050515 Bacteria 1941
346 nmdc:mga0a205_4866_c1 3300050515 Bacteria 12080
347 nmdc:mga0sz30_27855_c1 3300050516 Bacteria 2323
348 Ga0500643_000013 3300053087 Bacteria 324296
349 Ga0500643_001421 3300053087 Bacteria 13818
350 Ga0500644_0000877 3300053088 Bacteria 9814
351 Ga0500581_091633 3300053089 Bacteria 1505
352 Ga0500647_0035169 3300053091 Bacteria 2394
353 Ga0500583_0055115 3300053092 Bacteria 1858
354 Ga0500651_0000136 3300053093 Bacteria 45911
355 Ga0500566_0000175 3300053094 Bacteria 32618
356 Ga0500555_018139 3300053103 Bacteria 2028
357 Ga0500571_002109 3300053110 Bacteria 9740
358 Ga0500572_000114 3300053111 Bacteria 26963
359 Ga0500594_0004339 3300053118 Bacteria 3123
360 Ga0500595_000003 3300053119 Bacteria 419332
361 Ga0500614_003437 3300053123 Bacteria 3406
362 Ga0500642_0000089 3300053130 Bacteria 47311
363 Ga0500642_0014527 3300053130 Bacteria 2933
364 Ga0500658_0000533 3300053134 Bacteria 16061
365 Ga0500658_0000760 3300053134 Bacteria 13287
366 Ga0500658_0031169 3300053134 Bacteria 2085
367 Ga0500658_0085240 3300053134 Bacteria 1358
368 Ga0500559_0001756 3300053136 Bacteria 11890
369 Ga0500568_0002408 3300053139 Bacteria 11035
370 Ga0500603_000248 3300053150 Bacteria 14177
371 Ga0500616_0000002 3300053153 Bacteria 1611257
372 Ga0500616_0048187 3300053153 Bacteria 2259
373 Ga0500620_017128 3300053155 Bacteria 2085
374 Ga0500622_0012792 3300053156 Bacteria 4534
375 Ga0500630_002060 3300053159 Bacteria 9670
376 Ga0500633_0026072 3300053160 Bacteria 1836
377 Ga0500634_0008813 3300053161 Bacteria 5063
378 Ga0500639_000006 3300053163 Bacteria 165068
379 Ga0500637_0028942 3300053178 Bacteria 3069
380 Ga0500611_008126 3300053727 Bacteria 1610
381 Ga0500645_000226 3300053730 Bacteria 42982
382 Ga0500645_007179 3300053730 Bacteria 3905
383 Ga0500596_000235 3300053735 Bacteria 9494
384 Ga0500599_003019 3300053736 Bacteria 2042

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006177 Ga0075362_10058931 Ga0075362_100589312 325
2 3300048917 Ga0496114_0117385 Ga0496114_0117385_392_1543 337
3 3300046507 Ga0495606_0187385 Ga0495606_0187385_133_1170 342
4 3300046680 Ga0495646_0105476 Ga0495646_0105476_524_1567 344
5 3300048925 Ga0496122_0060404 Ga0496122_0060404_577_1773 346
6 3300046453 Ga0495627_008960 Ga0495627_008960_838_2034 347
7 3300048927 Ga0496124_0064469 Ga0496124_0064469_1283_2479 347
8 3300048927 Ga0496124_0180776 Ga0496124_0180776_273_1418 348
9 3300048928 Ga0496125_0025027 Ga0496125_0025027_1843_2988 348
10 3300048929 Ga0496126_0086606 Ga0496126_0086606_856_2001 348
11 3300005467 Ga0070706_100005252 Ga0070706_10000525211 349
12 3300005471 Ga0070698_100039959 Ga0070698_1000399595 349
13 3300005536 Ga0070697_100000934 Ga0070697_10000093422 349
14 3300006871 Ga0075434_100004379 Ga0075434_1000043796 349
15 3300025910 Ga0207684_10006677 Ga0207684_100066775 349
16 3300025922 Ga0207646_10003508 Ga0207646_1000350815 349
17 3300046515 Ga0495620_0028018 Ga0495620_0028018_1157_2233 349
18 3300050513 nmdc:mga0rr50_20064_c1 nmdc:mga0rr50_20064_c1_174_1283 349
19 3300006028 Ga0070717_10172299 Ga0070717_101722992 350
20 3300037471 Ga0395905_0447774 Ga0395905_0447774_56_1156 350
21 3300031456 Ga0307513_10116626 Ga0307513_101166262 351
22 3300039437 Ga0436365_0012708 Ga0436365_0012708_215_1285 351
23 3300050514 nmdc:mga08x19_222316_c1 nmdc:mga08x19_222316_c1_119_1243 351
24 3300053155 Ga0500620_017128 Ga0500620_017128_542_1648 351
25 3300006195 Ga0075366_10013779 Ga0075366_100137795 352
26 3300048929 Ga0496126_0136439 Ga0496126_0136439_98_1198 353
27 3300003215 JGI25153J46596_10021256 JGI25153J46596_100212562 354
28 3300025297 Ga0209758_1003698 Ga0209758_10036981 354
29 3300041404 Ga0439436_0000089 Ga0439436_0000089_20293_21411 354
30 3300041410 Ga0439461_0009636 Ga0439461_0009636_543_1661 354
31 3300041411 Ga0439466_0008222 Ga0439466_0008222_525_1643 354
32 3300041413 Ga0439465_0000306 Ga0439465_0000306_5164_6282 354
33 3300041997 Ga0439431_0000537 Ga0439431_0000537_5732_6850 354
34 3300041999 Ga0439433_0007118 Ga0439433_0007118_1052_2170 354
35 3300042002 Ga0439442_000868 Ga0439442_000868_1004_2122 354
36 3300042004 Ga0439445_0000482 Ga0439445_0000482_366_1484 354
37 3300042006 Ga0439432_000424 Ga0439432_000424_8061_9179 354
38 3300042007 Ga0439449_0000280 Ga0439449_0000280_12575_13693 354
39 3300042010 Ga0439452_000869 Ga0439452_000869_7374_8492 354
40 3300042014 Ga0439457_019034 Ga0439457_019034_141_1259 354
41 3300042015 Ga0439462_0037053 Ga0439462_0037053_58_1176 354
42 3300042156 Ga0439446_0000322 Ga0439446_0000322_141_1259 354
43 3300042435 Ga0439434_0001202 Ga0439434_0001202_2156_3274 354
44 iso_pu_bacteria 2857576091 2857577433 354
45 3300005262 Ga0065165_1000704 Ga0065165_10007042 355
46 3300048921 Ga0496118_0045939 Ga0496118_0045939_1195_2331 355
47 3300005471 Ga0070698_100015609 Ga0070698_1000156096 357
48 3300046460 Ga0495638_0008675 Ga0495638_0008675_2624_3769 357
49 3300046513 Ga0495616_0000562 Ga0495616_0000562_10769_11914 357
50 3300046515 Ga0495620_0015159 Ga0495620_0015159_2496_3641 357
51 3300053118 Ga0500594_0004339 Ga0500594_0004339_774_1919 357
52 3300006051 Ga0075364_10005186 Ga0075364_100051863 358
53 3300046520 Ga0495637_0019284 Ga0495637_0019284_1924_3069 358
54 3300046525 Ga0495663_0037193 Ga0495663_0037193_265_1410 358
55 3300046530 Ga0495654_0007228 Ga0495654_0007228_1107_2252 358
56 3300046660 Ga0495625_0011649 Ga0495625_0011649_709_1854 358
57 3300047673 Ga0495593_0025679 Ga0495593_0025679_1713_2858 358
58 3300048920 Ga0496117_0072555 Ga0496117_0072555_276_1421 358
59 3300048924 Ga0496121_0078391 Ga0496121_0078391_261_1406 358
60 3300048925 Ga0496122_0088314 Ga0496122_0088314_639_1784 358
61 3300048926 Ga0496123_0068433 Ga0496123_0068433_609_1754 358
62 3300048928 Ga0496125_0033810 Ga0496125_0033810_1785_2930 358
63 3300048929 Ga0496126_0023637 Ga0496126_0023637_4455_5600 358
64 3300050491 nmdc:mga00v17_9032_c1 nmdc:mga00v17_9032_c1_2326_3486 358
65 3300053087 Ga0500643_001421 Ga0500643_001421_5496_6587 358
66 3300053088 Ga0500644_0000877 Ga0500644_0000877_6755_7846 358
67 3300053093 Ga0500651_0000136 Ga0500651_0000136_32908_34053 358
68 3300053110 Ga0500571_002109 Ga0500571_002109_8367_9512 358
69 3300053119 Ga0500595_000003 Ga0500595_000003_395496_396587 358
70 3300053134 Ga0500658_0000533 Ga0500658_0000533_729_1874 358
71 3300053134 Ga0500658_0000760 Ga0500658_0000760_6774_7919 358
72 3300053139 Ga0500568_0002408 Ga0500568_0002408_4089_5234 358
73 3300053153 Ga0500616_0000002 Ga0500616_0000002_1582111_1583202 358
74 3300053153 Ga0500616_0048187 Ga0500616_0048187_725_1870 358
75 3300053161 Ga0500634_0008813 Ga0500634_0008813_168_1313 358
76 3300053730 Ga0500645_000226 Ga0500645_000226_29284_30375 358
77 3300031712 Ga0265342_10123601 Ga0265342_101236012 359
78 3300046501 Ga0495607_0000060 Ga0495607_0000060_80446_81531 359
79 3300048090 Ga0495615_0004234 Ga0495615_0004234_464_1558 359
80 iso_pu_bacteria 2824704595 2824711246 359
81 iso_pu_bacteria 2824753945 2824760706 359
82 iso_pu_bacteria 2824763712 2824770423 359
83 iso_pu_bacteria 2874628541 2874631095 359
84 iso_pu_bacteria 2904711408 2904715623 359
85 3300006195 Ga0075366_10049230 Ga0075366_100492303 360
86 3300031595 Ga0265313_10061306 Ga0265313_100613062 360
87 3300046511 Ga0495608_0147187 Ga0495608_0147187_32_1129 360
88 3300050512 nmdc:mga0n895_302446_c1 nmdc:mga0n895_302446_c1_199_1308 360
89 iso_pu_bacteria 2511231028 2511396793 360
90 iso_pu_bacteria 2513237094 2513642604 360
91 iso_pu_bacteria 2824679649 2824684595 360
92 iso_pu_bacteria 2922393267 2922396140 360
93 iso_pu_bacteria 8019648815 8019653811 360
94 3300005468 Ga0070707_100312552 Ga0070707_1003125521 361
95 3300028794 Ga0307515_10227102 Ga0307515_102271022 361
96 3300031507 Ga0307509_10122578 Ga0307509_101225782 361
97 3300041491 Ga0451833_0358655 Ga0451833_0358655_297_1403 361
98 3300046455 Ga0495603_0170390 Ga0495603_0170390_29_1123 361
99 3300046530 Ga0495654_0003171 Ga0495654_0003171_5071_6177 361
100 iso_pu_bacteria 2881665667 2881667901 361
101 iso_pu_bacteria 3005710791 3005716752 361
102 3300006844 Ga0075428_100067572 Ga0075428_1000675723 362
103 3300006852 Ga0075433_10001276 Ga0075433_100012762 362
104 3300006871 Ga0075434_100002724 Ga0075434_1000027244 362
105 3300006880 Ga0075429_100003776 Ga0075429_1000037766 362
106 3300007076 Ga0075435_100021502 Ga0075435_1000215024 362
107 3300009147 Ga0114129_10010311 Ga0114129_100103114 362
108 3300009147 Ga0114129_10015415 Ga0114129_100154154 362
109 3300042876 Ga0451577_0193234 Ga0451577_0193234_159_1265 362
110 3300045051 Ga0451576_0370965 Ga0451576_0370965_381_1484 362
111 3300048909 Ga0496106_0220673 Ga0496106_0220673_256_1365 362
112 3300048912 Ga0496109_0133311 Ga0496109_0133311_975_2084 362
113 3300048913 Ga0496110_0079971 Ga0496110_0079971_69_1178 362
114 3300048925 Ga0496122_0010784 Ga0496122_0010784_3220_4323 362
115 3300049588 Ga0501072_0117045 Ga0501072_0117045_930_2036 362
116 3300049592 Ga0501076_0258007 Ga0501076_0258007_195_1301 362
117 3300050507 nmdc:mga05p37_2581_c1 nmdc:mga05p37_2581_c1_14303_15409 362
118 3300050507 nmdc:mga05p37_88256_c1 nmdc:mga05p37_88256_c1_1719_2825 362
119 3300050510 nmdc:mga06r32_14727_c1 nmdc:mga06r32_14727_c1_3579_4685 362
120 3300050510 nmdc:mga06r32_210667_c1 nmdc:mga06r32_210667_c1_184_1290 362
121 3300050512 nmdc:mga0n895_29055_c1 nmdc:mga0n895_29055_c1_2218_3324 362
122 3300050513 nmdc:mga0rr50_36647_c1 nmdc:mga0rr50_36647_c1_1113_2219 362
123 3300050515 nmdc:mga0a205_4866_c1 nmdc:mga0a205_4866_c1_3903_5009 362
124 iso_pu_bacteria 2517093001 2517106111 362
125 iso_pu_bacteria 2617270735 2617349512 362
126 iso_pu_bacteria 2617270741 2617375108 362
127 iso_pu_bacteria 2824600985 2824605972 362
128 iso_pu_bacteria 2824609381 2824613455 362
129 iso_pu_bacteria 2824653114 2824657003 362
130 iso_pu_bacteria 2824732956 2824737133 362
131 iso_pu_bacteria 2824746037 2824749715 362
132 iso_pu_bacteria 2824773399 2824777947 362
133 iso_pu_bacteria 2841957949 2841963643 362
134 iso_pu_bacteria 2888419890 2888426507 362
135 iso_pu_bacteria 2903727486 2903730781 362
136 iso_pu_bacteria 2908775508 2908782608 362
137 iso_pu_bacteria 3005483717 3005487593 362
138 iso_pu_bacteria 3005587118 3005591354 362
139 iso_pu_bacteria 3005594810 3005601274 362
140 iso_pu_bacteria 3005718088 3005724016 362
141 iso_pu_bacteria 8056967851 8056969781 362
142 3300003215 JGI25153J46596_10016800 JGI25153J46596_100168002 363
143 3300003354 JGI25160J50197_1002373 JGI25160J50197_10023736 363
144 3300005262 Ga0065165_1010683 Ga0065165_10106832 363
145 3300006051 Ga0075364_10102185 Ga0075364_101021852 363
146 3300006353 Ga0075370_10023182 Ga0075370_100231822 363
147 3300025297 Ga0209758_1002229 Ga0209758_10022298 363
148 3300025302 Ga0207426_1000522 Ga0207426_100052217 363
149 3300025302 Ga0207426_1000635 Ga0207426_100063513 363
150 3300025914 Ga0207671_10134067 Ga0207671_101340672 363
151 3300031249 Ga0265339_10040853 Ga0265339_100408534 363
152 3300031344 Ga0265316_10232456 Ga0265316_102324561 363
153 3300031616 Ga0307508_10037396 Ga0307508_100373963 363
154 3300049571 Ga0501034_0141259 Ga0501034_0141259_1155_2267 363
155 3300050516 nmdc:mga0sz30_27855_c1 nmdc:mga0sz30_27855_c1_655_1755 363
156 iso_pu_bacteria 2513237102 2513702651 363
157 iso_pu_bacteria 2816332527 2818239863 363
158 iso_pu_bacteria 2824617872 2824623699 363
159 iso_pu_bacteria 2824626560 2824633463 363
160 iso_pu_bacteria 2824635225 2824640238 363
161 iso_pu_bacteria 2824644064 2824650887 363
162 iso_pu_bacteria 2824714736 2824720765 363
163 iso_pu_bacteria 2824723954 2824730966 363
164 iso_pu_bacteria 2857509624 2857515023 363
165 iso_pu_bacteria 2874620515 2874624982 363
166 iso_pu_bacteria 2881364244 2881371259 363
167 iso_pu_bacteria 2888378607 2888386346 363
168 iso_pu_bacteria 2904666416 2904669043 363
169 iso_pu_bacteria 2935908558 2935911133 363
170 iso_pu_bacteria 2935916978 2935920636 363
171 iso_pu_bacteria 2935926038 2935928162 363
172 iso_pu_bacteria 2935934488 2935937807 363
173 iso_pu_bacteria 2935942939 2935945089 363
174 iso_pu_bacteria 2935951376 2935954406 363
175 iso_pu_bacteria 2935959822 2935967358 363
176 iso_pu_bacteria 2935967501 2935971327 363
177 iso_pu_bacteria 8019687851 8019694884 363
178 3300006195 Ga0075366_10018558 Ga0075366_100185583 364
179 3300025297 Ga0209758_1000176 Ga0209758_100017630 364
180 3300031241 Ga0265325_10017619 Ga0265325_100176195 364
181 3300031711 Ga0265314_10067897 Ga0265314_100678972 364
182 3300044658 Ga0466972_0001838 Ga0466972_0001838_594_1697 364
183 3300044694 Ga0466963_0006291 Ga0466963_0006291_2585_3688 364
184 3300044842 Ga0466957_0020281 Ga0466957_0020281_244_1347 364
185 3300045049 Ga0466959_0064865 Ga0466959_0064865_513_1616 364
186 3300045976 Ga0466967_0020653 Ga0466967_0020653_3441_4544 364
187 3300046454 Ga0495592_0220939 Ga0495592_0220939_34_1149 364
188 3300046462 Ga0495651_0161564 Ga0495651_0161564_269_1372 364
189 3300046463 Ga0495653_0044682 Ga0495653_0044682_1930_3033 364
190 3300046475 Ga0495639_0096887 Ga0495639_0096887_265_1368 364
191 3300046514 Ga0495618_0039747 Ga0495618_0039747_1564_2667 364
192 3300046533 Ga0495640_0032211 Ga0495640_0032211_197_1300 364
193 3300046536 Ga0495587_0054906 Ga0495587_0054906_40_1143 364
194 3300046557 Ga0495622_0004569 Ga0495622_0004569_4124_5227 364
195 3300046663 Ga0495635_0041397 Ga0495635_0041397_1880_2983 364
196 3300046675 Ga0495657_0007621 Ga0495657_0007621_6559_7662 364
197 3300046689 Ga0495613_0185174 Ga0495613_0185174_49_1152 364
198 3300046809 Ga0495600_0183621 Ga0495600_0183621_38_1141 364
199 3300047321 Ga0495676_0023112 Ga0495676_0023112_1027_2130 364
200 3300047469 Ga0495673_0030904 Ga0495673_0030904_422_1525 364
201 3300048907 Ga0496104_0008069 Ga0496104_0008069_654_1757 364
202 3300048908 Ga0496105_0001065 Ga0496105_0001065_2792_3895 364
203 3300048917 Ga0496114_0068563 Ga0496114_0068563_828_1931 364
204 3300048917 Ga0496114_0202941 Ga0496114_0202941_241_1344 364
205 3300048918 Ga0496115_0142006 Ga0496115_0142006_738_1841 364
206 3300048923 Ga0496120_0024157 Ga0496120_0024157_2639_3742 364
207 3300048924 Ga0496121_0139088 Ga0496121_0139088_116_1219 364
208 3300048928 Ga0496125_0137916 Ga0496125_0137916_525_1628 364
209 3300048929 Ga0496126_0032695 Ga0496126_0032695_2506_3609 364
210 3300050493 nmdc:mga0k408_41914_c1 nmdc:mga0k408_41914_c1_1285_2403 364
211 3300053091 Ga0500647_0035169 Ga0500647_0035169_866_1969 364
212 3300053094 Ga0500566_0000175 Ga0500566_0000175_7011_8114 364
213 3300053111 Ga0500572_000114 Ga0500572_000114_18873_19976 364
214 3300053123 Ga0500614_003437 Ga0500614_003437_702_1805 364
215 3300053136 Ga0500559_0001756 Ga0500559_0001756_3766_4869 364
216 3300053150 Ga0500603_000248 Ga0500603_000248_5967_7070 364
217 3300053159 Ga0500630_002060 Ga0500630_002060_5534_6637 364
218 3300053163 Ga0500639_000006 Ga0500639_000006_92409_93512 364
219 3300053735 Ga0500596_000235 Ga0500596_000235_8237_9340 364
220 iso_pu_bacteria 2513237104 2513720595 364
221 3300005434 Ga0070709_10006033 Ga0070709_100060333 365
222 3300005437 Ga0070710_10002372 Ga0070710_100023723 365
223 3300005439 Ga0070711_100020339 Ga0070711_1000203393 365
224 3300005457 Ga0070662_100058474 Ga0070662_1000584742 365
225 3300006163 Ga0070715_10001833 Ga0070715_100018333 365
226 3300006175 Ga0070712_100077948 Ga0070712_1000779482 365
227 3300006186 Ga0075369_10107340 Ga0075369_101073401 365
228 3300021384 Ga0213876_10028562 Ga0213876_100285623 365
229 3300025299 Ga0209256_1014122 Ga0209256_10141222 365
230 3300025898 Ga0207692_10004026 Ga0207692_100040263 365
231 3300025915 Ga0207693_10016892 Ga0207693_100168922 365
232 3300025916 Ga0207663_10002039 Ga0207663_100020392 365
233 3300025929 Ga0207664_10005949 Ga0207664_100059497 365
234 3300025933 Ga0207706_10155715 Ga0207706_101557151 365
235 3300027296 Ga0209389_1000045 Ga0209389_100004587 365
236 3300027296 Ga0209389_1000355 Ga0209389_100035526 365
237 3300027357 Ga0209589_1003826 Ga0209589_10038262 365
238 3300027361 Ga0209489_100110 Ga0209489_10011034 365
239 3300027361 Ga0209489_100210 Ga0209489_10021065 365
240 3300027363 Ga0209700_100116 Ga0209700_10011681 365
241 3300031730 Ga0307516_10003542 Ga0307516_100035423 365
242 3300035691 Ga0373931_0080997 Ga0373931_0080997_491_1597 365
243 3300046460 Ga0495638_0015731 Ga0495638_0015731_3585_4688 365
244 3300046476 Ga0495662_0129003 Ga0495662_0129003_31_1137 365
245 3300046518 Ga0495631_0071426 Ga0495631_0071426_293_1396 365
246 3300046519 Ga0495632_0010701 Ga0495632_0010701_1450_2577 365
247 3300046522 Ga0495643_0032779 Ga0495643_0032779_365_1492 365
248 3300047472 Ga0495686_0112575 Ga0495686_0112575_246_1373 365
249 3300047673 Ga0495593_0099672 Ga0495593_0099672_374_1480 365
250 3300048903 Ga0496100_0067682 Ga0496100_0067682_27_1133 365
251 3300053134 Ga0500658_0031169 Ga0500658_0031169_765_1892 365
252 3300053156 Ga0500622_0012792 Ga0500622_0012792_659_1762 365
253 3300053160 Ga0500633_0026072 Ga0500633_0026072_232_1335 365
254 3300053178 Ga0500637_0028942 Ga0500637_0028942_789_1895 365
255 3300053736 Ga0500599_003019 Ga0500599_003019_708_1811 365
256 iso_pu_bacteria 2945984333 2945989064 365
257 3300005367 Ga0070667_100111219 Ga0070667_1001112192 366
258 3300005456 Ga0070678_100017754 Ga0070678_1000177544 366
259 3300006847 Ga0075431_100004599 Ga0075431_10000459918 366
260 3300006852 Ga0075433_10201000 Ga0075433_102010002 366
261 3300006871 Ga0075434_100048666 Ga0075434_1000486664 366
262 3300013306 Ga0163162_10100617 Ga0163162_101006172 366
263 3300015262 Ga0182007_10000258 Ga0182007_1000025827 366
264 3300017792 Ga0163161_10028754 Ga0163161_100287542 366
265 3300021320 Ga0214544_1000578 Ga0214544_100057860 366
266 3300021321 Ga0214542_1000338 Ga0214542_100033866 366
267 3300021324 Ga0214545_1000186 Ga0214545_100018666 366
268 3300021327 Ga0214543_1000271 Ga0214543_100027166 366
269 3300021327 Ga0214543_1041406 Ga0214543_10414061 366
270 3300025254 Ga0209148_1000445 Ga0209148_100044529 366
271 3300025261 Ga0209233_1010726 Ga0209233_10107262 366
272 3300025272 Ga0209455_1002155 Ga0209455_10021553 366
273 3300025297 Ga0209758_1001659 Ga0209758_100165913 366
274 3300025903 Ga0207680_10051253 Ga0207680_100512533 366
275 3300025960 Ga0207651_10048172 Ga0207651_100481722 366
276 3300025986 Ga0207658_10023459 Ga0207658_100234592 366
277 3300026078 Ga0207702_10208726 Ga0207702_102087262 366
278 3300026121 Ga0207683_10008440 Ga0207683_100084403 366
279 3300028379 Ga0268266_10429614 Ga0268266_104296141 366
280 3300031456 Ga0307513_10053702 Ga0307513_100537023 366
281 3300033180 Ga0307510_10115702 Ga0307510_101157022 366
282 3300044658 Ga0466972_0013922 Ga0466972_0013922_220_1329 366
283 3300046524 Ga0495648_0075806 Ga0495648_0075806_814_1923 366
284 3300046539 Ga0495621_0008436 Ga0495621_0008436_91_1209 366
285 3300046615 Ga0495656_0000198 Ga0495656_0000198_19482_20600 366
286 3300046690 Ga0495624_0059421 Ga0495624_0059421_34_1143 366
287 3300046691 Ga0495670_0092256 Ga0495670_0092256_273_1391 366
288 3300047469 Ga0495673_0081026 Ga0495673_0081026_225_1334 366
289 3300048903 Ga0496100_0003079 Ga0496100_0003079_2197_3315 366
290 3300048904 Ga0496101_0008166 Ga0496101_0008166_2177_3379 366
291 3300048905 Ga0496102_0003422 Ga0496102_0003422_8588_9706 366
292 3300048907 Ga0496104_0001742 Ga0496104_0001742_9954_11072 366
293 3300048909 Ga0496106_0026058 Ga0496106_0026058_1840_2958 366
294 3300048912 Ga0496109_0195177 Ga0496109_0195177_44_1168 366
295 3300048913 Ga0496110_0014308 Ga0496110_0014308_1480_2604 366
296 3300048917 Ga0496114_0010148 Ga0496114_0010148_994_2112 366
297 3300048921 Ga0496118_0047065 Ga0496118_0047065_1453_2559 366
298 3300048922 Ga0496119_0111361 Ga0496119_0111361_307_1413 366
299 3300048923 Ga0496120_0063511 Ga0496120_0063511_234_1340 366
300 3300050510 nmdc:mga06r32_147320_c1 nmdc:mga06r32_147320_c1_609_1733 366
301 3300050511 nmdc:mga08y16_111375_c1 nmdc:mga08y16_111375_c1_1377_2501 366
302 3300050515 nmdc:mga0a205_190866_c1 nmdc:mga0a205_190866_c1_174_1298 366
303 3300053130 Ga0500642_0000089 Ga0500642_0000089_19521_20630 366
304 3300003215 JGI25153J46596_10008802 JGI25153J46596_100088023 367
305 3300003794 Ga0055531_10007800 Ga0055531_100078005 367
306 3300003794 Ga0055531_10010492 Ga0055531_100104924 367
307 3300005262 Ga0065165_1010204 Ga0065165_10102042 367
308 3300017792 Ga0163161_10000561 Ga0163161_1000056113 367
309 3300025245 Ga0207425_1019844 Ga0207425_10198441 367
310 3300025295 Ga0209564_1007915 Ga0209564_10079152 367
311 3300025297 Ga0209758_1000109 Ga0209758_1000109135 367
312 3300025299 Ga0209256_1011161 Ga0209256_10111611 367
313 3300025304 Ga0209257_1000781 Ga0209257_100078123 367
314 3300037471 Ga0395905_0000548 Ga0395905_0000548_21590_22702 367
315 3300038443 Ga0395901_0107274 Ga0395901_0107274_906_2018 367
316 3300046507 Ga0495606_0019863 Ga0495606_0019863_2638_3750 367
317 3300046616 Ga0495668_0093282 Ga0495668_0093282_370_1482 367
318 3300046648 Ga0495611_0056954 Ga0495611_0056954_217_1329 367
319 3300053087 Ga0500643_000013 Ga0500643_000013_81357_82469 367
320 3300053092 Ga0500583_0055115 Ga0500583_0055115_703_1815 367
321 3300053103 Ga0500555_018139 Ga0500555_018139_780_1892 367
322 3300053130 Ga0500642_0014527 Ga0500642_0014527_384_1496 367
323 3300005436 Ga0070713_100003901 Ga0070713_1000039018 368
324 3300005467 Ga0070706_100216244 Ga0070706_1002162442 368
325 3300006028 Ga0070717_10003698 Ga0070717_100036987 368
326 3300006175 Ga0070712_100028225 Ga0070712_1000282254 368
327 3300006175 Ga0070712_100136113 Ga0070712_1001361133 368
328 3300025915 Ga0207693_10037955 Ga0207693_100379553 368
329 3300025915 Ga0207693_10199688 Ga0207693_101996882 368
330 3300031730 Ga0307516_10014375 Ga0307516_100143756 368
331 3300031730 Ga0307516_10032629 Ga0307516_100326292 368
332 3300045049 Ga0466959_0033938 Ga0466959_0033938_2644_3759 368
333 3300046462 Ga0495651_0059689 Ga0495651_0059689_344_1459 368
334 3300046616 Ga0495668_0035944 Ga0495668_0035944_774_1889 368
335 iso_pu_bacteria 2574179768 2574432112 368
336 3300005436 Ga0070713_100287594 Ga0070713_1002875941 369
337 3300035118 Ga0373954_0019530 Ga0373954_0019530_983_2101 369
338 3300046463 Ga0495653_0143436 Ga0495653_0143436_518_1636 369
339 3300046559 Ga0495667_0081636 Ga0495667_0081636_773_1891 369
340 3300046689 Ga0495613_0177390 Ga0495613_0177390_358_1476 369
341 iso_pu_bacteria 2738541307 2738883329 369
342 3300006881 Ga0068865_100190883 Ga0068865_1001908832 370
343 3300025910 Ga0207684_10255261 Ga0207684_102552612 370
344 3300033180 Ga0307510_10027613 Ga0307510_100276132 370
345 3300044684 Ga0466966_0014385 Ga0466966_0014385_108_1229 370
346 3300046462 Ga0495651_0058888 Ga0495651_0058888_673_1797 370
347 3300047320 Ga0495672_0020076 Ga0495672_0020076_1545_2666 370
348 3300048918 Ga0496115_0110231 Ga0496115_0110231_691_1809 370
349 3300048908 Ga0496105_0014413 Ga0496105_0014413_80_1195 371
350 iso_pu_bacteria 2922425934 2922433818 371
351 iso_pu_bacteria 2935630451 2935635635 371
352 iso_pu_bacteria 2941507105 2941509284 371
353 iso_pu_bacteria 2941515067 2941517113 371
354 iso_pu_bacteria 2941523033 2941524792 371
355 iso_pu_bacteria 8019555841 8019562923 371
356 iso_pu_bacteria 8019565922 8019573002 371
357 3300005434 Ga0070709_10005113 Ga0070709_100051135 372
358 3300005435 Ga0070714_100063532 Ga0070714_1000635322 372
359 3300005437 Ga0070710_10001880 Ga0070710_100018807 372
360 3300005439 Ga0070711_100005028 Ga0070711_1000050283 372
361 3300006173 Ga0070716_100099383 Ga0070716_1000993831 372
362 3300021384 Ga0213876_10000531 Ga0213876_1000053119 372
363 3300025906 Ga0207699_10002225 Ga0207699_100022255 372
364 3300025916 Ga0207663_10013434 Ga0207663_100134341 372
365 3300025928 Ga0207700_10048319 Ga0207700_100483193 372
366 3300025929 Ga0207664_10052336 Ga0207664_100523363 372
367 3300025939 Ga0207665_10007339 Ga0207665_100073396 372
368 3300031456 Ga0307513_10099941 Ga0307513_100999412 372
369 3300039437 Ga0436365_0612221 Ga0436365_0612221_5144_6262 372
370 iso_pu_bacteria 2667528175 2671122014 372
371 iso_pu_bacteria 2791355197 2793068990 372
372 iso_pu_bacteria 2908756301 2908763927 372
373 3300005434 Ga0070709_10002668 Ga0070709_100026682 373
374 3300005434 Ga0070709_10074340 Ga0070709_100743402 373
375 3300005435 Ga0070714_100011992 Ga0070714_1000119923 373
376 3300005436 Ga0070713_100004191 Ga0070713_1000041919 373
377 3300005437 Ga0070710_10008339 Ga0070710_100083393 373
378 3300005439 Ga0070711_100007501 Ga0070711_1000075016 373
379 3300006163 Ga0070715_10084838 Ga0070715_100848381 373
380 3300006173 Ga0070716_100018059 Ga0070716_1000180592 373
381 3300006175 Ga0070712_100033556 Ga0070712_1000335561 373
382 3300021377 Ga0213874_10009267 Ga0213874_100092671 373
383 3300021384 Ga0213876_10038957 Ga0213876_100389572 373
384 3300025898 Ga0207692_10003821 Ga0207692_100038216 373
385 3300025906 Ga0207699_10054711 Ga0207699_100547111 373
386 3300025906 Ga0207699_10072876 Ga0207699_100728762 373
387 3300025915 Ga0207693_10004244 Ga0207693_100042449 373
388 3300025916 Ga0207663_10021314 Ga0207663_100213142 373
389 3300025928 Ga0207700_10025721 Ga0207700_100257212 373
390 3300025928 Ga0207700_10122964 Ga0207700_101229641 373
391 3300025929 Ga0207664_10067630 Ga0207664_100676301 373
392 3300028786 Ga0307517_10000008 Ga0307517_10000008144 373
393 3300039450 Ga0436363_1602871 Ga0436363_1602871_946_2073 373
394 3300005983 Ga0081540_1003913 Ga0081540_10039135 374
395 3300053134 Ga0500658_0085240 Ga0500658_0085240_210_1334 374
396 3300053727 Ga0500611_008126 Ga0500611_008126_299_1423 374
397 3300005548 Ga0070665_100041857 Ga0070665_1000418575 375
398 3300005719 Ga0068861_100146067 Ga0068861_1001460672 375
399 3300005844 Ga0068862_100162504 Ga0068862_1001625042 375
400 3300006028 Ga0070717_10003568 Ga0070717_100035686 375
401 3300007265 Ga0099794_10001307 Ga0099794_100013077 375
402 3300010159 Ga0099796_10027350 Ga0099796_100273502 375
403 3300014325 Ga0163163_10211176 Ga0163163_102111762 375
404 3300025261 Ga0209233_1004289 Ga0209233_10042892 375
405 3300027671 Ga0209588_1005429 Ga0209588_10054293 375
406 3300032126 Ga0307415_100205905 Ga0307415_1002059052 375
407 3300053089 Ga0500581_091633 Ga0500581_091633_141_1268 375
408 3300005467 Ga0070706_100104631 Ga0070706_1001046312 376
409 3300006844 Ga0075428_100020774 Ga0075428_1000207746 376
410 3300009092 Ga0105250_10021450 Ga0105250_100214503 376
411 3300017792 Ga0163161_10182184 Ga0163161_101821842 376
412 3300031456 Ga0307513_10269254 Ga0307513_102692541 376
413 3300046528 Ga0495642_0078582 Ga0495642_0078582_204_1340 376
414 3300048907 Ga0496104_0185598 Ga0496104_0185598_626_1759 376
415 3300048913 Ga0496110_0311662 Ga0496110_0311662_41_1174 376
416 3300048929 Ga0496126_0018069 Ga0496126_0018069_5662_6798 376
417 3300050491 nmdc:mga00v17_177539_c1 nmdc:mga00v17_177539_c1_178_1314 376
418 3300050492 nmdc:mga0yw44_24969_c1 nmdc:mga0yw44_24969_c1_837_1973 376
419 3300050507 nmdc:mga05p37_78589_c1 nmdc:mga05p37_78589_c1_2197_3333 376
420 3300053730 Ga0500645_007179 Ga0500645_007179_1200_2336 376
421 iso_pu_bacteria 2738541277 2738719325 376
422 iso_pu_bacteria 2738543019 2739282944 376
423 3300005548 Ga0070665_100028600 Ga0070665_1000286003 381
424 3300005617 Ga0068859_100057614 Ga0068859_1000576142 381
425 3300006931 Ga0097620_100057614 Ga0097620_1000576142 381
426 3300009176 Ga0105242_10301471 Ga0105242_103014712 381
427 3300013308 Ga0157375_10157452 Ga0157375_101574522 381
428 3300026067 Ga0207678_10016716 Ga0207678_100167166 381
429 3300028379 Ga0268266_10005077 Ga0268266_100050778 381
430 3300046452 Ga0495617_037388 Ga0495617_037388_137_1282 381
431 3300047315 Ga0495581_0019611 Ga0495581_0019611_2018_3163 381
432 3300047321 Ga0495676_0167492 Ga0495676_0167492_135_1280 381
433 3300050512 nmdc:mga0n895_186954_c1 nmdc:mga0n895_186954_c1_848_1993 381
434 3300006186 Ga0075369_10006245 Ga0075369_100062454 382
435 3300025297 Ga0209758_1015309 Ga0209758_10153093 382
436 3300025942 Ga0207689_10028674 Ga0207689_100286742 382
437 3300037418 Ga0395900_0452983 Ga0395900_0452983_18_1175 382
438 3300046460 Ga0495638_0127485 Ga0495638_0127485_86_1240 382
439 3300048917 Ga0496114_0363148 Ga0496114_0363148_22_1173 382
440 3300050491 nmdc:mga00v17_97259_c1 nmdc:mga00v17_97259_c1_590_1744 382
441 iso_pu_bacteria 2903748898 2903750269 388
442 iso_pu_bacteria 3005474847 3005475417 388
443 3300005843 Ga0068860_100368321 Ga0068860_1003683212 398
444 3300025903 Ga0207680_10123599 Ga0207680_101235992 398
445 3300028380 Ga0268265_10276475 Ga0268265_102764751 398
446 3300025938 Ga0207704_10055969 Ga0207704_100559692 399
447 3300048905 Ga0496102_0390517 Ga0496102_0390517_75_1274 399
448 3300025933 Ga0207706_10191630 Ga0207706_101916301 400
449 3300025986 Ga0207658_10096474 Ga0207658_100964742 400
450 3300026041 Ga0207639_10118774 Ga0207639_101187741 400
451 3300026075 Ga0207708_10078649 Ga0207708_100786493 400
452 3300026118 Ga0207675_100056901 Ga0207675_1000569013 400
453 3300046455 Ga0495603_0009099 Ga0495603_0009099_1630_2943 416
454 3300010159 Ga0099796_10017980 Ga0099796_100179802 418
455 3300003215 JGI25153J46596_10002853 JGI25153J46596_100028537 419

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09663

Amido_AtzD_TrzD

Amidohydrolase ring-opening protein (Amido_AtzD_TrzD)

73

437

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bun-assembly1.cif.gz_B crystal structures of cyanuric acid hydrolase from moorella thermoacetica 0.9597 46 415
5t13-assembly1.cif.gz_A structure of the cyanuric acid hydrolase trzd reveals product exit channel 0.9561 45 415
6bun-assembly1.cif.gz_B crystal structures of cyanuric acid hydrolase from moorella thermoacetica 0.9545 46 415
6dhj-assembly1.cif.gz_F crystal structures of cyanuric acid hydrolase from moorella thermoacetica 0.954 47 415
4bvq-assembly1.cif.gz_A cyanuric acid hydrolase: evolutionary innovation by structural concatenation. 0.9526 46 414
ID Description Score Start End Superfamily
3zgrA02 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Cyanuric acid hydrolase/Barbiturase, RU B 0.9756 154 294 3.30.1330.180
5hxzB02 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Cyanuric acid hydrolase/Barbiturase, RU B 0.9676 154 294 3.30.1330.180
4nq3B02 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Cyanuric acid hydrolase/Barbiturase, RU B 0.9656 160 292 3.30.1330.180
5hy4G02 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Cyanuric acid hydrolase/Barbiturase, RU B 0.9573 157 292 3.30.1330.180
4bvrA01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Cyanuric acid hydrolase/Barbiturase, RU A 0.9546 46 145 3.30.1330.170
ID Description Score Start End GO Terms
AF-A0A508SW83-F1-model_v4 Cyanuric acid amidohydrolase (EC 3.5.2.15) 0.9664 44 236 GO:0018753
AF-A0A0K2F1X3-F1-model_v4 TrzD 0.966 107 296 GO:0016812
AF-C7EY81-F1-model_v4 Cyanuric acid amidohydrolase 0.9648 99 270 GO:0016812
AF-A0A0K2F269-F1-model_v4 TrzD 0.9628 107 283 GO:0016812
AF-A0A842SD09-F1-model_v4 Ring-opening amidohydrolase 0.9621 47 294 GO:0016812

Feature Viewer

pLDDT pTM Quality
83.39 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map