F447531

General Info

Members Datasets Scaffolds Average Seq Length
455 236 910 211

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100002584|Ga0070699_10000258415
Length 248
Sequence VQPQWSPLFRTDTQQSAVESGWYPPVEGFLFLTSGHRGGMARPRATTSAANFLPAELSLPALRAASAGCKGCDLWRLGTQTVFGEGPESAGVMFVGEQPGDQEDRAGKPFVGPAGQLLDKALTEAGIDRSATYMTNAVKHFKWQARGKRRIHQKPTWAEITACRPWLEAELAIVHPRVLVLLGATAAQSLLGREFRVTQNRRTLVESNLADAVTATIHPSAILRGEPEQRETEFAAFVDDLRFVASLL

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
145 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
154 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
155 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
156 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
157 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
158 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
164 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
165 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
168 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
169 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
170 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
171 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
172 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
173 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
174 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
175 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
176 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
177 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
178 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
179 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
195 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
206 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
207 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
208 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
209 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
210 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
211 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
212 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
213 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
214 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
215 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
216 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
217 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
218 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
220 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
221 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
224 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
225 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
226 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
227 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
228 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
229 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
230 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
231 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
232 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
233 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
234 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
236 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.34
Metatranscriptomes 0.66
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.88
Nodule 0
Rhizoplane 10.99
Rhizosphere 86.81
Stem 0
Stem Tuber 0
Unclassified 0.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100002584 3300005518 Bacteria 16223
2 JGI24742J22300_10006118 3300002244 Bacteria 1986
3 Ga0070683_100002597 3300005329 Bacteria 14436
4 Ga0070683_100174696 3300005329 Bacteria 2039
5 Ga0070683_100234844 3300005329 Bacteria 1743
6 Ga0070690_100063704 3300005330 Bacteria 2380
7 Ga0070670_100208724 3300005331 Bacteria 1698
8 Ga0070666_10108855 3300005335 Bacteria 1915
9 Ga0070680_100048572 3300005336 Bacteria 3459
10 Ga0070682_100026420 3300005337 Bacteria 3475
11 Ga0070682_100154283 3300005337 Bacteria 1579
12 Ga0068868_100167000 3300005338 Bacteria 1821
13 Ga0070660_100018517 3300005339 Bacteria 5090
14 Ga0070660_100081068 3300005339 Bacteria 2547
15 Ga0070660_100259136 3300005339 Bacteria 1420
16 Ga0070660_100767323 3300005339 Bacteria 810
17 Ga0070689_100106796 3300005340 Bacteria 2222
18 Ga0070687_100012665 3300005343 Bacteria 3731
19 Ga0070692_10018348 3300005345 Bacteria 3363
20 Ga0070668_100118186 3300005347 Bacteria 2116
21 Ga0070671_100131081 3300005355 Bacteria 2112
22 Ga0070674_100101862 3300005356 Bacteria 2094
23 Ga0070674_100109982 3300005356 Bacteria 2022
24 Ga0070673_100315310 3300005364 Bacteria 1380
25 Ga0070688_100050193 3300005365 Bacteria 2598
26 Ga0070659_100421533 3300005366 Bacteria 1129
27 Ga0070659_100602687 3300005366 Bacteria 944
28 Ga0070667_100009237 3300005367 Bacteria 8166
29 Ga0070703_10004571 3300005406 Bacteria 3889
30 Ga0070709_10031214 3300005434 Bacteria 3204
31 Ga0070713_100032357 3300005436 Bacteria 4176
32 Ga0070710_10318326 3300005437 Bacteria 1020
33 Ga0070701_10022760 3300005438 Bacteria 3008
34 Ga0070711_100054432 3300005439 Bacteria 2761
35 Ga0070705_100250696 3300005440 Bacteria 1242
36 Ga0070705_100323884 3300005440 Bacteria 1114
37 Ga0070700_100007677 3300005441 Bacteria 5838
38 Ga0070694_100012323 3300005444 Bacteria 5312
39 Ga0070708_100131712 3300005445 Bacteria 2315
40 Ga0070708_100185010 3300005445 Bacteria 1948
41 Ga0070663_100076320 3300005455 Bacteria 2450
42 Ga0070678_100020373 3300005456 Bacteria 4350
43 Ga0070662_100146149 3300005457 Bacteria 1837
44 Ga0070681_10024160 3300005458 Bacteria 6119
45 Ga0070681_11040468 3300005458 Bacteria 739
46 Ga0068867_100001494 3300005459 Bacteria 16185
47 Ga0070706_100212347 3300005467 Bacteria 1807
48 Ga0070707_100012018 3300005468 Bacteria 8082
49 Ga0070698_100073157 3300005471 Bacteria 3434
50 Ga0070699_100023239 3300005518 Bacteria 5340
51 Ga0070684_100001074 3300005535 Bacteria 19597
52 Ga0070684_100173870 3300005535 Bacteria 1957
53 Ga0070684_100558608 3300005535 Bacteria 1063
54 Ga0070697_100159280 3300005536 Bacteria 1906
55 Ga0068853_100016536 3300005539 Bacteria 6074
56 Ga0068853_100019979 3300005539 Bacteria 5564
57 Ga0068853_100048151 3300005539 Bacteria 3660
58 Ga0068853_100273205 3300005539 Bacteria 1557
59 Ga0070686_100001905 3300005544 Bacteria 11612
60 Ga0070695_100076904 3300005545 Bacteria 2198
61 Ga0070695_100150735 3300005545 Bacteria 1623
62 Ga0070696_100182748 3300005546 Bacteria 1556
63 Ga0070696_100273248 3300005546 Bacteria 1286
64 Ga0070693_100028022 3300005547 Bacteria 3058
65 Ga0070693_100267081 3300005547 Bacteria 1140
66 Ga0070693_100326394 3300005547 Bacteria 1043
67 Ga0070665_100012039 3300005548 Bacteria 8724
68 Ga0070665_100548699 3300005548 Bacteria 1168
69 Ga0070704_100003028 3300005549 Bacteria 9556
70 Ga0070704_100178773 3300005549 Bacteria 1695
71 Ga0068855_100107292 3300005563 Bacteria 3209
72 Ga0068855_100126852 3300005563 Bacteria 2917
73 Ga0070664_100163970 3300005564 Bacteria 1968
74 Ga0068857_100002220 3300005577 Bacteria 15819
75 Ga0068854_100205712 3300005578 Bacteria 1550
76 Ga0068856_100366293 3300005614 Bacteria 1460
77 Ga0068856_100379150 3300005614 Bacteria 1433
78 Ga0070702_100007012 3300005615 Bacteria 5371
79 Ga0068852_100298670 3300005616 Bacteria 1558
80 Ga0068866_10001347 3300005718 Bacteria 10616
81 Ga0068860_100308749 3300005843 Bacteria 1551
82 Ga0081455_10026079 3300005937 Bacteria 5384
83 Ga0081538_10166077 3300005981 Bacteria 971
84 Ga0081539_10000384 3300005985 Bacteria 95594
85 Ga0070717_10272753 3300006028 Bacteria 1499
86 Ga0070712_100101441 3300006175 Bacteria 2129
87 Ga0070712_100152441 3300006175 Bacteria 1776
88 Ga0097621_100027657 3300006237 Bacteria 4463
89 Ga0097621_100219348 3300006237 Bacteria 1657
90 Ga0075370_10004713 3300006353 Bacteria 6662
91 Ga0068871_100006114 3300006358 Bacteria 8480
92 Ga0075428_100004398 3300006844 Bacteria 15559
93 Ga0075430_100010994 3300006846 Bacteria 7668
94 Ga0075431_100003765 3300006847 Bacteria 14743
95 Ga0075431_100004510 3300006847 Bacteria 13670
96 Ga0075431_100152715 3300006847 Bacteria 2377
97 Ga0075431_100781936 3300006847 Bacteria 928
98 Ga0075433_10003555 3300006852 Bacteria 12028
99 Ga0075433_10008898 3300006852 Bacteria 8014
100 Ga0075433_10597306 3300006852 Bacteria 969
101 Ga0075434_100068478 3300006871 Bacteria 3536
102 Ga0075434_100137115 3300006871 Bacteria 2466
103 Ga0075434_100320369 3300006871 Bacteria 1571
104 Ga0075434_100340098 3300006871 Bacteria 1521
105 Ga0075429_100003138 3300006880 Bacteria 14041
106 Ga0068865_100052396 3300006881 Bacteria 2828
107 Ga0068865_100265490 3300006881 Bacteria 1361
108 Ga0075436_100016970 3300006914 Bacteria 4982
109 Ga0075435_100010171 3300007076 Bacteria 6870
110 Ga0075435_100052535 3300007076 Bacteria 3284
111 Ga0111539_10001786 3300009094 Bacteria 28597
112 Ga0105245_10067360 3300009098 Bacteria 3243
113 Ga0114129_10005588 3300009147 Bacteria 17789
114 Ga0114129_10058570 3300009147 Bacteria 5388
115 Ga0114129_10101247 3300009147 Bacteria 3986
116 Ga0114129_10101537 3300009147 Bacteria 3980
117 Ga0114129_10267247 3300009147 Bacteria 2290
118 Ga0114129_10808368 3300009147 Bacteria 1195
119 Ga0114129_10899908 3300009147 Bacteria 1121
120 Ga0114129_11034997 3300009147 Bacteria 1032
121 Ga0105243_10096170 3300009148 Bacteria 2450
122 Ga0105241_10296154 3300009174 Bacteria 1387
123 Ga0105242_10613108 3300009176 Bacteria 1053
124 Ga0105248_10039134 3300009177 Bacteria 5310
125 Ga0105238_10413428 3300009551 Bacteria 1343
126 Ga0105246_10040995 3300011119 Bacteria 3128
127 Ga0157373_10069929 3300013100 Bacteria 2481
128 Ga0157374_10502944 3300013296 Bacteria 1216
129 Ga0157378_10031649 3300013297 Bacteria 4673
130 Ga0163162_10079316 3300013306 Bacteria 3349
131 Ga0157372_10333204 3300013307 Bacteria 1767
132 Ga0157375_10206563 3300013308 Bacteria 2120
133 Ga0157375_10339946 3300013308 Bacteria 1666
134 Ga0157379_10154759 3300014968 Bacteria 2068
135 Ga0157376_10150030 3300014969 Bacteria 2101
136 Ga0206356_10762478 3300020070 Bacteria 2964
137 Ga0213876_10002712 3300021384 Bacteria 10306
138 Ga0213876_10007692 3300021384 Bacteria 5851
139 Ga0207653_10005061 3300025885 Bacteria 4118
140 Ga0207642_10002112 3300025899 Bacteria 6146
141 Ga0207680_10052506 3300025903 Bacteria 2443
142 Ga0207705_10091453 3300025909 Bacteria 2228
143 Ga0207684_10707829 3300025910 Bacteria 855
144 Ga0207684_10966282 3300025910 Bacteria 714
145 Ga0207707_10148020 3300025912 Bacteria 2053
146 Ga0207707_10849278 3300025912 Bacteria 758
147 Ga0207693_10012153 3300025915 Bacteria 6957
148 Ga0207693_10063373 3300025915 Bacteria 2896
149 Ga0207693_10179507 3300025915 Bacteria 1666
150 Ga0207663_10334898 3300025916 Bacteria 1141
151 Ga0207660_10057600 3300025917 Bacteria 2784
152 Ga0207660_10088739 3300025917 Bacteria 2287
153 Ga0207660_10128990 3300025917 Bacteria 1923
154 Ga0207657_10001199 3300025919 Bacteria 27571
155 Ga0207657_10047579 3300025919 Bacteria 3748
156 Ga0207657_10201148 3300025919 Bacteria 1602
157 Ga0207646_10037297 3300025922 Bacteria 4383
158 Ga0207694_10097840 3300025924 Bacteria 2322
159 Ga0207687_10056558 3300025927 Bacteria 2752
160 Ga0207644_10064889 3300025931 Bacteria 2654
161 Ga0207690_10062561 3300025932 Bacteria 2534
162 Ga0207690_10109891 3300025932 Bacteria 1984
163 Ga0207690_10282084 3300025932 Bacteria 1294
164 Ga0207706_10028775 3300025933 Bacteria 4960
165 Ga0207686_10002109 3300025934 Bacteria 10955
166 Ga0207709_10001379 3300025935 Bacteria 17019
167 Ga0207709_10283381 3300025935 Bacteria 1225
168 Ga0207669_10316037 3300025937 Bacteria 1193
169 Ga0207669_10360377 3300025937 Bacteria 1126
170 Ga0207704_10001420 3300025938 Bacteria 10704
171 Ga0207665_10041623 3300025939 Bacteria 3069
172 Ga0207661_10169543 3300025944 Bacteria 1899
173 Ga0207661_10586887 3300025944 Bacteria 1022
174 Ga0207679_10124260 3300025945 Bacteria 2060
175 Ga0207712_10002222 3300025961 Bacteria 12631
176 Ga0207668_10032538 3300025972 Bacteria 3447
177 Ga0207658_10063326 3300025986 Bacteria 2771
178 Ga0207677_10104404 3300026023 Bacteria 2094
179 Ga0207677_10106710 3300026023 Bacteria 2076
180 Ga0207703_10210955 3300026035 Bacteria 1731
181 Ga0207639_10011400 3300026041 Bacteria 6174
182 Ga0207639_10052989 3300026041 Bacteria 3094
183 Ga0207639_10136754 3300026041 Bacteria 2036
184 Ga0207639_10364633 3300026041 Bacteria 1294
185 Ga0207678_10031561 3300026067 Bacteria 4621
186 Ga0207708_10000866 3300026075 Bacteria 22792
187 Ga0207708_10202965 3300026075 Bacteria 1582
188 Ga0207702_10096123 3300026078 Bacteria 2605
189 Ga0207702_10182093 3300026078 Bacteria 1935
190 Ga0207702_10281016 3300026078 Bacteria 1574
191 Ga0207641_10007722 3300026088 Bacteria 8939
192 Ga0207648_10000097 3300026089 Bacteria 83554
193 Ga0207648_10350967 3300026089 Bacteria 1330
194 Ga0207674_10001849 3300026116 Bacteria 26988
195 Ga0207683_10000038 3300026121 Bacteria 100875
196 Ga0209813_10088346 3300027866 Bacteria 1036
197 Ga0207428_10015267 3300027907 Bacteria 6647
198 Ga0268266_10046609 3300028379 Bacteria 3711
199 Ga0268264_10017813 3300028381 Bacteria 5814
200 Ga0265770_1016682 3300030878 Bacteria 1127
201 Ga0307408_100036512 3300031548 Bacteria 3455
202 Ga0307408_100117164 3300031548 Bacteria 2057
203 Ga0307408_100537557 3300031548 Bacteria 1029
204 Ga0307405_10511237 3300031731 Bacteria 965
205 Ga0307405_10534328 3300031731 Bacteria 946
206 Ga0307413_10213449 3300031824 Bacteria 1404
207 Ga0307410_10065290 3300031852 Bacteria 2503
208 Ga0307410_10066968 3300031852 Bacteria 2476
209 Ga0307407_10510667 3300031903 Unclassified 882
210 Ga0307407_10706565 3300031903 Bacteria 760
211 Ga0307412_11026327 3300031911 Bacteria 730
212 Ga0307409_100152052 3300031995 Bacteria 2011
213 Ga0307409_100161148 3300031995 Bacteria 1962
214 Ga0307409_100293343 3300031995 Bacteria 1509
215 Ga0307409_100818989 3300031995 Bacteria 940
216 Ga0307416_100137647 3300032002 Bacteria 2213
217 Ga0307416_100244125 3300032002 Bacteria 1743
218 Ga0307416_100266548 3300032002 Bacteria 1678
219 Ga0307416_100332463 3300032002 Bacteria 1528
220 Ga0307416_100588028 3300032002 Bacteria 1191
221 Ga0307414_10243293 3300032004 Bacteria 1491
222 Ga0307415_100071212 3300032126 Bacteria 2444
223 Ga0373946_0134210 3300035171 Bacteria 1142
224 Ga0373961_0061528 3300035241 Bacteria 1141
225 Ga0373925_0241050 3300037068 Bacteria 1448
226 Ga0395899_0008139 3300037312 Bacteria 8077
227 Ga0395899_0008230 3300037312 Bacteria 8032
228 Ga0395899_0028812 3300037312 Bacteria 4178
229 Ga0395899_0034773 3300037312 Bacteria 3785
230 Ga0395899_0085085 3300037312 Bacteria 2298
231 Ga0395899_0152474 3300037312 Bacteria 1637
232 Ga0395899_0156551 3300037312 Bacteria 1612
233 Ga0395900_0003063 3300037418 Bacteria 18201
234 Ga0395900_0003252 3300037418 Bacteria 17595
235 Ga0395900_0017178 3300037418 Bacteria 7385
236 Ga0395900_0028012 3300037418 Bacteria 5769
237 Ga0395900_0040358 3300037418 Bacteria 4810
238 Ga0395900_0079779 3300037418 Bacteria 3363
239 Ga0395900_0149666 3300037418 Bacteria 2385
240 Ga0395900_0168016 3300037418 Bacteria 2234
241 Ga0395900_0248453 3300037418 Bacteria 1781
242 Ga0395900_0767043 3300037418 Bacteria 894
243 Ga0395900_1036084 3300037418 Bacteria 739
244 Ga0395898_0005810 3300037466 Bacteria 13273
245 Ga0395898_0011130 3300037466 Bacteria 9367
246 Ga0395898_0022440 3300037466 Bacteria 6392
247 Ga0395898_0026792 3300037466 Bacteria 5794
248 Ga0395898_0028527 3300037466 Bacteria 5592
249 Ga0395898_0036872 3300037466 Bacteria 4853
250 Ga0395898_0049860 3300037466 Bacteria 4100
251 Ga0395898_0072279 3300037466 Bacteria 3332
252 Ga0395898_0425362 3300037466 Bacteria 1265
253 Ga0395898_0783145 3300037466 Bacteria 894
254 Ga0395905_0003589 3300037471 Bacteria 16508
255 Ga0395905_0006073 3300037471 Bacteria 12215
256 Ga0395905_0008877 3300037471 Bacteria 9874
257 Ga0395905_0024621 3300037471 Bacteria 5678
258 Ga0395905_0029919 3300037471 Bacteria 5133
259 Ga0395905_0047734 3300037471 Bacteria 4011
260 Ga0395905_0071446 3300037471 Bacteria 3254
261 Ga0395905_0083489 3300037471 Bacteria 2992
262 Ga0395905_0085668 3300037471 Bacteria 2952
263 Ga0395905_0129393 3300037471 Bacteria 2374
264 Ga0395905_0173836 3300037471 Bacteria 2023
265 Ga0395905_0190299 3300037471 Bacteria 1925
266 Ga0395905_0435079 3300037471 Bacteria 1209
267 Ga0395901_0006425 3300038443 Bacteria 11912
268 Ga0395901_0045610 3300038443 Bacteria 4550
269 Ga0395901_0057800 3300038443 Bacteria 4034
270 Ga0395901_0064911 3300038443 Bacteria 3800
271 Ga0395901_0136061 3300038443 Bacteria 2582
272 Ga0395901_0141782 3300038443 Bacteria 2526
273 Ga0395901_0258526 3300038443 Bacteria 1813
274 Ga0395901_0390287 3300038443 Bacteria 1431
275 Ga0395901_0459031 3300038443 Bacteria 1302
276 Ga0395901_0524962 3300038443 Bacteria 1202
277 Ga0395901_0629216 3300038443 Bacteria 1079
278 Ga0436365_0050448 3300039437 Bacteria 6824
279 Ga0436365_1054006 3300039437 Bacteria 23329
280 Ga0436363_0932722 3300039450 Bacteria 1463
281 Ga0436362_0703235 3300039453 Bacteria 1062
282 Ga0451853_2222065 3300041512 Bacteria 2607
283 Ga0453684_0186850 3300044712 Bacteria 2427
284 Ga0466957_0516909 3300044842 Bacteria 829
285 Ga0466958_0159420 3300045836 Bacteria 1425
286 Ga0466967_0070079 3300045976 Bacteria 3136
287 Ga0466967_0075440 3300045976 Bacteria 3030
288 Ga0466967_0220462 3300045976 Bacteria 1802
289 Ga0495603_0109241 3300046455 Bacteria 1614
290 Ga0495629_0210539 3300046459 Bacteria 1343
291 Ga0495582_0006881 3300046473 Bacteria 6321
292 Ga0495605_0028574 3300046474 Bacteria 2878
293 Ga0495584_0024102 3300046491 Bacteria 3085
294 Ga0495584_0161162 3300046491 Bacteria 1140
295 Ga0495596_0034991 3300046500 Bacteria 1993
296 Ga0495630_0005755 3300046517 Bacteria 8762
297 Ga0495644_0232338 3300046523 Bacteria 714
298 Ga0495663_0149496 3300046525 Bacteria 796
299 Ga0495642_0023179 3300046528 Bacteria 2450
300 Ga0495609_0029326 3300046538 Bacteria 2506
301 Ga0495609_0054900 3300046538 Bacteria 1768
302 Ga0495668_0167442 3300046616 Bacteria 1204
303 Ga0495659_0018105 3300046664 Bacteria 2343
304 Ga0495659_0027011 3300046664 Bacteria 1977
305 Ga0495659_0036862 3300046664 Bacteria 1730
306 Ga0495658_0037306 3300046683 Bacteria 2686
307 Ga0495589_0068073 3300046794 Bacteria 1742
308 Ga0495581_0001397 3300047315 Bacteria 13350
309 Ga0495676_0040666 3300047321 Bacteria 3834
310 Ga0495677_0117770 3300047445 Bacteria 1012
311 Ga0495677_0165714 3300047445 Bacteria 854
312 Ga0495677_0236095 3300047445 Bacteria 714
313 Ga0495593_0395237 3300047673 Bacteria 691
314 Ga0496100_0085815 3300048903 Bacteria 2137
315 Ga0496100_0114078 3300048903 Bacteria 1882
316 Ga0496101_0225871 3300048904 Bacteria 1454
317 Ga0496101_0531315 3300048904 Bacteria 930
318 Ga0496102_0008116 3300048905 Bacteria 8985
319 Ga0496102_0104041 3300048905 Bacteria 2640
320 Ga0496102_0169305 3300048905 Bacteria 2056
321 Ga0496102_0300357 3300048905 Bacteria 1513
322 Ga0496103_0092555 3300048906 Bacteria 1908
323 Ga0496103_0385227 3300048906 Bacteria 901
324 Ga0496104_0058729 3300048907 Bacteria 3641
325 Ga0496104_0103754 3300048907 Bacteria 2724
326 Ga0496105_0001568 3300048908 Bacteria 16195
327 Ga0496106_0010033 3300048909 Bacteria 6996
328 Ga0496106_0348317 3300048909 Bacteria 1190
329 Ga0496107_0000477 3300048910 Bacteria 22008
330 Ga0496107_0017918 3300048910 Bacteria 4985
331 Ga0496107_0124032 3300048910 Bacteria 1904
332 Ga0496107_0361482 3300048910 Bacteria 1080
333 Ga0496107_0389830 3300048910 Bacteria 1036
334 Ga0496107_0458321 3300048910 Bacteria 947
335 Ga0496108_0000843 3300048911 Bacteria 23878
336 Ga0496108_0013528 3300048911 Bacteria 6660
337 Ga0496108_0040357 3300048911 Bacteria 3890
338 Ga0496109_0002965 3300048912 Bacteria 14196
339 Ga0496109_0004262 3300048912 Bacteria 11948
340 Ga0496109_0009148 3300048912 Bacteria 8434
341 Ga0496109_0100137 3300048912 Bacteria 2688
342 Ga0496109_0646445 3300048912 Bacteria 994
343 Ga0496110_0006835 3300048913 Bacteria 9067
344 Ga0496110_0011369 3300048913 Bacteria 7284
345 Ga0496110_0023107 3300048913 Bacteria 5288
346 Ga0496110_0157766 3300048913 Bacteria 2056
347 Ga0496110_0399681 3300048913 Bacteria 1253
348 Ga0496110_0436744 3300048913 Bacteria 1193
349 Ga0496111_0003510 3300048914 Bacteria 9702
350 Ga0496111_0065482 3300048914 Bacteria 2638
351 Ga0496111_0076889 3300048914 Bacteria 2433
352 Ga0496111_0218134 3300048914 Bacteria 1417
353 Ga0496111_0346050 3300048914 Bacteria 1100
354 Ga0496112_0001154 3300048915 Bacteria 19715
355 Ga0496112_0122691 3300048915 Bacteria 2569
356 Ga0496112_0181856 3300048915 Bacteria 2066
357 Ga0496112_0201007 3300048915 Bacteria 1952
358 Ga0496112_0642134 3300048915 Bacteria 992
359 Ga0496113_0022721 3300048916 Bacteria 4441
360 Ga0496113_0065554 3300048916 Bacteria 2749
361 Ga0496113_0081661 3300048916 Bacteria 2478
362 Ga0496114_0019764 3300048917 Bacteria 5460
363 Ga0496114_0074331 3300048917 Bacteria 2861
364 Ga0501297_016877 3300049520 Bacteria 886
365 Ga0501298_002825 3300049521 Bacteria 2660
366 Ga0501036_0117069 3300049572 Bacteria 2250
367 Ga0501036_0137718 3300049572 Bacteria 2060
368 Ga0501037_0488534 3300049573 Unclassified 836
369 Ga0501038_0294272 3300049574 Bacteria 1275
370 Ga0501039_0021920 3300049575 Bacteria 4902
371 Ga0501039_0504344 3300049575 Bacteria 950
372 Ga0501039_0685763 3300049575 Bacteria 801
373 Ga0501040_0019204 3300049576 Bacteria 4546
374 Ga0501040_0038737 3300049576 Bacteria 3241
375 Ga0501041_0005249 3300049577 Bacteria 7570
376 Ga0501041_0054479 3300049577 Bacteria 2440
377 Ga0501041_0284946 3300049577 Bacteria 1040
378 Ga0501042_0011191 3300049578 Bacteria 6045
379 Ga0501042_0067686 3300049578 Bacteria 2553
380 Ga0501042_0381978 3300049578 Bacteria 1020
381 Ga0501042_0535036 3300049578 Bacteria 851
382 Ga0501046_0110487 3300049580 Bacteria 2101
383 Ga0501048_0012335 3300049582 Bacteria 6359
384 Ga0501067_0005111 3300049583 Bacteria 7290
385 Ga0501067_0012004 3300049583 Bacteria 4800
386 Ga0501067_0174710 3300049583 Bacteria 1196
387 Ga0501068_0029714 3300049584 Bacteria 3238
388 Ga0501068_0264020 3300049584 Unclassified 1098
389 Ga0501069_0014515 3300049585 Bacteria 4212
390 Ga0501069_0179440 3300049585 Bacteria 1224
391 Ga0501070_0183841 3300049586 Bacteria 1720
392 Ga0501071_0016565 3300049587 Bacteria 5071
393 Ga0501071_0333256 3300049587 Bacteria 1153
394 Ga0501072_0022935 3300049588 Bacteria 4846
395 Ga0501072_0023369 3300049588 Bacteria 4801
396 Ga0501072_0030711 3300049588 Bacteria 4204
397 Ga0501072_0338464 3300049588 Bacteria 1195
398 Ga0501074_0059091 3300049590 Bacteria 2763
399 Ga0501074_0064113 3300049590 Bacteria 2646
400 Ga0501075_0063531 3300049591 Bacteria 2783
401 Ga0501075_0075039 3300049591 Bacteria 2557
402 Ga0501076_0003599 3300049592 Bacteria 10886
403 Ga0501076_0034028 3300049592 Bacteria 3980
404 Ga0501076_0062366 3300049592 Bacteria 2968
405 Ga0501076_0550151 3300049592 Bacteria 952
406 Ga0501077_0002825 3300049593 Bacteria 10409
407 Ga0501077_0010712 3300049593 Bacteria 5709
408 Ga0501079_0103796 3300049741 Bacteria 2205
409 Ga0501079_0181711 3300049741 Bacteria 1641
410 Ga0501080_0059508 3300049742 Bacteria 3555
411 Ga0501080_0705348 3300049742 Bacteria 890
412 Ga0501081_0005136 3300049743 Bacteria 8428
413 Ga0501081_0018706 3300049743 Bacteria 4602
414 Ga0501081_0252970 3300049743 Bacteria 1286
415 Ga0501035_0098358 3300049822 Bacteria 2569
416 Ga0501035_0244103 3300049822 Bacteria 1527
417 Ga0501045_0009761 3300049824 Bacteria 6713
418 Ga0501045_0043872 3300049824 Bacteria 3257
419 Ga0501045_0226934 3300049824 Bacteria 1390
420 nmdc:mga06z11_23683_c1 3300050494 Bacteria 2888
421 nmdc:mga04h51_5574_c1 3300050495 Bacteria 3215
422 nmdc:mga05p37_214240_c1 3300050507 Bacteria 2327
423 nmdc:mga05p37_634645_c1 3300050507 Bacteria 1199
424 nmdc:mga05p37_68024_c1 3300050507 Bacteria 4380
425 nmdc:mga05p37_979879_c1 3300050507 Bacteria 901
426 nmdc:mga09592_2251_c1 3300050508 Bacteria 15526
427 nmdc:mga09592_280835_c1 3300050508 Bacteria 1444
428 nmdc:mga09592_787522_c1 3300050508 Bacteria 805
429 nmdc:mga0qj67_246720_c1 3300050509 Bacteria 1449
430 nmdc:mga0qj67_8636_c1 3300050509 Bacteria 7559
431 nmdc:mga06r32_102478_c1 3300050510 Bacteria 2810
432 nmdc:mga06r32_5780_c1 3300050510 Bacteria 11147
433 nmdc:mga08y16_112180_c1 3300050511 Bacteria 2838
434 nmdc:mga0n895_21273_c1 3300050512 Bacteria 6061
435 nmdc:mga0n895_247678_c1 3300050512 Bacteria 1808
436 nmdc:mga0n895_393003_c1 3300050512 Bacteria 1403
437 nmdc:mga0n895_9980_c1 3300050512 Bacteria 8355
438 nmdc:mga0rr50_6928_c1 3300050513 Bacteria 6949
439 nmdc:mga08x19_8451_c1 3300050514 Bacteria 6133
440 nmdc:mga0a205_119041_c1 3300050515 Bacteria 2540
441 nmdc:mga0a205_243742_c1 3300050515 Bacteria 1678
442 nmdc:mga0a205_387407_c1 3300050515 Bacteria 1262
443 nmdc:mga0a205_4038_c1 3300050515 Bacteria 13123
444 nmdc:mga0a205_419343_c1 3300050515 Bacteria 1201
445 Ga0501084_0003454 3300054114 Bacteria 12831
446 Ga0501084_0005423 3300054114 Bacteria 10458
447 Ga0501084_0065988 3300054114 Bacteria 3028
448 Ga0501084_0111503 3300054114 Bacteria 2299
449 Ga0590075_075556 3300059424 Bacteria 871
450 Ga0590077_032611 3300059426 Bacteria 1141
451 Ga0587066_026924 3300059490 Bacteria 997
452 Ga0501082_0004912 3300060353 Bacteria 11665
453 Ga0501082_0065616 3300060353 Bacteria 3126
454 Ga0501082_0114268 3300060353 Bacteria 2338
455 Ga0530510_0211447 3300061734 Bacteria 1441
456 Ga0070699_100002584
457 JGI24742J22300_10006118
458 Ga0070683_100002597
459 Ga0070683_100174696
460 Ga0070683_100234844
461 Ga0070690_100063704
462 Ga0070670_100208724
463 Ga0070666_10108855
464 Ga0070680_100048572
465 Ga0070682_100026420
466 Ga0070682_100154283
467 Ga0068868_100167000
468 Ga0070660_100018517
469 Ga0070660_100081068
470 Ga0070660_100259136
471 Ga0070660_100767323
472 Ga0070689_100106796
473 Ga0070687_100012665
474 Ga0070692_10018348
475 Ga0070668_100118186
476 Ga0070671_100131081
477 Ga0070674_100101862
478 Ga0070674_100109982
479 Ga0070673_100315310
480 Ga0070688_100050193
481 Ga0070659_100421533
482 Ga0070659_100602687
483 Ga0070667_100009237
484 Ga0070703_10004571
485 Ga0070709_10031214
486 Ga0070713_100032357
487 Ga0070710_10318326
488 Ga0070701_10022760
489 Ga0070711_100054432
490 Ga0070705_100250696
491 Ga0070705_100323884
492 Ga0070700_100007677
493 Ga0070694_100012323
494 Ga0070708_100131712
495 Ga0070708_100185010
496 Ga0070663_100076320
497 Ga0070678_100020373
498 Ga0070662_100146149
499 Ga0070681_10024160
500 Ga0070681_11040468
501 Ga0068867_100001494
502 Ga0070706_100212347
503 Ga0070707_100012018
504 Ga0070698_100073157
505 Ga0070699_100023239
506 Ga0070684_100001074
507 Ga0070684_100173870
508 Ga0070684_100558608
509 Ga0070697_100159280
510 Ga0068853_100016536
511 Ga0068853_100019979
512 Ga0068853_100048151
513 Ga0068853_100273205
514 Ga0070686_100001905
515 Ga0070695_100076904
516 Ga0070695_100150735
517 Ga0070696_100182748
518 Ga0070696_100273248
519 Ga0070693_100028022
520 Ga0070693_100267081
521 Ga0070693_100326394
522 Ga0070665_100012039
523 Ga0070665_100548699
524 Ga0070704_100003028
525 Ga0070704_100178773
526 Ga0068855_100107292
527 Ga0068855_100126852
528 Ga0070664_100163970
529 Ga0068857_100002220
530 Ga0068854_100205712
531 Ga0068856_100366293
532 Ga0068856_100379150
533 Ga0070702_100007012
534 Ga0068852_100298670
535 Ga0068866_10001347
536 Ga0068860_100308749
537 Ga0081455_10026079
538 Ga0081538_10166077
539 Ga0081539_10000384
540 Ga0070717_10272753
541 Ga0070712_100101441
542 Ga0070712_100152441
543 Ga0097621_100027657
544 Ga0097621_100219348
545 Ga0075370_10004713
546 Ga0068871_100006114
547 Ga0075428_100004398
548 Ga0075430_100010994
549 Ga0075431_100003765
550 Ga0075431_100004510
551 Ga0075431_100152715
552 Ga0075431_100781936
553 Ga0075433_10003555
554 Ga0075433_10008898
555 Ga0075433_10597306
556 Ga0075434_100068478
557 Ga0075434_100137115
558 Ga0075434_100320369
559 Ga0075434_100340098
560 Ga0075429_100003138
561 Ga0068865_100052396
562 Ga0068865_100265490
563 Ga0075436_100016970
564 Ga0075435_100010171
565 Ga0075435_100052535
566 Ga0111539_10001786
567 Ga0105245_10067360
568 Ga0114129_10005588
569 Ga0114129_10058570
570 Ga0114129_10101247
571 Ga0114129_10101537
572 Ga0114129_10267247
573 Ga0114129_10808368
574 Ga0114129_10899908
575 Ga0114129_11034997
576 Ga0105243_10096170
577 Ga0105241_10296154
578 Ga0105242_10613108
579 Ga0105248_10039134
580 Ga0105238_10413428
581 Ga0105246_10040995
582 Ga0157373_10069929
583 Ga0157374_10502944
584 Ga0157378_10031649
585 Ga0163162_10079316
586 Ga0157372_10333204
587 Ga0157375_10206563
588 Ga0157375_10339946
589 Ga0157379_10154759
590 Ga0157376_10150030
591 Ga0206356_10762478
592 Ga0213876_10002712
593 Ga0213876_10007692
594 Ga0207653_10005061
595 Ga0207642_10002112
596 Ga0207680_10052506
597 Ga0207705_10091453
598 Ga0207684_10707829
599 Ga0207684_10966282
600 Ga0207707_10148020
601 Ga0207707_10849278
602 Ga0207693_10012153
603 Ga0207693_10063373
604 Ga0207693_10179507
605 Ga0207663_10334898
606 Ga0207660_10057600
607 Ga0207660_10088739
608 Ga0207660_10128990
609 Ga0207657_10001199
610 Ga0207657_10047579
611 Ga0207657_10201148
612 Ga0207646_10037297
613 Ga0207694_10097840
614 Ga0207687_10056558
615 Ga0207644_10064889
616 Ga0207690_10062561
617 Ga0207690_10109891
618 Ga0207690_10282084
619 Ga0207706_10028775
620 Ga0207686_10002109
621 Ga0207709_10001379
622 Ga0207709_10283381
623 Ga0207669_10316037
624 Ga0207669_10360377
625 Ga0207704_10001420
626 Ga0207665_10041623
627 Ga0207661_10169543
628 Ga0207661_10586887
629 Ga0207679_10124260
630 Ga0207712_10002222
631 Ga0207668_10032538
632 Ga0207658_10063326
633 Ga0207677_10104404
634 Ga0207677_10106710
635 Ga0207703_10210955
636 Ga0207639_10011400
637 Ga0207639_10052989
638 Ga0207639_10136754
639 Ga0207639_10364633
640 Ga0207678_10031561
641 Ga0207708_10000866
642 Ga0207708_10202965
643 Ga0207702_10096123
644 Ga0207702_10182093
645 Ga0207702_10281016
646 Ga0207641_10007722
647 Ga0207648_10000097
648 Ga0207648_10350967
649 Ga0207674_10001849
650 Ga0207683_10000038
651 Ga0209813_10088346
652 Ga0207428_10015267
653 Ga0268266_10046609
654 Ga0268264_10017813
655 Ga0265770_1016682
656 Ga0307408_100036512
657 Ga0307408_100117164
658 Ga0307408_100537557
659 Ga0307405_10511237
660 Ga0307405_10534328
661 Ga0307413_10213449
662 Ga0307410_10065290
663 Ga0307410_10066968
664 Ga0307407_10510667
665 Ga0307407_10706565
666 Ga0307412_11026327
667 Ga0307409_100152052
668 Ga0307409_100161148
669 Ga0307409_100293343
670 Ga0307409_100818989
671 Ga0307416_100137647
672 Ga0307416_100244125
673 Ga0307416_100266548
674 Ga0307416_100332463
675 Ga0307416_100588028
676 Ga0307414_10243293
677 Ga0307415_100071212
678 Ga0373946_0134210
679 Ga0373961_0061528
680 Ga0373925_0241050
681 Ga0395899_0008139
682 Ga0395899_0008230
683 Ga0395899_0028812
684 Ga0395899_0034773
685 Ga0395899_0085085
686 Ga0395899_0152474
687 Ga0395899_0156551
688 Ga0395900_0003063
689 Ga0395900_0003252
690 Ga0395900_0017178
691 Ga0395900_0028012
692 Ga0395900_0040358
693 Ga0395900_0079779
694 Ga0395900_0149666
695 Ga0395900_0168016
696 Ga0395900_0248453
697 Ga0395900_0767043
698 Ga0395900_1036084
699 Ga0395898_0005810
700 Ga0395898_0011130
701 Ga0395898_0022440
702 Ga0395898_0026792
703 Ga0395898_0028527
704 Ga0395898_0036872
705 Ga0395898_0049860
706 Ga0395898_0072279
707 Ga0395898_0425362
708 Ga0395898_0783145
709 Ga0395905_0003589
710 Ga0395905_0006073
711 Ga0395905_0008877
712 Ga0395905_0024621
713 Ga0395905_0029919
714 Ga0395905_0047734
715 Ga0395905_0071446
716 Ga0395905_0083489
717 Ga0395905_0085668
718 Ga0395905_0129393
719 Ga0395905_0173836
720 Ga0395905_0190299
721 Ga0395905_0435079
722 Ga0395901_0006425
723 Ga0395901_0045610
724 Ga0395901_0057800
725 Ga0395901_0064911
726 Ga0395901_0136061
727 Ga0395901_0141782
728 Ga0395901_0258526
729 Ga0395901_0390287
730 Ga0395901_0459031
731 Ga0395901_0524962
732 Ga0395901_0629216
733 Ga0436365_0050448
734 Ga0436365_1054006
735 Ga0436363_0932722
736 Ga0436362_0703235
737 Ga0451853_2222065
738 Ga0453684_0186850
739 Ga0466957_0516909
740 Ga0466958_0159420
741 Ga0466967_0070079
742 Ga0466967_0075440
743 Ga0466967_0220462
744 Ga0495603_0109241
745 Ga0495629_0210539
746 Ga0495582_0006881
747 Ga0495605_0028574
748 Ga0495584_0024102
749 Ga0495584_0161162
750 Ga0495596_0034991
751 Ga0495630_0005755
752 Ga0495644_0232338
753 Ga0495663_0149496
754 Ga0495642_0023179
755 Ga0495609_0029326
756 Ga0495609_0054900
757 Ga0495668_0167442
758 Ga0495659_0018105
759 Ga0495659_0027011
760 Ga0495659_0036862
761 Ga0495658_0037306
762 Ga0495589_0068073
763 Ga0495581_0001397
764 Ga0495676_0040666
765 Ga0495677_0117770
766 Ga0495677_0165714
767 Ga0495677_0236095
768 Ga0495593_0395237
769 Ga0496100_0085815
770 Ga0496100_0114078
771 Ga0496101_0225871
772 Ga0496101_0531315
773 Ga0496102_0008116
774 Ga0496102_0104041
775 Ga0496102_0169305
776 Ga0496102_0300357
777 Ga0496103_0092555
778 Ga0496103_0385227
779 Ga0496104_0058729
780 Ga0496104_0103754
781 Ga0496105_0001568
782 Ga0496106_0010033
783 Ga0496106_0348317
784 Ga0496107_0000477
785 Ga0496107_0017918
786 Ga0496107_0124032
787 Ga0496107_0361482
788 Ga0496107_0389830
789 Ga0496107_0458321
790 Ga0496108_0000843
791 Ga0496108_0013528
792 Ga0496108_0040357
793 Ga0496109_0002965
794 Ga0496109_0004262
795 Ga0496109_0009148
796 Ga0496109_0100137
797 Ga0496109_0646445
798 Ga0496110_0006835
799 Ga0496110_0011369
800 Ga0496110_0023107
801 Ga0496110_0157766
802 Ga0496110_0399681
803 Ga0496110_0436744
804 Ga0496111_0003510
805 Ga0496111_0065482
806 Ga0496111_0076889
807 Ga0496111_0218134
808 Ga0496111_0346050
809 Ga0496112_0001154
810 Ga0496112_0122691
811 Ga0496112_0181856
812 Ga0496112_0201007
813 Ga0496112_0642134
814 Ga0496113_0022721
815 Ga0496113_0065554
816 Ga0496113_0081661
817 Ga0496114_0019764
818 Ga0496114_0074331
819 Ga0501297_016877
820 Ga0501298_002825
821 Ga0501036_0117069
822 Ga0501036_0137718
823 Ga0501037_0488534
824 Ga0501038_0294272
825 Ga0501039_0021920
826 Ga0501039_0504344
827 Ga0501039_0685763
828 Ga0501040_0019204
829 Ga0501040_0038737
830 Ga0501041_0005249
831 Ga0501041_0054479
832 Ga0501041_0284946
833 Ga0501042_0011191
834 Ga0501042_0067686
835 Ga0501042_0381978
836 Ga0501042_0535036
837 Ga0501046_0110487
838 Ga0501048_0012335
839 Ga0501067_0005111
840 Ga0501067_0012004
841 Ga0501067_0174710
842 Ga0501068_0029714
843 Ga0501068_0264020
844 Ga0501069_0014515
845 Ga0501069_0179440
846 Ga0501070_0183841
847 Ga0501071_0016565
848 Ga0501071_0333256
849 Ga0501072_0022935
850 Ga0501072_0023369
851 Ga0501072_0030711
852 Ga0501072_0338464
853 Ga0501074_0059091
854 Ga0501074_0064113
855 Ga0501075_0063531
856 Ga0501075_0075039
857 Ga0501076_0003599
858 Ga0501076_0034028
859 Ga0501076_0062366
860 Ga0501076_0550151
861 Ga0501077_0002825
862 Ga0501077_0010712
863 Ga0501079_0103796
864 Ga0501079_0181711
865 Ga0501080_0059508
866 Ga0501080_0705348
867 Ga0501081_0005136
868 Ga0501081_0018706
869 Ga0501081_0252970
870 Ga0501035_0098358
871 Ga0501035_0244103
872 Ga0501045_0009761
873 Ga0501045_0043872
874 Ga0501045_0226934
875 nmdc:mga06z11_23683_c1
876 nmdc:mga04h51_5574_c1
877 nmdc:mga05p37_214240_c1
878 nmdc:mga05p37_634645_c1
879 nmdc:mga05p37_68024_c1
880 nmdc:mga05p37_979879_c1
881 nmdc:mga09592_2251_c1
882 nmdc:mga09592_280835_c1
883 nmdc:mga09592_787522_c1
884 nmdc:mga0qj67_246720_c1
885 nmdc:mga0qj67_8636_c1
886 nmdc:mga06r32_102478_c1
887 nmdc:mga06r32_5780_c1
888 nmdc:mga08y16_112180_c1
889 nmdc:mga0n895_21273_c1
890 nmdc:mga0n895_247678_c1
891 nmdc:mga0n895_393003_c1
892 nmdc:mga0n895_9980_c1
893 nmdc:mga0rr50_6928_c1
894 nmdc:mga08x19_8451_c1
895 nmdc:mga0a205_119041_c1
896 nmdc:mga0a205_243742_c1
897 nmdc:mga0a205_387407_c1
898 nmdc:mga0a205_4038_c1
899 nmdc:mga0a205_419343_c1
900 Ga0501084_0003454
901 Ga0501084_0005423
902 Ga0501084_0065988
903 Ga0501084_0111503
904 Ga0590075_075556
905 Ga0590077_032611
906 Ga0587066_026924
907 Ga0501082_0004912
908 Ga0501082_0065616
909 Ga0501082_0114268
910 Ga0530510_0211447

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

83

242

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6iod-assembly2.cif.gz_B the structure of udgx in complex with single-stranded dna 0.9798 9 207
6l6s-assembly1.cif.gz_A the structure of the udgx mutant h109e crosslinked to single-stranded dna 0.9783 9 206
8iij-assembly1.cif.gz_A h109g mutant of uracil dna glycosylase x 0.9644 9 206
8iig-assembly1.cif.gz_A complex form of msmudgx h109a mutant and uracil- obtained from uracil dna (ttutt) post its cleavage by udgx h109a 0.9639 9 207
8iil-assembly1.cif.gz_A complex form of msmudgx h109g mutant and uracil- obtained from uracil dna (ttutt) post its cleavage by msmudgx h109g 0.9635 9 207
ID Description Score Start End Superfamily
1ui0A00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8737 19 209 3.40.470.10
1ui0A00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8479 19 209 3.40.470.10
4zbzA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8329 19 207 3.40.470.10
4zbzA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8128 19 207 3.40.470.10
2d3yA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7447 19 206 3.40.470.10
ID Description Score Start End GO Terms
AF-A0A537TSP7-F1-model_v4 Uracil-DNA glycosylase 0.9961 70 207 GO:0006281
GO:0046872
GO:0051539
GO:0097506
AF-A0A7V9KZQ3-F1-model_v4 Type-4 uracil-DNA glycosylase 0.9957 23 157 GO:0006281
GO:0046872
GO:0051539
GO:0097506
AF-A0A2V6DMC3-F1-model_v4 Type-4 uracil-DNA glycosylase 0.9937 14 151 GO:0004844
GO:0006281
GO:0046872
GO:0051539
AF-A0A536YSA9-F1-model_v4 Uracil-DNA glycosylase 0.9935 27 133 GO:0006281
GO:0046872
GO:0051539
GO:0097506
AF-A0A535W2D9-F1-model_v4 Type-4 uracil-DNA glycosylase 0.9927 19 207 GO:0004844
GO:0006281
GO:0046872
GO:0051539

Map