F447445

General Info

Members Datasets Scaffolds Average Seq Length
454 220 442 263

Family's Representative Sequence

Representative Sequence 3300047320|Ga0495672_0151786|Ga0495672_0151786_252_1106
Length 284
Sequence LIARRRRDEPAVVTPTPEDEAALDATKAPLMEHLIELRKRLIWAVLSFGICFVVSFAFSTQIFNFLTEPLHQALKGKPNDHMIYTALTEVFFTKVKIGMFGGICLGFPAIAAQLWIFVAPGLYKHEKRAFLPFLLWTPVMFTMGAAFVYFIMLPFSIDFFVAYQTSSTDGAMGIELQAKVSDYLGFVMTLIFAFGLTFQLPVLLSLLGKVGIVTSKGLREMRRYAIVGLFAVAAIFTPPDAISMLALAVPLTLLYEVSIWCVIMIERTRAKEDAARAARDLTPA

Samples

Sample ID Description Type Environment
1 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
2 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
3 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
4 2643221580 Devosia sp. Root635 Isolate Unclassified
5 2643221591 Devosia sp. Root685 Isolate Unclassified
6 2643221674 Devosia sp. Root436 Isolate Unclassified
7 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
8 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
9 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
10 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
11 2932401849 Devosia sp. 2618 Isolate Rhizosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
84 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
86 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
129 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
130 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
131 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
132 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
133 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
134 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
135 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
136 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
137 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
138 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
139 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
140 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
141 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
142 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
143 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
144 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
145 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
148 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
149 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
151 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
161 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
162 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
163 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
164 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
168 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
169 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
170 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
171 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
172 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
173 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
174 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
175 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
176 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
177 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
183 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
184 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
185 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
186 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
205 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
208 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
209 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
210 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
211 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
212 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
213 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
214 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
215 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
216 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
217 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
218 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
220 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.14
Metatranscriptomes 0.22
Isolates 2.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.96
Nodule 0
Rhizoplane 0.44
Rhizosphere 89.43
Stem 0
Stem Tuber 0
Unclassified 6.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000425 3300003214 Bacteria 43589
2 JGI25153J46596_10000552 3300003215 Bacteria 23376
3 Ga0065704_10234698 3300005289 Bacteria 1032
4 Ga0070658_10002834 3300005327 Bacteria 14407
5 Ga0070658_10139089 3300005327 Bacteria 2027
6 Ga0070658_10193219 3300005327 Bacteria 1716
7 Ga0070658_10363285 3300005327 Bacteria 1240
8 Ga0070658_10381820 3300005327 Bacteria 1209
9 Ga0070676_10156414 3300005328 Bacteria 1463
10 Ga0070683_100091758 3300005329 Bacteria 2852
11 Ga0070690_100026903 3300005330 Bacteria 3552
12 Ga0070670_100268896 3300005331 Bacteria 1487
13 Ga0068869_100035401 3300005334 Bacteria 3538
14 Ga0068869_100431899 3300005334 Bacteria 1088
15 Ga0070666_10004425 3300005335 Bacteria 8558
16 Ga0070666_10006985 3300005335 Bacteria 6960
17 Ga0070666_10059351 3300005335 Bacteria 2587
18 Ga0070680_100002345 3300005336 Bacteria 13991
19 Ga0068868_100019123 3300005338 Bacteria 5130
20 Ga0068868_100145697 3300005338 Unclassified 1947
21 Ga0070660_100034520 3300005339 Bacteria 3822
22 Ga0070660_100246891 3300005339 Bacteria 1455
23 Ga0070660_100297879 3300005339 Unclassified 1322
24 Ga0070689_100288386 3300005340 Bacteria 1363
25 Ga0070661_100000415 3300005344 Bacteria 32936
26 Ga0070661_100237408 3300005344 Bacteria 1402
27 Ga0070669_100258740 3300005353 Bacteria 1388
28 Ga0070675_100290453 3300005354 Unclassified 1439
29 Ga0070688_100014230 3300005365 Bacteria 4504
30 Ga0070659_100196990 3300005366 Bacteria 1657
31 Ga0070667_100008047 3300005367 Bacteria 8745
32 Ga0070667_100023261 3300005367 Bacteria 5140
33 Ga0070667_100225017 3300005367 Bacteria 1671
34 Ga0070678_100024532 3300005456 Unclassified 4040
35 Ga0070678_100093622 3300005456 Bacteria 2311
36 Ga0070678_100268425 3300005456 Bacteria 1438
37 Ga0070662_100083826 3300005457 Unclassified 2380
38 Ga0070681_10000001 3300005458 Bacteria 946857
39 Ga0070681_10073488 3300005458 Bacteria 3381
40 Ga0070681_10391393 3300005458 Unclassified 1301
41 Ga0070681_10544775 3300005458 Bacteria 1074
42 Ga0068867_100004232 3300005459 Bacteria 10099
43 Ga0068867_100069625 3300005459 Bacteria 2628
44 Ga0070699_100346877 3300005518 Bacteria 1337
45 Ga0070679_100000096 3300005530 Bacteria 67304
46 Ga0070679_100006337 3300005530 Bacteria 11018
47 Ga0070679_100070061 3300005530 Bacteria 3498
48 Ga0070679_100316072 3300005530 Bacteria 1511
49 Ga0070679_100430262 3300005530 Bacteria 1265
50 Ga0070679_100589815 3300005530 Bacteria 1055
51 Ga0070684_100098543 3300005535 Bacteria 2608
52 Ga0070684_100195111 3300005535 Bacteria 1843
53 Ga0068853_100060241 3300005539 Bacteria 3279
54 Ga0068853_100082395 3300005539 Bacteria 2818
55 Ga0068853_100170180 3300005539 Bacteria 1971
56 Ga0070695_100233287 3300005545 Unclassified 1331
57 Ga0070693_100168467 3300005547 Bacteria 1401
58 Ga0070665_100002027 3300005548 Bacteria 22781
59 Ga0070665_100004584 3300005548 Bacteria 14471
60 Ga0070665_100042507 3300005548 Unclassified 4568
61 Ga0070665_100067189 3300005548 Bacteria 3595
62 Ga0070665_100092073 3300005548 Bacteria 3036
63 Ga0070665_100207277 3300005548 Bacteria 1961
64 Ga0070665_100377787 3300005548 Bacteria 1424
65 Ga0068855_100201456 3300005563 Bacteria 2240
66 Ga0068855_100251188 3300005563 Bacteria 1973
67 Ga0068855_100332287 3300005563 Bacteria 1678
68 Ga0070664_100317947 3300005564 Bacteria 1410
69 Ga0068857_100045453 3300005577 Bacteria 3896
70 Ga0068856_100142061 3300005614 Bacteria 2408
71 Ga0068856_100271852 3300005614 Bacteria 1711
72 Ga0068856_100327470 3300005614 Bacteria 1550
73 Ga0068852_100015405 3300005616 Bacteria 5929
74 Ga0068852_100118787 3300005616 Bacteria 2416
75 Ga0068852_100246059 3300005616 Bacteria 1711
76 Ga0068859_100057770 3300005617 Bacteria 3908
77 Ga0068859_100113930 3300005617 Bacteria 2768
78 Ga0068851_10084228 3300005834 Bacteria 1665
79 Ga0068863_100026142 3300005841 Bacteria 5570
80 Ga0068863_100074099 3300005841 Bacteria 3220
81 Ga0068858_100059973 3300005842 Bacteria 3517
82 Ga0068858_100315325 3300005842 Unclassified 1494
83 Ga0068860_100032511 3300005843 Bacteria 5012
84 Ga0068860_100202656 3300005843 Bacteria 1923
85 Ga0068860_100277251 3300005843 Bacteria 1638
86 Ga0068862_100093360 3300005844 Bacteria 2624
87 Ga0068862_100306383 3300005844 Bacteria 1463
88 Ga0081539_10003744 3300005985 Bacteria 18082
89 Ga0070712_100049256 3300006175 Bacteria 2925
90 Ga0097621_100000693 3300006237 Bacteria 23626
91 Ga0097621_100051066 3300006237 Bacteria 3364
92 Ga0097621_100324351 3300006237 Bacteria 1365
93 Ga0068871_100000385 3300006358 Bacteria 31027
94 Ga0068871_100017481 3300006358 Bacteria 5428
95 Ga0068871_100112013 3300006358 Bacteria 2296
96 Ga0068871_100187769 3300006358 Bacteria 1779
97 Ga0068871_100246354 3300006358 Bacteria 1555
98 Ga0068871_100369142 3300006358 Bacteria 1272
99 Ga0068865_100019735 3300006881 Bacteria 4364
100 Ga0068865_100049141 3300006881 Unclassified 2906
101 Ga0097620_100057772 3300006931 Bacteria 3908
102 Ga0097620_100113925 3300006931 Bacteria 2768
103 Ga0105240_10000189 3300009093 Bacteria 125396
104 Ga0105240_10022178 3300009093 Bacteria 8424
105 Ga0105240_10040506 3300009093 Bacteria 5957
106 Ga0105240_10047424 3300009093 Bacteria 5436
107 Ga0105240_10064693 3300009093 Bacteria 4543
108 Ga0105240_10200393 3300009093 Bacteria 2339
109 Ga0105240_10215857 3300009093 Bacteria 2238
110 Ga0105240_10300617 3300009093 Bacteria 1836
111 Ga0105240_10324358 3300009093 Bacteria 1754
112 Ga0105240_10376010 3300009093 Bacteria 1605
113 Ga0105245_10036515 3300009098 Bacteria 4366
114 Ga0105245_10115751 3300009098 Bacteria 2499
115 Ga0105245_10188189 3300009098 Bacteria 1976
116 Ga0105245_10451638 3300009098 Bacteria 1294
117 Ga0105243_10050578 3300009148 Bacteria 3284
118 Ga0105243_10211188 3300009148 Bacteria 1709
119 Ga0105241_10016603 3300009174 Bacteria 5402
120 Ga0105241_10073163 3300009174 Bacteria 2665
121 Ga0105241_10106541 3300009174 Bacteria 2237
122 Ga0105242_10002477 3300009176 Bacteria 14478
123 Ga0105242_10004737 3300009176 Bacteria 10535
124 Ga0105242_10064993 3300009176 Bacteria 3009
125 Ga0105248_10000001 3300009177 Bacteria 1881304
126 Ga0105248_10030640 3300009177 Bacteria 6008
127 Ga0105248_10092485 3300009177 Bacteria 3406
128 Ga0105237_10044071 3300009545 Bacteria 4492
129 Ga0105237_10087383 3300009545 Bacteria 3107
130 Ga0105237_10143878 3300009545 Bacteria 2379
131 Ga0105237_10200544 3300009545 Bacteria 1995
132 Ga0105237_10233619 3300009545 Bacteria 1840
133 Ga0105237_10344348 3300009545 Unclassified 1495
134 Ga0105237_10480194 3300009545 Bacteria 1249
135 Ga0105238_10051825 3300009551 Bacteria 4126
136 Ga0105238_10060499 3300009551 Bacteria 3792
137 Ga0105238_10124164 3300009551 Unclassified 2561
138 Ga0105238_10126559 3300009551 Bacteria 2533
139 Ga0105238_10180964 3300009551 Bacteria 2085
140 Ga0105238_10181116 3300009551 Bacteria 2084
141 Ga0105238_10234543 3300009551 Bacteria 1812
142 Ga0105238_10258623 3300009551 Bacteria 1720
143 Ga0105238_10262774 3300009551 Bacteria 1706
144 Ga0105249_10003440 3300009553 Bacteria 13707
145 Ga0105249_10137287 3300009553 Bacteria 2341
146 Ga0105249_10197808 3300009553 Bacteria 1965
147 Ga0105239_10007355 3300010375 Bacteria 12647
148 Ga0105239_10021044 3300010375 Bacteria 7198
149 Ga0105239_10076188 3300010375 Bacteria 3689
150 Ga0105246_10004555 3300011119 Bacteria 8435
151 Ga0105246_10016138 3300011119 Unclassified 4726
152 Ga0157370_10032355 3300013104 Bacteria 5107
153 Ga0157370_10043367 3300013104 Bacteria 4330
154 Ga0157370_10063278 3300013104 Bacteria 3506
155 Ga0157370_10284578 3300013104 Bacteria 1527
156 Ga0157369_10054498 3300013105 Bacteria 4318
157 Ga0157369_10239529 3300013105 Bacteria 1895
158 Ga0157369_10313354 3300013105 Bacteria 1631
159 Ga0157374_10009118 3300013296 Bacteria 8502
160 Ga0157374_10055681 3300013296 Bacteria 3692
161 Ga0157378_10017840 3300013297 Bacteria 6230
162 Ga0157378_10039888 3300013297 Unclassified 4164
163 Ga0157378_10043102 3300013297 Bacteria 4006
164 Ga0157378_10107892 3300013297 Unclassified 2548
165 Ga0157372_10296708 3300013307 Bacteria 1880
166 Ga0157372_10805973 3300013307 Unclassified 1091
167 Ga0157375_10022429 3300013308 Bacteria 5811
168 Ga0157375_10364595 3300013308 Bacteria 1611
169 Ga0163163_10000007 3300014325 Bacteria 288439
170 Ga0163163_10039975 3300014325 Unclassified 4579
171 Ga0163163_10108259 3300014325 Bacteria 2806
172 Ga0163163_10135522 3300014325 Bacteria 2504
173 Ga0157379_10001375 3300014968 Bacteria 19911
174 Ga0157379_10429018 3300014968 Bacteria 1218
175 Ga0157376_10390137 3300014969 Bacteria 1343
176 Ga0163161_10003454 3300017792 Bacteria 11071
177 Ga0213876_10055206 3300021384 Bacteria 2097
178 Ga0213876_10166735 3300021384 Bacteria 1172
179 Ga0213875_10220188 3300021388 Bacteria 894
180 Ga0209233_1000013 3300025261 Bacteria 1013785
181 Ga0209233_1004067 3300025261 Bacteria 5051
182 Ga0209675_1000873 3300025291 Bacteria 19411
183 Ga0209758_1000036 3300025297 Bacteria 441671
184 Ga0209257_1007643 3300025304 Bacteria 6474
185 Ga0207642_10057097 3300025899 Bacteria 1794
186 Ga0207688_10057611 3300025901 Bacteria 2184
187 Ga0207680_10018406 3300025903 Bacteria 3712
188 Ga0207680_10063774 3300025903 Bacteria 2256
189 Ga0207645_10115778 3300025907 Bacteria 1738
190 Ga0207643_10175676 3300025908 Bacteria 1294
191 Ga0207654_10115617 3300025911 Unclassified 1676
192 Ga0207654_10147452 3300025911 Bacteria 1507
193 Ga0207707_10000001 3300025912 Bacteria 1212482
194 Ga0207707_10378702 3300025912 Bacteria 1217
195 Ga0207695_10000003 3300025913 Bacteria 1368691
196 Ga0207695_10006268 3300025913 Bacteria 15485
197 Ga0207695_10033816 3300025913 Bacteria 5569
198 Ga0207695_10061684 3300025913 Bacteria 3874
199 Ga0207695_10067671 3300025913 Bacteria 3662
200 Ga0207695_10126800 3300025913 Bacteria 2513
201 Ga0207695_10165009 3300025913 Bacteria 2144
202 Ga0207695_10189392 3300025913 Bacteria 1975
203 Ga0207695_10239190 3300025913 Bacteria 1717
204 Ga0207695_10439860 3300025913 Bacteria 1187
205 Ga0207671_10010097 3300025914 Bacteria 7827
206 Ga0207671_10225315 3300025914 Bacteria 1470
207 Ga0207671_10278016 3300025914 Bacteria 1320
208 Ga0207660_10001894 3300025917 Bacteria 13943
209 Ga0207657_10272903 3300025919 Bacteria 1344
210 Ga0207657_10294758 3300025919 Unclassified 1286
211 Ga0207649_10000448 3300025920 Bacteria 29660
212 Ga0207649_10166564 3300025920 Bacteria 1531
213 Ga0207652_10000815 3300025921 Bacteria 29778
214 Ga0207652_10011116 3300025921 Bacteria 7255
215 Ga0207652_10063640 3300025921 Bacteria 3190
216 Ga0207652_10080918 3300025921 Bacteria 2841
217 Ga0207652_10091036 3300025921 Bacteria 2681
218 Ga0207652_10264969 3300025921 Bacteria 1550
219 Ga0207694_10000011 3300025924 Bacteria 417640
220 Ga0207694_10155726 3300025924 Bacteria 1843
221 Ga0207694_10195233 3300025924 Bacteria 1646
222 Ga0207650_10190956 3300025925 Bacteria 1637
223 Ga0207687_10098775 3300025927 Bacteria 2144
224 Ga0207687_10312316 3300025927 Unclassified 1270
225 Ga0207687_10568163 3300025927 Bacteria 953
226 Ga0207700_10078528 3300025928 Bacteria 2568
227 Ga0207644_10210711 3300025931 Bacteria 1536
228 Ga0207706_10134830 3300025933 Unclassified 2172
229 Ga0207686_10021121 3300025934 Unclassified 3731
230 Ga0207709_10086528 3300025935 Bacteria 2035
231 Ga0207711_10000002 3300025941 Bacteria 1228676
232 Ga0207711_10079049 3300025941 Bacteria 2870
233 Ga0207711_10270410 3300025941 Bacteria 1563
234 Ga0207689_10043642 3300025942 Bacteria 3707
235 Ga0207689_10060613 3300025942 Bacteria 3111
236 Ga0207689_10071371 3300025942 Bacteria 2852
237 Ga0207661_10361063 3300025944 Unclassified 1312
238 Ga0207679_10214643 3300025945 Bacteria 1616
239 Ga0207667_10000093 3300025949 Bacteria 145814
240 Ga0207667_10052480 3300025949 Bacteria 4294
241 Ga0207667_10092004 3300025949 Bacteria 3133
242 Ga0207667_10265675 3300025949 Bacteria 1754
243 Ga0207712_10066588 3300025961 Bacteria 2575
244 Ga0207658_10015559 3300025986 Bacteria 5219
245 Ga0207658_10054660 3300025986 Bacteria 2955
246 Ga0207658_10056216 3300025986 Bacteria 2919
247 Ga0207677_10019049 3300026023 Unclassified 4135
248 Ga0207677_10281252 3300026023 Bacteria 1366
249 Ga0207677_10372003 3300026023 Bacteria 1203
250 Ga0207703_10055490 3300026035 Unclassified 3223
251 Ga0207703_10136947 3300026035 Bacteria 2120
252 Ga0207639_10010896 3300026041 Bacteria 6305
253 Ga0207639_10026761 3300026041 Bacteria 4193
254 Ga0207639_10251515 3300026041 Bacteria 1541
255 Ga0207641_10020165 3300026088 Bacteria 5473
256 Ga0207641_10065592 3300026088 Bacteria 3106
257 Ga0207648_10010697 3300026089 Bacteria 8672
258 Ga0207648_10122728 3300026089 Bacteria 2284
259 Ga0207676_10070593 3300026095 Bacteria 2801
260 Ga0207674_10105482 3300026116 Bacteria 2796
261 Ga0207674_10424121 3300026116 Unclassified 1285
262 Ga0207675_100182889 3300026118 Bacteria 2008
263 Ga0207683_10012094 3300026121 Bacteria 7366
264 Ga0207683_10047613 3300026121 Bacteria 3755
265 Ga0207683_10280156 3300026121 Bacteria 1524
266 Ga0207698_10002935 3300026142 Bacteria 10197
267 Ga0268266_10004374 3300028379 Bacteria 13565
268 Ga0268266_10004626 3300028379 Bacteria 13123
269 Ga0268266_10032159 3300028379 Bacteria 4457
270 Ga0268266_10382226 3300028379 Bacteria 1328
271 Ga0268265_10072493 3300028380 Bacteria 2687
272 Ga0268264_10224027 3300028381 Bacteria 1733
273 Ga0265334_10001027 3300028573 Bacteria 13760
274 Ga0265334_10008058 3300028573 Bacteria 4496
275 Ga0265338_10000014 3300028800 Bacteria 378751
276 Ga0265338_10003602 3300028800 Bacteria 21622
277 Ga0265338_10021187 3300028800 Bacteria 6790
278 Ga0265338_10142079 3300028800 Bacteria 1879
279 Ga0265324_10056615 3300029957 Bacteria 1343
280 Ga0265332_10052915 3300031238 Bacteria 1743
281 Ga0265332_10099233 3300031238 Bacteria 1229
282 Ga0265332_10165601 3300031238 Bacteria 923
283 Ga0265328_10036067 3300031239 Bacteria 1827
284 Ga0265325_10000001 3300031241 Bacteria 726814
285 Ga0265329_10045976 3300031242 Bacteria 1395
286 Ga0265340_10001172 3300031247 Bacteria 15004
287 Ga0265339_10000941 3300031249 Bacteria 22348
288 Ga0265339_10018579 3300031249 Bacteria 4094
289 Ga0265331_10001093 3300031250 Bacteria 20883
290 Ga0265331_10065078 3300031250 Bacteria 1715
291 Ga0265331_10113102 3300031250 Bacteria 1244
292 Ga0265327_10000365 3300031251 Bacteria 86000
293 Ga0265316_10271413 3300031344 Bacteria 1241
294 Ga0265316_10354507 3300031344 Bacteria 1062
295 Ga0307513_10205817 3300031456 Bacteria 1804
296 Ga0265313_10000660 3300031595 Bacteria 35564
297 Ga0265313_10007050 3300031595 Bacteria 7777
298 Ga0265313_10009639 3300031595 Bacteria 6240
299 Ga0265314_10005627 3300031711 Bacteria 11255
300 Ga0265314_10038179 3300031711 Bacteria 3473
301 Ga0265314_10059506 3300031711 Bacteria 2613
302 Ga0265314_10067857 3300031711 Bacteria 2400
303 Ga0265314_10131459 3300031711 Bacteria 1561
304 Ga0265342_10129748 3300031712 Unclassified 1413
305 Ga0307516_10009774 3300031730 Bacteria 10642
306 Ga0307516_10016615 3300031730 Bacteria 7691
307 Ga0307516_10344351 3300031730 Bacteria 1157
308 Ga0307414_10190335 3300032004 Bacteria 1659
309 Ga0307414_10260435 3300032004 Bacteria 1447
310 Ga0307414_10262350 3300032004 Bacteria 1442
311 Ga0307411_10127308 3300032005 Bacteria 1855
312 Ga0373926_0071191 3300035083 Bacteria 1278
313 Ga0373940_0006817 3300035088 Bacteria 2554
314 Ga0373923_0042153 3300035111 Unclassified 1884
315 Ga0373956_0023955 3300035119 Bacteria 2625
316 Ga0373924_0241608 3300035410 Unclassified 799
317 Ga0373931_0079270 3300035691 Unclassified 1809
318 Ga0373933_0136746 3300035724 Unclassified 1544
319 Ga0373937_0075606 3300036401 Bacteria 3110
320 Ga0373937_0197195 3300036401 Unclassified 1892
321 Ga0373937_0215550 3300036401 Bacteria 1807
322 Ga0395899_0099216 3300037312 Bacteria 2104
323 Ga0395900_0095982 3300037418 Bacteria 3046
324 Ga0395898_0005472 3300037466 Bacteria 13720
325 Ga0436364_0284869 3300037853 Bacteria 1233
326 Ga0436364_0540739 3300037853 Bacteria 1003
327 Ga0436364_0940060 3300037853 Bacteria 2245
328 Ga0395901_0009138 3300038443 Bacteria 10038
329 Ga0395901_0049255 3300038443 Bacteria 4377
330 Ga0436365_0219856 3300039437 Bacteria 1556
331 Ga0436365_1093582 3300039437 Bacteria 8078
332 Ga0436365_1372603 3300039437 Bacteria 2292
333 Ga0436360_0185446 3300039438 Bacteria 3060
334 Ga0436360_0697891 3300039438 Bacteria 1354
335 Ga0436363_0133426 3300039450 Bacteria 5530
336 Ga0453684_0015381 3300044712 Bacteria 12111
337 Ga0466959_0137735 3300045049 Bacteria 1727
338 Ga0451576_0000209 3300045051 Bacteria 147227
339 Ga0466967_0184763 3300045976 Bacteria 1968
340 Ga0495606_0250651 3300046507 Bacteria 982
341 Ga0495642_0022385 3300046528 Bacteria 2490
342 Ga0495654_0152437 3300046530 Bacteria 1021
343 Ga0495622_0005156 3300046557 Bacteria 6060
344 Ga0495622_0006284 3300046557 Bacteria 5516
345 Ga0495611_0186493 3300046648 Bacteria 968
346 Ga0495661_0113885 3300046665 Bacteria 1504
347 Ga0495657_0006296 3300046675 Bacteria 9298
348 Ga0495658_0061515 3300046683 Bacteria 2156
349 Ga0495670_0109414 3300046691 Bacteria 1429
350 Ga0495672_0151786 3300047320 Unclassified 1201
351 Ga0495675_0152288 3300047444 Bacteria 1428
352 Ga0495684_0034910 3300047471 Bacteria 3858
353 Ga0495602_0066681 3300048088 Unclassified 3100
354 Ga0496108_0008434 3300048911 Bacteria 8359
355 Ga0496111_0037367 3300048914 Bacteria 3475
356 Ga0496122_0203484 3300048925 Bacteria 1155
357 Ga0496125_0000217 3300048928 Bacteria 117498
358 Ga0496126_0097213 3300048929 Bacteria 2581
359 Ga0496126_0182783 3300048929 Bacteria 1780
360 Ga0495682_0033419 3300049460 Bacteria 1898
361 Ga0501031_0001115 3300049568 Bacteria 16394
362 Ga0501032_0001583 3300049569 Bacteria 18137
363 Ga0501032_0025446 3300049569 Bacteria 4080
364 Ga0501033_0003945 3300049570 Bacteria 12027
365 Ga0501033_0018570 3300049570 Bacteria 5255
366 Ga0501033_0038593 3300049570 Bacteria 3569
367 Ga0501033_0044543 3300049570 Bacteria 3303
368 Ga0501033_0078303 3300049570 Bacteria 2426
369 Ga0501033_0084225 3300049570 Bacteria 2330
370 Ga0501034_0001102 3300049571 Bacteria 37998
371 Ga0501034_0004847 3300049571 Bacteria 14856
372 Ga0501034_0094110 3300049571 Bacteria 2993
373 Ga0501034_0216059 3300049571 Bacteria 1871
374 Ga0501034_0224917 3300049571 Bacteria 1828
375 Ga0501036_0006677 3300049572 Bacteria 9377
376 Ga0501036_0212356 3300049572 Unclassified 1626
377 Ga0501037_0020887 3300049573 Bacteria 4834
378 Ga0501037_0056341 3300049573 Bacteria 2871
379 Ga0501037_0058329 3300049573 Bacteria 2817
380 Ga0501037_0216790 3300049573 Bacteria 1348
381 Ga0501038_0011078 3300049574 Bacteria 8234
382 Ga0501038_0028541 3300049574 Bacteria 4957
383 Ga0501038_0281856 3300049574 Bacteria 1308
384 Ga0501039_0002480 3300049575 Bacteria 13740
385 Ga0501042_0010670 3300049578 Bacteria 6173
386 Ga0501042_0023797 3300049578 Bacteria 4290
387 Ga0501043_0037752 3300049579 Bacteria 3799
388 Ga0501043_0073355 3300049579 Bacteria 2688
389 Ga0501046_0039490 3300049580 Bacteria 3779
390 Ga0501046_0048572 3300049580 Bacteria 3360
391 Ga0501047_0009499 3300049581 Bacteria 9190
392 Ga0501047_0049719 3300049581 Bacteria 4047
393 Ga0501047_0077962 3300049581 Bacteria 3186
394 Ga0501047_0184767 3300049581 Bacteria 1950
395 Ga0501067_0001187 3300049583 Bacteria 14142
396 Ga0501067_0011104 3300049583 Bacteria 4983
397 Ga0501070_0012654 3300049586 Bacteria 7115
398 Ga0501070_0023578 3300049586 Bacteria 5156
399 Ga0501070_0176077 3300049586 Bacteria 1761
400 Ga0501070_0205860 3300049586 Bacteria 1615
401 Ga0501073_0009949 3300049589 Bacteria 6996
402 Ga0501073_0053517 3300049589 Bacteria 2825
403 Ga0501074_0001610 3300049590 Bacteria 15287
404 Ga0501079_0006955 3300049741 Bacteria 8528
405 Ga0501079_0028285 3300049741 Bacteria 4301
406 Ga0501080_0007694 3300049742 Bacteria 9737
407 Ga0501080_0020002 3300049742 Bacteria 6196
408 Ga0501080_0043541 3300049742 Bacteria 4180
409 Ga0501080_0353149 3300049742 Bacteria 1327
410 Ga0501083_0028788 3300049744 Bacteria 3827
411 Ga0501083_0067576 3300049744 Bacteria 2379
412 Ga0501035_0013193 3300049822 Bacteria 7627
413 Ga0501035_0013598 3300049822 Bacteria 7509
414 Ga0501035_0021943 3300049822 Bacteria 5866
415 Ga0501035_0025262 3300049822 Bacteria 5446
416 Ga0501035_0136818 3300049822 Bacteria 2132
417 Ga0501044_0008949 3300049823 Bacteria 10943
418 Ga0501044_0016248 3300049823 Bacteria 7999
419 Ga0501044_0030317 3300049823 Bacteria 5702
420 Ga0501044_0037395 3300049823 Bacteria 5074
421 Ga0501044_0045074 3300049823 Bacteria 4573
422 Ga0501044_0137887 3300049823 Bacteria 2429
423 Ga0501044_0148269 3300049823 Bacteria 2329
424 Ga0501045_0057130 3300049824 Bacteria 2855
425 Ga0500643_000014 3300053087 Bacteria 318249
426 Ga0500593_081434 3300053117 Bacteria 1387
427 Ga0500595_000522 3300053119 Bacteria 23191
428 Ga0500595_001419 3300053119 Bacteria 12865
429 Ga0500595_019831 3300053119 Bacteria 2433
430 Ga0500559_0147812 3300053136 Bacteria 1102
431 Ga0500573_0000004 3300053140 Bacteria 341236
432 Ga0500604_0001151 3300053151 Bacteria 7350
433 Ga0500624_003576 3300053157 Bacteria 2035
434 Ga0500634_0000212 3300053161 Bacteria 18816
435 Ga0500637_0023041 3300053178 Bacteria 3399
436 Ga0501084_0022425 3300054114 Bacteria 5269
437 Ga0501084_0030089 3300054114 Bacteria 4541
438 Ga0587111_0001483 3300060346 Bacteria 2835
439 Ga0501082_0011874 3300060353 Bacteria 7485
440 Ga0501082_0012021 3300060353 Bacteria 7444
441 Ga0501082_0078959 3300060353 Bacteria 2839
442 Ga0501082_0086407 3300060353 Bacteria 2705

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0015381 Ga0453684_0015381_2384_3178 201
2 3300045049 Ga0466959_0137735 Ga0466959_0137735_415_1221 212
3 3300025304 Ga0209257_1007643 Ga0209257_10076434 213
4 3300049572 Ga0501036_0212356 Ga0501036_0212356_460_1221 213
5 3300005545 Ga0070695_100233287 Ga0070695_1002332872 214
6 3300005617 Ga0068859_100057770 Ga0068859_1000577702 214
7 3300005843 Ga0068860_100202656 Ga0068860_1002026562 214
8 3300006931 Ga0097620_100057772 Ga0097620_1000577725 214
9 3300049578 Ga0501042_0010670 Ga0501042_0010670_3925_4686 217
10 3300035410 Ga0373924_0241608 Ga0373924_0241608_76_777 222
11 3300025908 Ga0207643_10175676 Ga0207643_101756762 223
12 3300031251 Ga0265327_10000365 Ga0265327_1000036569 227
13 3300035083 Ga0373926_0071191 Ga0373926_0071191_41_856 228
14 3300031250 Ga0265331_10113102 Ga0265331_101131021 232
15 3300031344 Ga0265316_10354507 Ga0265316_103545072 232
16 3300031595 Ga0265313_10000660 Ga0265313_100006602 232
17 3300031711 Ga0265314_10059506 Ga0265314_100595063 232
18 3300053157 Ga0500624_003576 Ga0500624_003576_568_1401 232
19 3300053161 Ga0500634_0000212 Ga0500634_0000212_11753_12586 232
20 3300031730 Ga0307516_10344351 Ga0307516_103443512 233
21 3300005456 Ga0070678_100093622 Ga0070678_1000936222 235
22 3300005535 Ga0070684_100098543 Ga0070684_1000985432 235
23 3300005563 Ga0068855_100332287 Ga0068855_1003322872 235
24 3300005614 Ga0068856_100271852 Ga0068856_1002718522 235
25 3300025913 Ga0207695_10189392 Ga0207695_101893923 235
26 3300025914 Ga0207671_10225315 Ga0207671_102253151 235
27 3300025944 Ga0207661_10361063 Ga0207661_103610632 235
28 3300014968 Ga0157379_10429018 Ga0157379_104290182 236
29 3300025291 Ga0209675_1000873 Ga0209675_100087316 237
30 3300048911 Ga0496108_0008434 Ga0496108_0008434_6567_7385 237
31 3300005334 Ga0068869_100431899 Ga0068869_1004318991 238
32 3300035111 Ga0373923_0042153 Ga0373923_0042153_239_1048 238
33 3300035724 Ga0373933_0136746 Ga0373933_0136746_441_1250 238
34 3300046675 Ga0495657_0006296 Ga0495657_0006296_5407_6216 238
35 3300047444 Ga0495675_0152288 Ga0495675_0152288_313_1122 238
36 3300047471 Ga0495684_0034910 Ga0495684_0034910_2187_2996 238
37 3300048088 Ga0495602_0066681 Ga0495602_0066681_1280_2089 238
38 3300053117 Ga0500593_081434 Ga0500593_081434_94_909 238
39 3300005548 Ga0070665_100377787 Ga0070665_1003777872 239
40 3300029957 Ga0265324_10056615 Ga0265324_100566151 239
41 3300031239 Ga0265328_10036067 Ga0265328_100360674 239
42 3300031250 Ga0265331_10001093 Ga0265331_100010931 239
43 iso_pu_bacteria 2511231221 2512036551 239
44 iso_pu_bacteria 8054002106 8054008411 239
45 3300005328 Ga0070676_10156414 Ga0070676_101564142 240
46 3300005338 Ga0068868_100145697 Ga0068868_1001456972 240
47 3300005340 Ga0070689_100288386 Ga0070689_1002883861 240
48 3300005353 Ga0070669_100258740 Ga0070669_1002587401 240
49 3300005459 Ga0068867_100069625 Ga0068867_1000696251 240
50 3300009148 Ga0105243_10050578 Ga0105243_100505782 240
51 3300009176 Ga0105242_10004737 Ga0105242_100047379 240
52 3300009553 Ga0105249_10137287 Ga0105249_101372873 240
53 3300013308 Ga0157375_10364595 Ga0157375_103645953 240
54 3300025901 Ga0207688_10057611 Ga0207688_100576111 240
55 3300025907 Ga0207645_10115778 Ga0207645_101157781 240
56 3300025935 Ga0207709_10086528 Ga0207709_100865282 240
57 3300025942 Ga0207689_10043642 Ga0207689_100436423 240
58 3300026089 Ga0207648_10122728 Ga0207648_101227282 240
59 3300037853 Ga0436364_0284869 Ga0436364_0284869_340_1149 240
60 3300039450 Ga0436363_0133426 Ga0436363_0133426_1633_2442 240
61 3300048929 Ga0496126_0182783 Ga0496126_0182783_804_1613 240
62 iso_pu_bacteria 2897803580 2897805598 240
63 3300005842 Ga0068858_100059973 Ga0068858_1000599734 241
64 3300009098 Ga0105245_10036515 Ga0105245_100365152 241
65 3300009148 Ga0105243_10211188 Ga0105243_102111881 241
66 3300026023 Ga0207677_10281252 Ga0207677_102812522 241
67 3300035691 Ga0373931_0079270 Ga0373931_0079270_290_1105 241
68 3300036401 Ga0373937_0075606 Ga0373937_0075606_1300_2130 241
69 3300045051 Ga0451576_0000209 Ga0451576_0000209_134839_135672 241
70 3300053119 Ga0500595_001419 Ga0500595_001419_10279_11094 241
71 iso_pu_bacteria 2846952575 2846956070 241
72 iso_pu_bacteria 2848858292 2848861702 241
73 3300005334 Ga0068869_100035401 Ga0068869_1000354014 242
74 3300005335 Ga0070666_10059351 Ga0070666_100593511 242
75 3300005367 Ga0070667_100225017 Ga0070667_1002250173 242
76 3300005518 Ga0070699_100346877 Ga0070699_1003468772 242
77 3300005548 Ga0070665_100004584 Ga0070665_10000458414 242
78 3300005617 Ga0068859_100113930 Ga0068859_1001139302 242
79 3300005841 Ga0068863_100074099 Ga0068863_1000740995 242
80 3300005843 Ga0068860_100277251 Ga0068860_1002772511 242
81 3300006931 Ga0097620_100113925 Ga0097620_1001139255 242
82 3300009177 Ga0105248_10092485 Ga0105248_100924852 242
83 3300009545 Ga0105237_10143878 Ga0105237_101438783 242
84 3300009553 Ga0105249_10003440 Ga0105249_100034405 242
85 3300013297 Ga0157378_10017840 Ga0157378_100178405 242
86 3300014325 Ga0163163_10108259 Ga0163163_101082592 242
87 3300021384 Ga0213876_10055206 Ga0213876_100552062 242
88 3300021388 Ga0213875_10220188 Ga0213875_102201881 242
89 3300025941 Ga0207711_10079049 Ga0207711_100790495 242
90 3300025942 Ga0207689_10071371 Ga0207689_100713712 242
91 3300025961 Ga0207712_10066588 Ga0207712_100665883 242
92 3300025986 Ga0207658_10054660 Ga0207658_100546605 242
93 3300026035 Ga0207703_10136947 Ga0207703_101369472 242
94 3300026088 Ga0207641_10065592 Ga0207641_100655924 242
95 3300028379 Ga0268266_10004626 Ga0268266_1000462612 242
96 3300028573 Ga0265334_10001027 Ga0265334_100010277 242
97 3300028800 Ga0265338_10021187 Ga0265338_100211876 242
98 3300031711 Ga0265314_10131459 Ga0265314_101314592 242
99 3300032004 Ga0307414_10190335 Ga0307414_101903352 242
100 3300032004 Ga0307414_10260435 Ga0307414_102604352 242
101 3300032004 Ga0307414_10262350 Ga0307414_102623502 242
102 3300032005 Ga0307411_10127308 Ga0307411_101273082 242
103 3300037853 Ga0436364_0940060 Ga0436364_0940060_1390_2178 242
104 3300039437 Ga0436365_1093582 Ga0436365_1093582_2860_3684 242
105 3300049571 Ga0501034_0001102 Ga0501034_0001102_34852_35670 242
106 3300053151 Ga0500604_0001151 Ga0500604_0001151_5745_6563 242
107 iso_pu_bacteria 2643221580 2643912426 242
108 iso_pu_bacteria 2643221674 2644410746 242
109 iso_pu_bacteria 2842698319 2842700252 242
110 iso_pu_bacteria 2932401849 2932403485 242
111 3300003215 JGI25153J46596_10000552 JGI25153J46596_100005527 243
112 3300005336 Ga0070680_100002345 Ga0070680_1000023459 243
113 3300005458 Ga0070681_10000001 Ga0070681_10000001816 243
114 3300005530 Ga0070679_100000096 Ga0070679_10000009615 243
115 3300010375 Ga0105239_10021044 Ga0105239_100210443 243
116 3300025297 Ga0209758_1000036 Ga0209758_1000036209 243
117 3300025912 Ga0207707_10000001 Ga0207707_10000001496 243
118 3300025917 Ga0207660_10001894 Ga0207660_100018949 243
119 3300025921 Ga0207652_10000815 Ga0207652_1000081520 243
120 3300031344 Ga0265316_10271413 Ga0265316_102714132 243
121 3300049573 Ga0501037_0216790 Ga0501037_0216790_356_1144 243
122 3300060346 Ga0587111_0001483 Ga0587111_0001483_1692_2483 243
123 3300031238 Ga0265332_10099233 Ga0265332_100992331 244
124 3300053119 Ga0500595_000522 Ga0500595_000522_2451_3266 244
125 3300005530 Ga0070679_100430262 Ga0070679_1004302622 245
126 3300009177 Ga0105248_10000001 Ga0105248_10000001437 245
127 3300025912 Ga0207707_10378702 Ga0207707_103787022 245
128 3300025921 Ga0207652_10264969 Ga0207652_102649693 245
129 3300025941 Ga0207711_10000002 Ga0207711_100000021138 245
130 3300031247 Ga0265340_10001172 Ga0265340_100011723 245
131 3300048914 Ga0496111_0037367 Ga0496111_0037367_1994_2836 245
132 3300048925 Ga0496122_0203484 Ga0496122_0203484_235_1077 245
133 3300048928 Ga0496125_0000217 Ga0496125_0000217_51493_52335 245
134 iso_pu_bacteria 2522572158 2523102935 245
135 iso_pu_bacteria 2643221591 2643963219 245
136 3300005289 Ga0065704_10234698 Ga0065704_102346981 246
137 3300005616 Ga0068852_100246059 Ga0068852_1002460593 246
138 3300009174 Ga0105241_10073163 Ga0105241_100731633 246
139 3300028573 Ga0265334_10008058 Ga0265334_100080583 246
140 3300028800 Ga0265338_10000014 Ga0265338_10000014319 246
141 3300031241 Ga0265325_10000001 Ga0265325_1000000190 246
142 3300031249 Ga0265339_10000941 Ga0265339_1000094116 246
143 3300031595 Ga0265313_10009639 Ga0265313_100096392 246
144 3300031711 Ga0265314_10005627 Ga0265314_100056278 246
145 3300035088 Ga0373940_0006817 Ga0373940_0006817_193_1008 246
146 3300046528 Ga0495642_0022385 Ga0495642_0022385_228_1043 246
147 3300046557 Ga0495622_0005156 Ga0495622_0005156_3344_4159 246
148 3300046648 Ga0495611_0186493 Ga0495611_0186493_78_893 246
149 3300046683 Ga0495658_0061515 Ga0495658_0061515_123_938 246
150 3300049569 Ga0501032_0025446 Ga0501032_0025446_2947_3750 246
151 3300049571 Ga0501034_0094110 Ga0501034_0094110_621_1424 246
152 3300049581 Ga0501047_0077962 Ga0501047_0077962_757_1560 246
153 3300049581 Ga0501047_0184767 Ga0501047_0184767_1054_1848 246
154 3300049583 Ga0501067_0011104 Ga0501067_0011104_2196_2999 246
155 3300049586 Ga0501070_0012654 Ga0501070_0012654_3376_4179 246
156 3300049589 Ga0501073_0053517 Ga0501073_0053517_1729_2532 246
157 3300049741 Ga0501079_0028285 Ga0501079_0028285_1858_2661 246
158 3300049742 Ga0501080_0007694 Ga0501080_0007694_5574_6368 246
159 3300049742 Ga0501080_0043541 Ga0501080_0043541_1521_2324 246
160 3300049822 Ga0501035_0025262 Ga0501035_0025262_2860_3663 246
161 3300049823 Ga0501044_0148269 Ga0501044_0148269_1365_2168 246
162 3300053119 Ga0500595_019831 Ga0500595_019831_1254_2069 246
163 3300053178 Ga0500637_0023041 Ga0500637_0023041_519_1334 246
164 3300054114 Ga0501084_0022425 Ga0501084_0022425_2445_3248 246
165 3300060353 Ga0501082_0078959 Ga0501082_0078959_1593_2393 246
166 iso_pu_bacteria 2597490356 2599106272 246
167 3300005841 Ga0068863_100026142 Ga0068863_1000261425 247
168 3300026088 Ga0207641_10020165 Ga0207641_100201654 247
169 3300005616 Ga0068852_100015405 Ga0068852_1000154057 248
170 3300006358 Ga0068871_100112013 Ga0068871_1001120132 248
171 3300009093 Ga0105240_10000189 Ga0105240_1000018957 248
172 3300013297 Ga0157378_10039888 Ga0157378_100398882 248
173 3300025913 Ga0207695_10000003 Ga0207695_10000003484 248
174 3300025924 Ga0207694_10000011 Ga0207694_10000011277 248
175 3300025949 Ga0207667_10000093 Ga0207667_1000009395 248
176 3300026142 Ga0207698_10002935 Ga0207698_1000293512 248
177 3300036401 Ga0373937_0197195 Ga0373937_0197195_468_1295 248
178 3300049460 Ga0495682_0033419 Ga0495682_0033419_1045_1845 248
179 3300005344 Ga0070661_100000415 Ga0070661_10000041525 249
180 3300005530 Ga0070679_100006337 Ga0070679_1000063373 249
181 3300005548 Ga0070665_100042507 Ga0070665_1000425073 249
182 3300005985 Ga0081539_10003744 Ga0081539_100037446 249
183 3300006175 Ga0070712_100049256 Ga0070712_1000492562 249
184 3300009545 Ga0105237_10480194 Ga0105237_104801942 249
185 3300010375 Ga0105239_10007355 Ga0105239_100073555 249
186 3300013104 Ga0157370_10032355 Ga0157370_100323555 249
187 3300013105 Ga0157369_10054498 Ga0157369_100544984 249
188 3300025913 Ga0207695_10439860 Ga0207695_104398602 249
189 3300025914 Ga0207671_10278016 Ga0207671_102780161 249
190 3300025920 Ga0207649_10000448 Ga0207649_1000044813 249
191 3300025921 Ga0207652_10063640 Ga0207652_100636404 249
192 3300025928 Ga0207700_10078528 Ga0207700_100785285 249
193 3300026041 Ga0207639_10026761 Ga0207639_100267614 249
194 3300031730 Ga0307516_10009774 Ga0307516_1000977411 249
195 3300039438 Ga0436360_0185446 Ga0436360_0185446_1333_2163 249
196 3300049580 Ga0501046_0048572 Ga0501046_0048572_1751_2554 249
197 3300049586 Ga0501070_0176077 Ga0501070_0176077_493_1311 249
198 3300049744 Ga0501083_0028788 Ga0501083_0028788_2388_3206 249
199 3300053136 Ga0500559_0147812 Ga0500559_0147812_91_894 249
200 3300060353 Ga0501082_0011874 Ga0501082_0011874_3689_4507 249
201 3300021384 Ga0213876_10166735 Ga0213876_101667352 250
202 3300039437 Ga0436365_1372603 Ga0436365_1372603_169_996 250
203 3300049570 Ga0501033_0018570 Ga0501033_0018570_986_1780 250
204 3300049570 Ga0501033_0084225 Ga0501033_0084225_567_1361 250
205 3300049573 Ga0501037_0056341 Ga0501037_0056341_1177_1971 250
206 3300049574 Ga0501038_0028541 Ga0501038_0028541_103_897 250
207 3300049581 Ga0501047_0009499 Ga0501047_0009499_4537_5331 250
208 3300049822 Ga0501035_0013193 Ga0501035_0013193_5520_6314 250
209 3300049823 Ga0501044_0008949 Ga0501044_0008949_762_1556 250
210 3300049823 Ga0501044_0037395 Ga0501044_0037395_369_1163 250
211 3300005563 Ga0068855_100251188 Ga0068855_1002511882 251
212 3300005577 Ga0068857_100045453 Ga0068857_1000454532 251
213 3300005614 Ga0068856_100142061 Ga0068856_1001420611 251
214 3300009093 Ga0105240_10324358 Ga0105240_103243583 251
215 3300025913 Ga0207695_10126800 Ga0207695_101268001 251
216 3300025913 Ga0207695_10239190 Ga0207695_102391903 251
217 3300025949 Ga0207667_10265675 Ga0207667_102656752 251
218 3300031456 Ga0307513_10205817 Ga0307513_102058172 251
219 3300046507 Ga0495606_0250651 Ga0495606_0250651_13_822 251
220 3300046530 Ga0495654_0152437 Ga0495654_0152437_28_864 251
221 3300046557 Ga0495622_0006284 Ga0495622_0006284_4521_5330 251
222 3300049568 Ga0501031_0001115 Ga0501031_0001115_13403_14212 251
223 3300049569 Ga0501032_0001583 Ga0501032_0001583_34_843 251
224 3300049570 Ga0501033_0003945 Ga0501033_0003945_1630_2439 251
225 3300049571 Ga0501034_0004847 Ga0501034_0004847_1967_2776 251
226 3300049572 Ga0501036_0006677 Ga0501036_0006677_6737_7546 251
227 3300049573 Ga0501037_0020887 Ga0501037_0020887_2267_3076 251
228 3300049574 Ga0501038_0011078 Ga0501038_0011078_2023_2832 251
229 3300049575 Ga0501039_0002480 Ga0501039_0002480_2135_2944 251
230 3300049578 Ga0501042_0023797 Ga0501042_0023797_1635_2444 251
231 3300049579 Ga0501043_0073355 Ga0501043_0073355_1344_2153 251
232 3300049580 Ga0501046_0039490 Ga0501046_0039490_2073_2882 251
233 3300049581 Ga0501047_0049719 Ga0501047_0049719_1609_2418 251
234 3300049583 Ga0501067_0001187 Ga0501067_0001187_13232_14041 251
235 3300049586 Ga0501070_0205860 Ga0501070_0205860_536_1345 251
236 3300049589 Ga0501073_0009949 Ga0501073_0009949_2565_3374 251
237 3300049590 Ga0501074_0001610 Ga0501074_0001610_12337_13146 251
238 3300049741 Ga0501079_0006955 Ga0501079_0006955_1468_2277 251
239 3300049742 Ga0501080_0020002 Ga0501080_0020002_55_864 251
240 3300049824 Ga0501045_0057130 Ga0501045_0057130_1915_2724 251
241 3300054114 Ga0501084_0030089 Ga0501084_0030089_1757_2566 251
242 3300060353 Ga0501082_0012021 Ga0501082_0012021_4995_5804 251
243 3300005327 Ga0070658_10139089 Ga0070658_101390892 252
244 3300005335 Ga0070666_10004425 Ga0070666_100044252 252
245 3300005339 Ga0070660_100034520 Ga0070660_1000345205 252
246 3300005366 Ga0070659_100196990 Ga0070659_1001969902 252
247 3300005367 Ga0070667_100023261 Ga0070667_1000232613 252
248 3300005457 Ga0070662_100083826 Ga0070662_1000838264 252
249 3300005530 Ga0070679_100316072 Ga0070679_1003160722 252
250 3300005548 Ga0070665_100067189 Ga0070665_1000671891 252
251 3300005614 Ga0068856_100327470 Ga0068856_1003274702 252
252 3300006358 Ga0068871_100369142 Ga0068871_1003691421 252
253 3300009174 Ga0105241_10016603 Ga0105241_100166033 252
254 3300009545 Ga0105237_10344348 Ga0105237_103443481 252
255 3300009551 Ga0105238_10051825 Ga0105238_100518255 252
256 3300009551 Ga0105238_10234543 Ga0105238_102345431 252
257 3300010375 Ga0105239_10076188 Ga0105239_100761882 252
258 3300011119 Ga0105246_10016138 Ga0105246_100161383 252
259 3300013104 Ga0157370_10063278 Ga0157370_100632782 252
260 3300014325 Ga0163163_10039975 Ga0163163_100399752 252
261 3300025903 Ga0207680_10018406 Ga0207680_100184063 252
262 3300025911 Ga0207654_10115617 Ga0207654_101156172 252
263 3300025921 Ga0207652_10080918 Ga0207652_100809181 252
264 3300025933 Ga0207706_10134830 Ga0207706_101348301 252
265 3300025986 Ga0207658_10015559 Ga0207658_100155595 252
266 3300026023 Ga0207677_10372003 Ga0207677_103720031 252
267 3300028379 Ga0268266_10032159 Ga0268266_100321593 252
268 3300031711 Ga0265314_10067857 Ga0265314_100678571 252
269 3300045976 Ga0466967_0184763 Ga0466967_0184763_48_902 252
270 3300005327 Ga0070658_10363285 Ga0070658_103632851 253
271 3300005329 Ga0070683_100091758 Ga0070683_1000917582 253
272 3300005330 Ga0070690_100026903 Ga0070690_1000269032 253
273 3300005331 Ga0070670_100268896 Ga0070670_1002688961 253
274 3300005335 Ga0070666_10006985 Ga0070666_100069853 253
275 3300005338 Ga0068868_100019123 Ga0068868_1000191233 253
276 3300005344 Ga0070661_100237408 Ga0070661_1002374082 253
277 3300005354 Ga0070675_100290453 Ga0070675_1002904531 253
278 3300005365 Ga0070688_100014230 Ga0070688_1000142304 253
279 3300005367 Ga0070667_100008047 Ga0070667_1000080473 253
280 3300005456 Ga0070678_100024532 Ga0070678_1000245323 253
281 3300005456 Ga0070678_100268425 Ga0070678_1002684252 253
282 3300005459 Ga0068867_100004232 Ga0068867_1000042329 253
283 3300005535 Ga0070684_100195111 Ga0070684_1001951112 253
284 3300005539 Ga0068853_100060241 Ga0068853_1000602412 253
285 3300005547 Ga0070693_100168467 Ga0070693_1001684671 253
286 3300005548 Ga0070665_100092073 Ga0070665_1000920732 253
287 3300005548 Ga0070665_100207277 Ga0070665_1002072772 253
288 3300005564 Ga0070664_100317947 Ga0070664_1003179471 253
289 3300005616 Ga0068852_100118787 Ga0068852_1001187873 253
290 3300005834 Ga0068851_10084228 Ga0068851_100842281 253
291 3300005842 Ga0068858_100315325 Ga0068858_1003153252 253
292 3300005843 Ga0068860_100032511 Ga0068860_1000325112 253
293 3300005844 Ga0068862_100306383 Ga0068862_1003063832 253
294 3300006237 Ga0097621_100000693 Ga0097621_10000069325 253
295 3300006237 Ga0097621_100051066 Ga0097621_1000510663 253
296 3300006237 Ga0097621_100324351 Ga0097621_1003243511 253
297 3300006358 Ga0068871_100000385 Ga0068871_10000038531 253
298 3300006358 Ga0068871_100017481 Ga0068871_1000174814 253
299 3300006358 Ga0068871_100246354 Ga0068871_1002463542 253
300 3300006881 Ga0068865_100019735 Ga0068865_1000197355 253
301 3300006881 Ga0068865_100049141 Ga0068865_1000491414 253
302 3300009093 Ga0105240_10047424 Ga0105240_100474245 253
303 3300009093 Ga0105240_10064693 Ga0105240_100646934 253
304 3300009098 Ga0105245_10115751 Ga0105245_101157512 253
305 3300009098 Ga0105245_10188189 Ga0105245_101881892 253
306 3300009174 Ga0105241_10106541 Ga0105241_101065412 253
307 3300009176 Ga0105242_10002477 Ga0105242_1000247712 253
308 3300009176 Ga0105242_10064993 Ga0105242_100649932 253
309 3300009177 Ga0105248_10030640 Ga0105248_100306404 253
310 3300009545 Ga0105237_10087383 Ga0105237_100873834 253
311 3300009551 Ga0105238_10124164 Ga0105238_101241641 253
312 3300009551 Ga0105238_10181116 Ga0105238_101811164 253
313 3300009553 Ga0105249_10197808 Ga0105249_101978083 253
314 3300011119 Ga0105246_10004555 Ga0105246_100045554 253
315 3300013104 Ga0157370_10284578 Ga0157370_102845781 253
316 3300013105 Ga0157369_10239529 Ga0157369_102395292 253
317 3300013296 Ga0157374_10009118 Ga0157374_100091186 253
318 3300013296 Ga0157374_10055681 Ga0157374_100556813 253
319 3300013297 Ga0157378_10043102 Ga0157378_100431025 253
320 3300013297 Ga0157378_10107892 Ga0157378_101078922 253
321 3300013308 Ga0157375_10022429 Ga0157375_100224294 253
322 3300014325 Ga0163163_10000007 Ga0163163_10000007105 253
323 3300014325 Ga0163163_10135522 Ga0163163_101355222 253
324 3300014968 Ga0157379_10001375 Ga0157379_1000137518 253
325 3300014969 Ga0157376_10390137 Ga0157376_103901372 253
326 3300017792 Ga0163161_10003454 Ga0163161_100034543 253
327 3300025899 Ga0207642_10057097 Ga0207642_100570973 253
328 3300025903 Ga0207680_10063774 Ga0207680_100637741 253
329 3300025911 Ga0207654_10147452 Ga0207654_101474522 253
330 3300025913 Ga0207695_10061684 Ga0207695_100616842 253
331 3300025913 Ga0207695_10165009 Ga0207695_101650093 253
332 3300025920 Ga0207649_10166564 Ga0207649_101665641 253
333 3300025925 Ga0207650_10190956 Ga0207650_101909562 253
334 3300025927 Ga0207687_10098775 Ga0207687_100987752 253
335 3300025927 Ga0207687_10312316 Ga0207687_103123162 253
336 3300025931 Ga0207644_10210711 Ga0207644_102107111 253
337 3300025934 Ga0207686_10021121 Ga0207686_100211214 253
338 3300025941 Ga0207711_10270410 Ga0207711_102704103 253
339 3300025942 Ga0207689_10060613 Ga0207689_100606131 253
340 3300025945 Ga0207679_10214643 Ga0207679_102146433 253
341 3300025986 Ga0207658_10056216 Ga0207658_100562162 253
342 3300026023 Ga0207677_10019049 Ga0207677_100190491 253
343 3300026035 Ga0207703_10055490 Ga0207703_100554902 253
344 3300026041 Ga0207639_10251515 Ga0207639_102515153 253
345 3300026089 Ga0207648_10010697 Ga0207648_100106979 253
346 3300026095 Ga0207676_10070593 Ga0207676_100705932 253
347 3300026116 Ga0207674_10424121 Ga0207674_104241211 253
348 3300026118 Ga0207675_100182889 Ga0207675_1001828894 253
349 3300026121 Ga0207683_10012094 Ga0207683_100120943 253
350 3300026121 Ga0207683_10280156 Ga0207683_102801563 253
351 3300028379 Ga0268266_10382226 Ga0268266_103822262 253
352 3300028381 Ga0268264_10224027 Ga0268264_102240273 253
353 3300031730 Ga0307516_10016615 Ga0307516_100166154 253
354 3300037853 Ga0436364_0540739 Ga0436364_0540739_144_947 253
355 3300046665 Ga0495661_0113885 Ga0495661_0113885_91_918 253
356 3300046691 Ga0495670_0109414 Ga0495670_0109414_287_1114 253
357 3300053140 Ga0500573_0000004 Ga0500573_0000004_89723_90538 253
358 3300005327 Ga0070658_10193219 Ga0070658_101932192 254
359 3300005327 Ga0070658_10381820 Ga0070658_103818201 254
360 3300005339 Ga0070660_100246891 Ga0070660_1002468912 254
361 3300005539 Ga0068853_100082395 Ga0068853_1000823952 254
362 3300005563 Ga0068855_100201456 Ga0068855_1002014563 254
363 3300006358 Ga0068871_100187769 Ga0068871_1001877692 254
364 3300009093 Ga0105240_10022178 Ga0105240_100221786 254
365 3300009093 Ga0105240_10040506 Ga0105240_100405066 254
366 3300009093 Ga0105240_10200393 Ga0105240_102003933 254
367 3300009093 Ga0105240_10215857 Ga0105240_102158572 254
368 3300009093 Ga0105240_10300617 Ga0105240_103006173 254
369 3300009545 Ga0105237_10044071 Ga0105237_100440715 254
370 3300009545 Ga0105237_10200544 Ga0105237_102005441 254
371 3300009545 Ga0105237_10233619 Ga0105237_102336193 254
372 3300009551 Ga0105238_10060499 Ga0105238_100604993 254
373 3300009551 Ga0105238_10126559 Ga0105238_101265594 254
374 3300009551 Ga0105238_10180964 Ga0105238_101809642 254
375 3300009551 Ga0105238_10258623 Ga0105238_102586232 254
376 3300013104 Ga0157370_10043367 Ga0157370_100433673 254
377 3300013105 Ga0157369_10313354 Ga0157369_103133542 254
378 3300013307 Ga0157372_10296708 Ga0157372_102967082 254
379 3300025913 Ga0207695_10006268 Ga0207695_100062683 254
380 3300025913 Ga0207695_10033816 Ga0207695_100338162 254
381 3300025913 Ga0207695_10067671 Ga0207695_100676712 254
382 3300025914 Ga0207671_10010097 Ga0207671_100100972 254
383 3300025919 Ga0207657_10272903 Ga0207657_102729032 254
384 3300025924 Ga0207694_10155726 Ga0207694_101557262 254
385 3300025924 Ga0207694_10195233 Ga0207694_101952332 254
386 3300025949 Ga0207667_10052480 Ga0207667_100524802 254
387 3300025949 Ga0207667_10092004 Ga0207667_100920043 254
388 3300026116 Ga0207674_10105482 Ga0207674_101054823 254
389 3300026121 Ga0207683_10047613 Ga0207683_100476134 254
390 3300031238 Ga0265332_10165601 Ga0265332_101656011 254
391 3300031712 Ga0265342_10129748 Ga0265342_101297482 254
392 3300035119 Ga0373956_0023955 Ga0373956_0023955_344_1174 254
393 3300036401 Ga0373937_0215550 Ga0373937_0215550_817_1635 254
394 3300037312 Ga0395899_0099216 Ga0395899_0099216_1189_2007 254
395 3300037466 Ga0395898_0005472 Ga0395898_0005472_6945_7763 254
396 3300038443 Ga0395901_0049255 Ga0395901_0049255_1579_2397 254
397 3300049570 Ga0501033_0044543 Ga0501033_0044543_972_1790 254
398 3300049742 Ga0501080_0353149 Ga0501080_0353149_82_900 254
399 3300049822 Ga0501035_0013598 Ga0501035_0013598_5423_6241 254
400 3300049823 Ga0501044_0137887 Ga0501044_0137887_127_945 254
401 3300005327 Ga0070658_10002834 Ga0070658_100028343 255
402 3300005339 Ga0070660_100297879 Ga0070660_1002978792 255
403 3300005458 Ga0070681_10073488 Ga0070681_100734883 255
404 3300005458 Ga0070681_10391393 Ga0070681_103913932 255
405 3300005458 Ga0070681_10544775 Ga0070681_105447752 255
406 3300005530 Ga0070679_100070061 Ga0070679_1000700613 255
407 3300005530 Ga0070679_100589815 Ga0070679_1005898151 255
408 3300005539 Ga0068853_100170180 Ga0068853_1001701803 255
409 3300005548 Ga0070665_100002027 Ga0070665_10000202721 255
410 3300005844 Ga0068862_100093360 Ga0068862_1000933604 255
411 3300009093 Ga0105240_10376010 Ga0105240_103760102 255
412 3300009098 Ga0105245_10451638 Ga0105245_104516381 255
413 3300009551 Ga0105238_10262774 Ga0105238_102627742 255
414 3300013307 Ga0157372_10805973 Ga0157372_108059732 255
415 3300025261 Ga0209233_1004067 Ga0209233_10040672 255
416 3300025919 Ga0207657_10294758 Ga0207657_102947582 255
417 3300025921 Ga0207652_10011116 Ga0207652_100111166 255
418 3300025921 Ga0207652_10091036 Ga0207652_100910363 255
419 3300025927 Ga0207687_10568163 Ga0207687_105681631 255
420 3300026041 Ga0207639_10010896 Ga0207639_100108964 255
421 3300028379 Ga0268266_10004374 Ga0268266_100043743 255
422 3300028380 Ga0268265_10072493 Ga0268265_100724932 255
423 3300028800 Ga0265338_10003602 Ga0265338_1000360219 255
424 3300028800 Ga0265338_10142079 Ga0265338_101420792 255
425 3300031238 Ga0265332_10052915 Ga0265332_100529151 255
426 3300031242 Ga0265329_10045976 Ga0265329_100459762 255
427 3300031249 Ga0265339_10018579 Ga0265339_100185796 255
428 3300031250 Ga0265331_10065078 Ga0265331_100650782 255
429 3300031595 Ga0265313_10007050 Ga0265313_100070507 255
430 3300031711 Ga0265314_10038179 Ga0265314_100381795 255
431 3300037418 Ga0395900_0095982 Ga0395900_0095982_1338_2189 255
432 3300038443 Ga0395901_0009138 Ga0395901_0009138_8165_9016 255
433 3300039437 Ga0436365_0219856 Ga0436365_0219856_670_1485 255
434 3300047320 Ga0495672_0151786 Ga0495672_0151786_252_1106 255
435 3300048929 Ga0496126_0097213 Ga0496126_0097213_591_1412 255
436 3300049570 Ga0501033_0038593 Ga0501033_0038593_1302_2111 255
437 3300049570 Ga0501033_0078303 Ga0501033_0078303_1237_2076 255
438 3300049571 Ga0501034_0216059 Ga0501034_0216059_518_1351 255
439 3300049571 Ga0501034_0224917 Ga0501034_0224917_508_1329 255
440 3300049573 Ga0501037_0058329 Ga0501037_0058329_1534_2343 255
441 3300049574 Ga0501038_0281856 Ga0501038_0281856_338_1171 255
442 3300049579 Ga0501043_0037752 Ga0501043_0037752_1537_2364 255
443 3300049586 Ga0501070_0023578 Ga0501070_0023578_165_998 255
444 3300049744 Ga0501083_0067576 Ga0501083_0067576_337_1158 255
445 3300049822 Ga0501035_0021943 Ga0501035_0021943_262_1101 255
446 3300049822 Ga0501035_0136818 Ga0501035_0136818_92_919 255
447 3300049823 Ga0501044_0016248 Ga0501044_0016248_5886_6695 255
448 3300049823 Ga0501044_0030317 Ga0501044_0030317_3059_3886 255
449 3300049823 Ga0501044_0045074 Ga0501044_0045074_2222_3055 255
450 3300053087 Ga0500643_000014 Ga0500643_000014_184917_185771 255
451 3300060353 Ga0501082_0086407 Ga0501082_0086407_295_1116 255
452 3300003214 JGI25165J46597_1000425 JGI25165J46597_100042530 256
453 3300025261 Ga0209233_1000013 Ga0209233_1000013241 256
454 3300039438 Ga0436360_0697891 Ga0436360_0697891_495_1304 256

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00902

TatC

Sec-independent protein translocase protein (TatC)

32

250

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4htt-assembly2.cif.gz_B crystal structure of twin arginine translocase receptor- tatc in ddm 0.8091 22 231
4hts-assembly1.cif.gz_A crystal structure of twin arginine translocase receptor- tatc 0.7664 12 237
4htt-assembly2.cif.gz_B crystal structure of twin arginine translocase receptor- tatc in ddm 0.755 22 231
4hts-assembly1.cif.gz_A crystal structure of twin arginine translocase receptor- tatc 0.7541 12 237
4uiq-assembly2.cif.gz_A isolated globin domain of the bordetella pertussis globin-coupled sensor with a heme at the dimer interface 0.3654 83 233
ID Description Score Start End Superfamily
af_A4I3B9_9_100_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.5991 155 244 1.20.1280.290
af_A4I3B9_9_100_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.5737 155 244 1.20.1280.290
af_Q8C6U2_90_202_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.4775 123 243 1.20.1280.290
af_Q8C6U2_90_202_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.461 123 243 1.20.1280.290
af_P0AG90_434_612_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.46 66 238 1.20.1640.10
ID Description Score Start End GO Terms
AF-A0A530C768-F1-model_v4 Twin-arginine translocase subunit TatC 0.9551 54 254 GO:0009977
GO:0033281
GO:0043953
GO:0065002
AF-A0A090X5C8-F1-model_v4 Twin-arginine translocation protein TatC 0.954 145 243 GO:0009977
GO:0033281
GO:0043953
GO:0051920
GO:0065002
AF-A0A2M7GVC1-F1-model_v4 Twin-arginine translocase subunit TatC 0.9516 24 245 GO:0009977
GO:0033281
GO:0043953
GO:0065002
AF-A0A354TYP4-F1-model_v4 deleted 0.9471 30 250
AF-A0A526QDY1-F1-model_v4 Twin-arginine translocase subunit TatC 0.9469 54 229 GO:0009977
GO:0033281
GO:0043953
GO:0065002

Feature Viewer

pLDDT pTM Quality
71.17 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map