F447436

General Info

Members Datasets Scaffolds Average Seq Length
454 267 904 255

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0084750|Ga0495638_0084750_376_1272
Length 298
Sequence VSIRDVGGDGPGATNGGRQRQVKADRRGQALEIMEEEVQVTYDFSGKSVLLIGGTTGIGRATAIAFAKAGANLYVAGMGREHGESLKDEIRQTTGVEIEFEEVDVRDSAAMKSLHDNAFSRFGRIDVAFNNAGVPGKTAPVQDLDDDDYNLLMDVNLRGIFLGLRHQVPHMIAKGGGAIVNTSSLFGVMGFATTAVYCASKWAVLGLTNSVALEVARKNIRVNAIAPGSVMTPLLKGMFGSEQSARDTVLPMIPMGRISDPSEIAQLVLFLSSDAASFITGQGIVIDGGGFVAGADSL

Samples

Sample ID Description Type Environment
1 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
57 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
58 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
59 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
87 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
88 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
89 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
90 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
91 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
92 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
93 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
103 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
104 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
105 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
106 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
107 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
108 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
109 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
110 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
111 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
112 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
113 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
114 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
116 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
117 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
127 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
128 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
129 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
130 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
131 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
132 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
135 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
138 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
139 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
142 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
143 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
144 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
149 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
150 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
151 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
152 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
153 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
154 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
155 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
156 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
157 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
158 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
159 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
160 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
163 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
164 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
165 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
166 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
167 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
179 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
180 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
181 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
182 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
183 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
184 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
197 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
198 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
203 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
211 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
212 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
213 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
214 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
215 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
216 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
217 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
218 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
219 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
220 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
221 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
222 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
223 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
224 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
225 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
226 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
227 2508501039 Frankia saprophytica CN3 Isolate Nodule
228 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
229 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
230 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
231 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
232 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
233 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
234 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
235 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
236 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
237 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
238 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
239 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
240 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
241 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
242 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
243 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
244 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
245 2919395869 Microbacterium resistens 2980 Isolate Unclassified
246 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
247 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
248 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
249 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
250 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
251 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
252 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
253 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
254 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
255 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
256 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
257 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
258 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
259 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
260 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
261 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
262 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
263 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
264 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
265 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
266 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
267 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.22
Metatranscriptomes 0.44
Isolates 12.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.07
Nodule 10.13
Rhizoplane 3.74
Rhizosphere 70.26
Stem 0
Stem Tuber 0
Unclassified 0.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495638_0084750 3300046460 Bacteria 1917
2 JGI24740J21852_10014591 3300001979 Bacteria 2892
3 JGI25152J39213_1001658 3300002773 Bacteria 9262
4 JGI25153J46596_10000035 3300003215 Bacteria 189737
5 Ga0055531_10016798 3300003794 Bacteria 3132
6 Ga0070683_100095377 3300005329 Bacteria 2797
7 Ga0068868_100476326 3300005338 Bacteria 1090
8 Ga0070660_100330677 3300005339 Bacteria 1253
9 Ga0070668_100000388 3300005347 Bacteria 29132
10 Ga0070714_100301579 3300005435 Bacteria 1494
11 Ga0070713_100037154 3300005436 Bacteria 3936
12 Ga0070713_100060514 3300005436 Bacteria 3166
13 Ga0070713_100083728 3300005436 Bacteria 2727
14 Ga0070713_100158499 3300005436 Bacteria 2019
15 Ga0070681_10308005 3300005458 Bacteria 1493
16 Ga0070681_10801537 3300005458 Bacteria 859
17 Ga0070706_100010185 3300005467 Bacteria 8743
18 Ga0070706_100022960 3300005467 Bacteria 5745
19 Ga0070706_100033722 3300005467 Bacteria 4726
20 Ga0070707_100030967 3300005468 Bacteria 5095
21 Ga0070698_100051870 3300005471 Bacteria 4176
22 Ga0070698_100091716 3300005471 Bacteria 3020
23 Ga0070699_100152833 3300005518 Bacteria 2042
24 Ga0070679_100700389 3300005530 Bacteria 956
25 Ga0070684_100794236 3300005535 Bacteria 885
26 Ga0068853_100001825 3300005539 Bacteria 15664
27 Ga0068857_100890735 3300005577 Bacteria 853
28 Ga0068854_100208239 3300005578 Bacteria 1541
29 Ga0068859_100333651 3300005617 Bacteria 1611
30 Ga0068861_100204763 3300005719 Bacteria 1659
31 Ga0068858_100043761 3300005842 Bacteria 4151
32 Ga0068860_100123722 3300005843 Bacteria 2479
33 Ga0068862_100011471 3300005844 Bacteria 7315
34 Ga0068862_100044421 3300005844 Bacteria 3789
35 Ga0081540_1003877 3300005983 Bacteria 11666
36 Ga0081539_10004233 3300005985 Bacteria 16151
37 Ga0081539_10005519 3300005985 Bacteria 12837
38 Ga0070717_10263663 3300006028 Bacteria 1525
39 Ga0070717_10497391 3300006028 Bacteria 1102
40 Ga0075363_100024050 3300006048 Bacteria 3094
41 Ga0070712_100089426 3300006175 Bacteria 2252
42 Ga0097621_100126917 3300006237 Bacteria 2168
43 Ga0075370_10141706 3300006353 Bacteria 1405
44 Ga0068871_100173133 3300006358 Bacteria 1852
45 Ga0075430_100136828 3300006846 Bacteria 2041
46 Ga0075431_100488090 3300006847 Bacteria 1224
47 Ga0075433_10292344 3300006852 Unclassified 1443
48 Ga0075429_100285893 3300006880 Bacteria 1444
49 Ga0097620_100333673 3300006931 Bacteria 1611
50 Ga0105240_10029902 3300009093 Bacteria 7089
51 Ga0105240_10163701 3300009093 Bacteria 2640
52 Ga0105240_10656020 3300009093 Bacteria 1149
53 Ga0105245_10388675 3300009098 Bacteria 1391
54 Ga0114129_10931662 3300009147 Bacteria 1099
55 Ga0105241_10068158 3300009174 Bacteria 2756
56 Ga0105237_10009411 3300009545 Bacteria 10465
57 Ga0105237_10029028 3300009545 Bacteria 5627
58 Ga0105238_10009791 3300009551 Bacteria 9594
59 Ga0105238_10073330 3300009551 Bacteria 3418
60 Ga0105238_10444958 3300009551 Bacteria 1292
61 Ga0105249_10404833 3300009553 Bacteria 1395
62 Ga0105249_10578156 3300009553 Bacteria 1176
63 Ga0105239_10008311 3300010375 Bacteria 11830
64 Ga0105239_10053325 3300010375 Bacteria 4436
65 Ga0105239_10995489 3300010375 Bacteria 964
66 Ga0157369_10099270 3300013105 Bacteria 3104
67 Ga0157369_10121950 3300013105 Bacteria 2765
68 Ga0157369_10744091 3300013105 Bacteria 1009
69 Ga0157378_10284552 3300013297 Bacteria 1595
70 Ga0163162_10087512 3300013306 Bacteria 3194
71 Ga0163162_10905248 3300013306 Bacteria 995
72 Ga0157372_10244251 3300013307 Bacteria 2083
73 Ga0182008_10082451 3300014497 Unclassified 1583
74 Ga0182008_10290631 3300014497 Bacteria 853
75 Ga0163161_10265602 3300017792 Bacteria 1341
76 Ga0206356_10987069 3300020070 Bacteria 1026
77 Ga0206349_1065386 3300020075 Bacteria 901
78 Ga0213876_10083263 3300021384 Bacteria 1692
79 Ga0213876_10091917 3300021384 Bacteria 1607
80 Ga0213876_10224211 3300021384 Bacteria 999
81 Ga0213875_10000174 3300021388 Bacteria 67979
82 Ga0209758_1000028 3300025297 Bacteria 530102
83 Ga0209050_1004232 3300025298 Bacteria 9872
84 Ga0209257_1000688 3300025304 Bacteria 52564
85 Ga0207684_10006967 3300025910 Bacteria 10226
86 Ga0207684_10012990 3300025910 Bacteria 7210
87 Ga0207684_10079066 3300025910 Bacteria 2798
88 Ga0207695_10086453 3300025913 Bacteria 3162
89 Ga0207671_10009322 3300025914 Bacteria 8217
90 Ga0207693_10012600 3300025915 Bacteria 6830
91 Ga0207693_10163926 3300025915 Bacteria 1749
92 Ga0207646_10007717 3300025922 Bacteria 10891
93 Ga0207694_10007908 3300025924 Bacteria 8045
94 Ga0207687_10457101 3300025927 Bacteria 1060
95 Ga0207700_10063231 3300025928 Bacteria 2814
96 Ga0207700_10182055 3300025928 Bacteria 1760
97 Ga0207664_10111432 3300025929 Bacteria 2277
98 Ga0207664_10231809 3300025929 Bacteria 1605
99 Ga0207709_10029758 3300025935 Bacteria 3171
100 Ga0207665_10045988 3300025939 Bacteria 2924
101 Ga0207665_10237095 3300025939 Bacteria 1343
102 Ga0207689_10142588 3300025942 Bacteria 1974
103 Ga0207679_10288149 3300025945 Bacteria 1411
104 Ga0207668_10002047 3300025972 Bacteria 11764
105 Ga0207677_10196717 3300026023 Bacteria 1599
106 Ga0207677_10621733 3300026023 Bacteria 950
107 Ga0207703_10061893 3300026035 Bacteria 3065
108 Ga0207639_10011272 3300026041 Bacteria 6203
109 Ga0207639_10835715 3300026041 Bacteria 859
110 Ga0207641_10362022 3300026088 Bacteria 1385
111 Ga0207674_10455189 3300026116 Bacteria 1237
112 Ga0207675_100455867 3300026118 Bacteria 1268
113 Ga0207683_10093263 3300026121 Bacteria 2683
114 Ga0207698_10079145 3300026142 Bacteria 2643
115 Ga0207698_10391884 3300026142 Bacteria 1325
116 Ga0268266_10142897 3300028379 Bacteria 2149
117 Ga0268266_10159909 3300028379 Bacteria 2037
118 Ga0268266_10273792 3300028379 Bacteria 1568
119 Ga0268265_10210091 3300028380 Bacteria 1695
120 Ga0268264_10255038 3300028381 Bacteria 1631
121 Ga0307517_10055716 3300028786 Bacteria 3875
122 Ga0307515_10005570 3300028794 Bacteria 25473
123 Ga0307515_10008782 3300028794 Bacteria 19629
124 Ga0307515_10009482 3300028794 Bacteria 18813
125 Ga0307515_10038280 3300028794 Bacteria 7679
126 Ga0307515_10092909 3300028794 Bacteria 3748
127 Ga0307515_10095031 3300028794 Bacteria 3674
128 Ga0265338_10008500 3300028800 Bacteria 12451
129 Ga0307512_10003557 3300030522 Bacteria 17922
130 Ga0307512_10005418 3300030522 Bacteria 13324
131 Ga0307513_10011753 3300031456 Bacteria 10857
132 Ga0307513_10072152 3300031456 Bacteria 3600
133 Ga0307513_10388634 3300031456 Bacteria 1132
134 Ga0307509_10022358 3300031507 Bacteria 7131
135 Ga0307509_10427885 3300031507 Bacteria 1023
136 Ga0307508_10001056 3300031616 Bacteria 31836
137 Ga0307508_10002326 3300031616 Bacteria 20156
138 Ga0307508_10046984 3300031616 Bacteria 3853
139 Ga0307516_10032068 3300031730 Bacteria 5292
140 Ga0307516_10045179 3300031730 Bacteria 4352
141 Ga0307516_10209594 3300031730 Bacteria 1663
142 Ga0307405_10061564 3300031731 Bacteria 2373
143 Ga0307413_10004128 3300031824 Bacteria 6261
144 Ga0307413_10223740 3300031824 Bacteria 1376
145 Ga0307406_10109004 3300031901 Bacteria 1902
146 Ga0307407_10019923 3300031903 Bacteria 3424
147 Ga0307407_10021074 3300031903 Bacteria 3353
148 Ga0307412_10060883 3300031911 Bacteria 2535
149 Ga0307409_100007437 3300031995 Bacteria 6551
150 Ga0307409_100086727 3300031995 Bacteria 2549
151 Ga0307409_100167970 3300031995 Bacteria 1927
152 Ga0307416_100012521 3300032002 Bacteria 5718
153 Ga0307415_100012365 3300032126 Bacteria 4933
154 Ga0307415_100185093 3300032126 Bacteria 1638
155 Ga0307507_10000090 3300033179 Bacteria 142457
156 Ga0307507_10099093 3300033179 Bacteria 2450
157 Ga0307510_10037246 3300033180 Bacteria 5400
158 Ga0373940_0011793 3300035088 Bacteria 2083
159 Ga0373944_0001054 3300035089 Bacteria 6809
160 Ga0373944_0043919 3300035089 Bacteria 1390
161 Ga0373951_0000099 3300035091 Bacteria 33540
162 Ga0373936_0000093 3300035113 Bacteria 32187
163 Ga0373945_0000391 3300035116 Bacteria 12579
164 Ga0373943_0000007 3300035170 Bacteria 72018
165 Ga0373943_0089247 3300035170 Bacteria 1594
166 Ga0373946_0000003 3300035171 Bacteria 72620
167 Ga0373946_0166353 3300035171 Bacteria 1039
168 Ga0373955_0001751 3300035172 Bacteria 9322
169 Ga0373942_0000188 3300035207 Bacteria 15726
170 Ga0373924_0002501 3300035410 Bacteria 6184
171 Ga0373924_0156327 3300035410 Bacteria 999
172 Ga0373935_0000016 3300035692 Bacteria 71558
173 Ga0373935_0006994 3300035692 Bacteria 6736
174 Ga0373935_0055246 3300035692 Bacteria 2530
175 Ga0373935_0171069 3300035692 Bacteria 1486
176 Ga0373927_0000211 3300035695 Bacteria 46349
177 Ga0373927_0001365 3300035695 Bacteria 18376
178 Ga0373927_0069576 3300035695 Bacteria 2278
179 Ga0373927_0332207 3300035695 Bacteria 1001
180 Ga0373933_0008696 3300035724 Bacteria 5536
181 Ga0373933_0286933 3300035724 Bacteria 1064
182 Ga0373947_0000043 3300035725 Bacteria 62167
183 Ga0373947_0108628 3300035725 Bacteria 1750
184 Ga0373947_0175221 3300035725 Bacteria 1394
185 Ga0373937_0005277 3300036401 Bacteria 11038
186 Ga0373937_0030615 3300036401 Bacteria 4873
187 Ga0373937_0298748 3300036401 Bacteria 1522
188 Ga0373925_0002739 3300037068 Bacteria 13949
189 Ga0373925_0008327 3300037068 Bacteria 7549
190 Ga0373925_0030131 3300037068 Bacteria 3981
191 Ga0373925_0036379 3300037068 Bacteria 3633
192 Ga0373925_0130396 3300037068 Bacteria 1960
193 Ga0395899_0109269 3300037312 Bacteria 1990
194 Ga0395900_0013060 3300037418 Bacteria 8486
195 Ga0395900_0054083 3300037418 Bacteria 4133
196 Ga0395900_0459664 3300037418 Bacteria 1228
197 Ga0395905_0008367 3300037471 Bacteria 10202
198 Ga0395905_0020499 3300037471 Bacteria 6263
199 Ga0395905_0044426 3300037471 Bacteria 4170
200 Ga0395905_0316546 3300037471 Bacteria 1450
201 Ga0436364_0421763 3300037853 Bacteria 1460
202 Ga0436364_0606886 3300037853 Bacteria 3592
203 Ga0436364_0676163 3300037853 Bacteria 64006
204 Ga0436364_1089735 3300037853 Bacteria 3926
205 Ga0395901_0006447 3300038443 Bacteria 11889
206 Ga0436365_0054807 3300039437 Bacteria 14219
207 Ga0436365_1639617 3300039437 Bacteria 6743
208 Ga0436365_1746564 3300039437 Bacteria 2490
209 Ga0436360_0911620 3300039438 Bacteria 5027
210 Ga0436361_0196129 3300039447 Bacteria 1111
211 Ga0436361_0522489 3300039447 Bacteria 1680
212 Ga0451793_1613998 3300041452 Bacteria 2589
213 Ga0453683_0004016 3300044673 Bacteria 10616
214 Ga0466963_0212967 3300044694 Bacteria 1352
215 Ga0466970_0000220 3300044765 Bacteria 28133
216 Ga0466970_0099382 3300044765 Bacteria 1584
217 Ga0466957_0044376 3300044842 Bacteria 2694
218 Ga0451576_0002859 3300045051 Bacteria 24772
219 Ga0495627_000110 3300046453 Bacteria 101742
220 Ga0495592_0084392 3300046454 Bacteria 2292
221 Ga0495629_0024688 3300046459 Bacteria 4279
222 Ga0495641_0002568 3300046461 Bacteria 14265
223 Ga0495651_0026863 3300046462 Bacteria 4482
224 Ga0495653_0000217 3300046463 Bacteria 46686
225 Ga0495653_0203082 3300046463 Bacteria 1344
226 Ga0495582_0004403 3300046473 Bacteria 7926
227 Ga0495639_0007908 3300046475 Bacteria 4570
228 Ga0495662_0005583 3300046476 Bacteria 6293
229 Ga0495662_0039073 3300046476 Bacteria 2293
230 Ga0495664_0000109 3300046477 Bacteria 40957
231 Ga0495664_0140331 3300046477 Bacteria 1465
232 Ga0495618_0005434 3300046514 Bacteria 7768
233 Ga0495630_0016964 3300046517 Bacteria 5329
234 Ga0495630_0079591 3300046517 Bacteria 2472
235 Ga0495632_0032868 3300046519 Bacteria 2669
236 Ga0495652_0003454 3300046529 Bacteria 15588
237 Ga0495652_0100987 3300046529 Bacteria 2339
238 Ga0495665_0004301 3300046531 Bacteria 7696
239 Ga0495665_0083309 3300046531 Bacteria 1682
240 Ga0495640_0006888 3300046533 Bacteria 8955
241 Ga0495587_0023417 3300046536 Bacteria 3794
242 Ga0495645_0005111 3300046543 Bacteria 8992
243 Ga0495645_0133679 3300046543 Bacteria 1736
244 Ga0495667_0001838 3300046559 Bacteria 14083
245 Ga0495634_0004251 3300046642 Bacteria 11291
246 Ga0495625_0077202 3300046660 Bacteria 2328
247 Ga0495635_0000270 3300046663 Bacteria 33309
248 Ga0495657_0005065 3300046675 Bacteria 10467
249 Ga0495599_0007789 3300046678 Bacteria 6501
250 Ga0495599_0201584 3300046678 Bacteria 1222
251 Ga0495600_0249169 3300046809 Bacteria 1130
252 Ga0495581_0029078 3300047315 Bacteria 3204
253 Ga0495604_0128135 3300047317 Bacteria 1827
254 Ga0495674_0000088 3300047319 Bacteria 64974
255 Ga0495674_0000190 3300047319 Bacteria 49393
256 Ga0495676_0005958 3300047321 Bacteria 11197
257 Ga0495676_0257623 3300047321 Bacteria 1188
258 Ga0495680_0000584 3300047322 Bacteria 40933
259 Ga0495684_0000563 3300047471 Bacteria 30078
260 Ga0495684_0281224 3300047471 Bacteria 1200
261 Ga0495686_0001309 3300047472 Bacteria 27956
262 Ga0495593_0028886 3300047673 Bacteria 3044
263 Ga0495593_0128253 3300047673 Bacteria 1289
264 Ga0495602_0128046 3300048088 Bacteria 2030
265 Ga0496100_0255949 3300048903 Bacteria 1297
266 Ga0496101_0575411 3300048904 Bacteria 891
267 Ga0496102_0063085 3300048905 Bacteria 3393
268 Ga0496102_0167681 3300048905 Bacteria 2067
269 Ga0496102_0172885 3300048905 Bacteria 2034
270 Ga0496105_0061697 3300048908 Bacteria 3094
271 Ga0496108_0426805 3300048911 Bacteria 1158
272 Ga0496110_0548589 3300048913 Bacteria 1051
273 Ga0496112_0250884 3300048915 Bacteria 1721
274 Ga0496112_0253844 3300048915 Bacteria 1709
275 Ga0496113_0215640 3300048916 Bacteria 1529
276 Ga0496114_0015802 3300048917 Bacteria 6074
277 Ga0496114_0348333 3300048917 Bacteria 1310
278 Ga0496115_0013544 3300048918 Bacteria 6170
279 Ga0496115_0053900 3300048918 Bacteria 3229
280 Ga0496115_0516507 3300048918 Bacteria 958
281 Ga0496117_0255968 3300048920 Bacteria 952
282 Ga0496118_0057620 3300048921 Bacteria 2910
283 Ga0496120_0000435 3300048923 Bacteria 66035
284 Ga0496121_0165063 3300048924 Bacteria 1615
285 Ga0496124_0000094 3300048927 Bacteria 189147
286 Ga0496124_0013791 3300048927 Bacteria 7865
287 Ga0496124_0337728 3300048927 Bacteria 1071
288 Ga0496126_0075125 3300048929 Bacteria 3000
289 Ga0496126_0091186 3300048929 Bacteria 2680
290 Ga0496126_0363815 3300048929 Bacteria 1181
291 Ga0496126_0365178 3300048929 Unclassified 1178
292 Ga0501031_0079648 3300049568 Bacteria 2135
293 Ga0501031_0098381 3300049568 Bacteria 1909
294 Ga0501032_0001259 3300049569 Bacteria 20313
295 Ga0501032_0154403 3300049569 Bacteria 1508
296 Ga0501032_0260332 3300049569 Bacteria 1125
297 Ga0501033_0001735 3300049570 Bacteria 19066
298 Ga0501033_0014995 3300049570 Bacteria 5882
299 Ga0501033_0145122 3300049570 Bacteria 1714
300 Ga0501033_0526306 3300049570 Bacteria 816
301 Ga0501034_0010346 3300049571 Bacteria 9722
302 Ga0501034_0034906 3300049571 Bacteria 5100
303 Ga0501034_0073385 3300049571 Bacteria 3430
304 Ga0501034_0138154 3300049571 Bacteria 2417
305 Ga0501034_0189487 3300049571 Bacteria 2019
306 Ga0501034_0352098 3300049571 Bacteria 1401
307 Ga0501036_0000466 3300049572 Bacteria 29017
308 Ga0501036_0067032 3300049572 Bacteria 3037
309 Ga0501036_0074448 3300049572 Bacteria 2872
310 Ga0501036_0147129 3300049572 Bacteria 1987
311 Ga0501037_0028848 3300049573 Bacteria 4100
312 Ga0501037_0073140 3300049573 Bacteria 2492
313 Ga0501038_0000545 3300049574 Bacteria 33068
314 Ga0501038_0058862 3300049574 Bacteria 3292
315 Ga0501038_0136243 3300049574 Bacteria 2011
316 Ga0501038_0292721 3300049574 Bacteria 1279
317 Ga0501039_0035237 3300049575 Bacteria 3861
318 Ga0501039_0091413 3300049575 Bacteria 2372
319 Ga0501039_0173629 3300049575 Bacteria 1695
320 Ga0501043_0003126 3300049579 Bacteria 13728
321 Ga0501043_0064279 3300049579 Bacteria 2881
322 Ga0501043_0097960 3300049579 Bacteria 2305
323 Ga0501043_0221612 3300049579 Bacteria 1463
324 Ga0501046_0001833 3300049580 Bacteria 20268
325 Ga0501046_0076959 3300049580 Bacteria 2583
326 Ga0501046_0104698 3300049580 Bacteria 2168
327 Ga0501047_0007892 3300049581 Bacteria 10036
328 Ga0501047_0026802 3300049581 Bacteria 5547
329 Ga0501047_0034989 3300049581 Bacteria 4851
330 Ga0501047_0036304 3300049581 Bacteria 4763
331 Ga0501047_0064880 3300049581 Bacteria 3521
332 Ga0501047_0320841 3300049581 Bacteria 1389
333 Ga0501047_0535447 3300049581 Bacteria 996
334 Ga0501048_0008028 3300049582 Bacteria 7993
335 Ga0501048_0096356 3300049582 Bacteria 2087
336 Ga0501048_0251436 3300049582 Bacteria 1255
337 Ga0501067_0038310 3300049583 Bacteria 2662
338 Ga0501068_0008550 3300049584 Bacteria 5701
339 Ga0501068_0099906 3300049584 Bacteria 1798
340 Ga0501068_0170655 3300049584 Bacteria 1373
341 Ga0501069_0000761 3300049585 Bacteria 15059
342 Ga0501069_0161639 3300049585 Bacteria 1290
343 Ga0501070_0005191 3300049586 Bacteria 11094
344 Ga0501070_0065125 3300049586 Bacteria 3018
345 Ga0501070_0137685 3300049586 Bacteria 2016
346 Ga0501070_0140536 3300049586 Bacteria 1994
347 Ga0501070_0193940 3300049586 Bacteria 1669
348 Ga0501070_0296144 3300049586 Bacteria 1318
349 Ga0501073_0001189 3300049589 Bacteria 18989
350 Ga0501073_0044234 3300049589 Bacteria 3138
351 Ga0501073_0145792 3300049589 Bacteria 1640
352 Ga0501073_0380308 3300049589 Bacteria 975
353 Ga0501074_0006372 3300049590 Bacteria 8521
354 Ga0501075_0308997 3300049591 Bacteria 1205
355 Ga0501075_0416248 3300049591 Bacteria 1025
356 Ga0501079_0028962 3300049741 Bacteria 4251
357 Ga0501080_0000340 3300049742 Bacteria 35875
358 Ga0501080_0004640 3300049742 Bacteria 12251
359 Ga0501080_0163415 3300049742 Bacteria 2055
360 Ga0501080_0590713 3300049742 Bacteria 986
361 Ga0501083_0002041 3300049744 Bacteria 13908
362 Ga0501083_0087627 3300049744 Bacteria 2058
363 Ga0501035_0001722 3300049822 Bacteria 22095
364 Ga0501035_0120024 3300049822 Bacteria 2299
365 Ga0501035_0146160 3300049822 Bacteria 2053
366 Ga0501044_0009277 3300049823 Bacteria 10740
367 Ga0501044_0012137 3300049823 Bacteria 9329
368 Ga0501044_0037282 3300049823 Bacteria 5082
369 Ga0501044_0077086 3300049823 Bacteria 3381
370 Ga0501044_0174180 3300049823 Bacteria 2121
371 Ga0501044_0401139 3300049823 Bacteria 1284
372 nmdc:mga0qj67_69065_c1 3300050509 Bacteria 2817
373 nmdc:mga06r32_259221_c1 3300050510 Bacteria 1726
374 nmdc:mga0a205_131892_c1 3300050515 Unclassified 2399
375 Ga0495601_0191601 3300053077 Bacteria 1336
376 Ga0495601_0300142 3300053077 Bacteria 1046
377 Ga0495619_0283948 3300053085 Bacteria 1147
378 Ga0500578_0277429 3300053086 Bacteria 1001
379 Ga0500651_0011465 3300053093 Bacteria 5346
380 Ga0500651_0077563 3300053093 Bacteria 2062
381 Ga0500651_0078160 3300053093 Bacteria 2053
382 Ga0500641_0094658 3300053096 Bacteria 1277
383 Ga0500650_0117072 3300053098 Bacteria 1243
384 Ga0500555_032206 3300053103 Bacteria 1482
385 Ga0500594_0008030 3300053118 Bacteria 2399
386 Ga0500658_0075129 3300053134 Bacteria 1434
387 Ga0500588_0006644 3300053146 Bacteria 2632
388 Ga0500600_0137457 3300053149 Bacteria 1235
389 Ga0500600_0174232 3300053149 Bacteria 1042
390 Ga0500604_0000685 3300053151 Bacteria 9276
391 Ga0500627_0100849 3300053158 Bacteria 1296
392 Ga0500609_012381 3300053731 Bacteria 1153
393 Ga0501084_0022182 3300054114 Bacteria 5298
394 Ga0501084_0037692 3300054114 Bacteria 4040
395 Ga0501082_0008225 3300060353 Bacteria 8996
396 Ga0501082_0008443 3300060353 Bacteria 8883
397 2508670851 2508501039 Bacteria 9978592
398 2509373136 2509276018 Bacteria 6910194
399 2509373140 2509276018 Bacteria 6910194
400 2510316311 2510065059 Bacteria 6847884
401 2510316315 2510065059 Bacteria 6847884
402 2676204641 2675902999 Bacteria 9438463
403 2753264668 2751185782 Bacteria 11227053
404 2774849216 2773857921 Bacteria 9435764
405 2858903826 2858902515 Bacteria 7086037
406 2867507770 2867507094 Bacteria 6506033
407 2869163025 2869162929 Bacteria 6399702
408 2869253825 2869249662 Bacteria 6868783
409 2869253829 2869249662 Bacteria 6868783
410 2869269290 2869264136 Bacteria 6880765
411 2869269294 2869264136 Bacteria 6880765
412 2871462885 2871459585 Bacteria 6866887
413 2871462889 2871459585 Bacteria 6866887
414 2874131987 2874131515 Bacteria 6820270
415 2874136224 2874131515 Bacteria 6820270
416 2876378272 2876377896 Bacteria 6565995
417 2889018342 2889016732 Bacteria 6700763
418 2906365163 2906363423 Bacteria 6856682
419 2906365167 2906363423 Bacteria 6856682
420 2906375514 2906370794 Bacteria 6881062
421 2906376889 2906370794 Bacteria 6881062
422 2906395524 2906393657 Bacteria 6790866
423 2906395528 2906393657 Bacteria 6790866
424 2919397846 2919395869 Bacteria 3704152
425 2922189194 2922185730 Bacteria 7113964
426 2937873368 2937868953 Bacteria 6639878
427 2938017436 2938014810 Bacteria 6700592
428 2946033354 2946033335 Bacteria 3835514
429 2958107438 2958100919 Bacteria 6800575
430 2958175808 2958172287 Bacteria 6716688
431 2965040965 2965040258 Bacteria 6855979
432 2965040969 2965040258 Bacteria 6855979
433 2965091865 2965089291 Bacteria 6866420
434 2965091869 2965089291 Bacteria 6866420
435 2965120130 2965119406 Bacteria 6956431
436 2977917310 2977915119 Bacteria 6829656
437 2977920835 2977915119 Bacteria 6829656
438 2977953892 2977950692 Bacteria 6893264
439 2977953896 2977950692 Bacteria 6893264
440 2977974337 2977971508 Bacteria 7472917
441 2979714741 2979710463 Bacteria 6785254
442 2979745582 2979742915 Bacteria 7301278
443 2995394321 2995392953 Bacteria 4539380
444 3004199129 3004195979 Bacteria 6776956
445 3004199133 3004195979 Bacteria 6776956
446 8003862639 8003856774 Bacteria 7675274
447 8003874949 8003870546 Bacteria 7396674
448 8004214472 8004212874 Bacteria 2861420
449 8004366670 8004361976 Bacteria 6858373
450 8004366674 8004361976 Bacteria 6858373
451 8018153701 8018150411 Bacteria 5549903
452 8055415983 8055412473 Bacteria 6257500
453 Ga0495638_0084750
454 JGI24740J21852_10014591
455 JGI25152J39213_1001658
456 JGI25153J46596_10000035
457 Ga0055531_10016798
458 Ga0070683_100095377
459 Ga0068868_100476326
460 Ga0070660_100330677
461 Ga0070668_100000388
462 Ga0070714_100301579
463 Ga0070713_100037154
464 Ga0070713_100060514
465 Ga0070713_100083728
466 Ga0070713_100158499
467 Ga0070681_10308005
468 Ga0070681_10801537
469 Ga0070706_100010185
470 Ga0070706_100022960
471 Ga0070706_100033722
472 Ga0070707_100030967
473 Ga0070698_100051870
474 Ga0070698_100091716
475 Ga0070699_100152833
476 Ga0070679_100700389
477 Ga0070684_100794236
478 Ga0068853_100001825
479 Ga0068857_100890735
480 Ga0068854_100208239
481 Ga0068859_100333651
482 Ga0068861_100204763
483 Ga0068858_100043761
484 Ga0068860_100123722
485 Ga0068862_100011471
486 Ga0068862_100044421
487 Ga0081540_1003877
488 Ga0081539_10004233
489 Ga0081539_10005519
490 Ga0070717_10263663
491 Ga0070717_10497391
492 Ga0075363_100024050
493 Ga0070712_100089426
494 Ga0097621_100126917
495 Ga0075370_10141706
496 Ga0068871_100173133
497 Ga0075430_100136828
498 Ga0075431_100488090
499 Ga0075433_10292344
500 Ga0075429_100285893
501 Ga0097620_100333673
502 Ga0105240_10029902
503 Ga0105240_10163701
504 Ga0105240_10656020
505 Ga0105245_10388675
506 Ga0114129_10931662
507 Ga0105241_10068158
508 Ga0105237_10009411
509 Ga0105237_10029028
510 Ga0105238_10009791
511 Ga0105238_10073330
512 Ga0105238_10444958
513 Ga0105249_10404833
514 Ga0105249_10578156
515 Ga0105239_10008311
516 Ga0105239_10053325
517 Ga0105239_10995489
518 Ga0157369_10099270
519 Ga0157369_10121950
520 Ga0157369_10744091
521 Ga0157378_10284552
522 Ga0163162_10087512
523 Ga0163162_10905248
524 Ga0157372_10244251
525 Ga0182008_10082451
526 Ga0182008_10290631
527 Ga0163161_10265602
528 Ga0206356_10987069
529 Ga0206349_1065386
530 Ga0213876_10083263
531 Ga0213876_10091917
532 Ga0213876_10224211
533 Ga0213875_10000174
534 Ga0209758_1000028
535 Ga0209050_1004232
536 Ga0209257_1000688
537 Ga0207684_10006967
538 Ga0207684_10012990
539 Ga0207684_10079066
540 Ga0207695_10086453
541 Ga0207671_10009322
542 Ga0207693_10012600
543 Ga0207693_10163926
544 Ga0207646_10007717
545 Ga0207694_10007908
546 Ga0207687_10457101
547 Ga0207700_10063231
548 Ga0207700_10182055
549 Ga0207664_10111432
550 Ga0207664_10231809
551 Ga0207709_10029758
552 Ga0207665_10045988
553 Ga0207665_10237095
554 Ga0207689_10142588
555 Ga0207679_10288149
556 Ga0207668_10002047
557 Ga0207677_10196717
558 Ga0207677_10621733
559 Ga0207703_10061893
560 Ga0207639_10011272
561 Ga0207639_10835715
562 Ga0207641_10362022
563 Ga0207674_10455189
564 Ga0207675_100455867
565 Ga0207683_10093263
566 Ga0207698_10079145
567 Ga0207698_10391884
568 Ga0268266_10142897
569 Ga0268266_10159909
570 Ga0268266_10273792
571 Ga0268265_10210091
572 Ga0268264_10255038
573 Ga0307517_10055716
574 Ga0307515_10005570
575 Ga0307515_10008782
576 Ga0307515_10009482
577 Ga0307515_10038280
578 Ga0307515_10092909
579 Ga0307515_10095031
580 Ga0265338_10008500
581 Ga0307512_10003557
582 Ga0307512_10005418
583 Ga0307513_10011753
584 Ga0307513_10072152
585 Ga0307513_10388634
586 Ga0307509_10022358
587 Ga0307509_10427885
588 Ga0307508_10001056
589 Ga0307508_10002326
590 Ga0307508_10046984
591 Ga0307516_10032068
592 Ga0307516_10045179
593 Ga0307516_10209594
594 Ga0307405_10061564
595 Ga0307413_10004128
596 Ga0307413_10223740
597 Ga0307406_10109004
598 Ga0307407_10019923
599 Ga0307407_10021074
600 Ga0307412_10060883
601 Ga0307409_100007437
602 Ga0307409_100086727
603 Ga0307409_100167970
604 Ga0307416_100012521
605 Ga0307415_100012365
606 Ga0307415_100185093
607 Ga0307507_10000090
608 Ga0307507_10099093
609 Ga0307510_10037246
610 Ga0373940_0011793
611 Ga0373944_0001054
612 Ga0373944_0043919
613 Ga0373951_0000099
614 Ga0373936_0000093
615 Ga0373945_0000391
616 Ga0373943_0000007
617 Ga0373943_0089247
618 Ga0373946_0000003
619 Ga0373946_0166353
620 Ga0373955_0001751
621 Ga0373942_0000188
622 Ga0373924_0002501
623 Ga0373924_0156327
624 Ga0373935_0000016
625 Ga0373935_0006994
626 Ga0373935_0055246
627 Ga0373935_0171069
628 Ga0373927_0000211
629 Ga0373927_0001365
630 Ga0373927_0069576
631 Ga0373927_0332207
632 Ga0373933_0008696
633 Ga0373933_0286933
634 Ga0373947_0000043
635 Ga0373947_0108628
636 Ga0373947_0175221
637 Ga0373937_0005277
638 Ga0373937_0030615
639 Ga0373937_0298748
640 Ga0373925_0002739
641 Ga0373925_0008327
642 Ga0373925_0030131
643 Ga0373925_0036379
644 Ga0373925_0130396
645 Ga0395899_0109269
646 Ga0395900_0013060
647 Ga0395900_0054083
648 Ga0395900_0459664
649 Ga0395905_0008367
650 Ga0395905_0020499
651 Ga0395905_0044426
652 Ga0395905_0316546
653 Ga0436364_0421763
654 Ga0436364_0606886
655 Ga0436364_0676163
656 Ga0436364_1089735
657 Ga0395901_0006447
658 Ga0436365_0054807
659 Ga0436365_1639617
660 Ga0436365_1746564
661 Ga0436360_0911620
662 Ga0436361_0196129
663 Ga0436361_0522489
664 Ga0451793_1613998
665 Ga0453683_0004016
666 Ga0466963_0212967
667 Ga0466970_0000220
668 Ga0466970_0099382
669 Ga0466957_0044376
670 Ga0451576_0002859
671 Ga0495627_000110
672 Ga0495592_0084392
673 Ga0495629_0024688
674 Ga0495641_0002568
675 Ga0495651_0026863
676 Ga0495653_0000217
677 Ga0495653_0203082
678 Ga0495582_0004403
679 Ga0495639_0007908
680 Ga0495662_0005583
681 Ga0495662_0039073
682 Ga0495664_0000109
683 Ga0495664_0140331
684 Ga0495618_0005434
685 Ga0495630_0016964
686 Ga0495630_0079591
687 Ga0495632_0032868
688 Ga0495652_0003454
689 Ga0495652_0100987
690 Ga0495665_0004301
691 Ga0495665_0083309
692 Ga0495640_0006888
693 Ga0495587_0023417
694 Ga0495645_0005111
695 Ga0495645_0133679
696 Ga0495667_0001838
697 Ga0495634_0004251
698 Ga0495625_0077202
699 Ga0495635_0000270
700 Ga0495657_0005065
701 Ga0495599_0007789
702 Ga0495599_0201584
703 Ga0495600_0249169
704 Ga0495581_0029078
705 Ga0495604_0128135
706 Ga0495674_0000088
707 Ga0495674_0000190
708 Ga0495676_0005958
709 Ga0495676_0257623
710 Ga0495680_0000584
711 Ga0495684_0000563
712 Ga0495684_0281224
713 Ga0495686_0001309
714 Ga0495593_0028886
715 Ga0495593_0128253
716 Ga0495602_0128046
717 Ga0496100_0255949
718 Ga0496101_0575411
719 Ga0496102_0063085
720 Ga0496102_0167681
721 Ga0496102_0172885
722 Ga0496105_0061697
723 Ga0496108_0426805
724 Ga0496110_0548589
725 Ga0496112_0250884
726 Ga0496112_0253844
727 Ga0496113_0215640
728 Ga0496114_0015802
729 Ga0496114_0348333
730 Ga0496115_0013544
731 Ga0496115_0053900
732 Ga0496115_0516507
733 Ga0496117_0255968
734 Ga0496118_0057620
735 Ga0496120_0000435
736 Ga0496121_0165063
737 Ga0496124_0000094
738 Ga0496124_0013791
739 Ga0496124_0337728
740 Ga0496126_0075125
741 Ga0496126_0091186
742 Ga0496126_0363815
743 Ga0496126_0365178
744 Ga0501031_0079648
745 Ga0501031_0098381
746 Ga0501032_0001259
747 Ga0501032_0154403
748 Ga0501032_0260332
749 Ga0501033_0001735
750 Ga0501033_0014995
751 Ga0501033_0145122
752 Ga0501033_0526306
753 Ga0501034_0010346
754 Ga0501034_0034906
755 Ga0501034_0073385
756 Ga0501034_0138154
757 Ga0501034_0189487
758 Ga0501034_0352098
759 Ga0501036_0000466
760 Ga0501036_0067032
761 Ga0501036_0074448
762 Ga0501036_0147129
763 Ga0501037_0028848
764 Ga0501037_0073140
765 Ga0501038_0000545
766 Ga0501038_0058862
767 Ga0501038_0136243
768 Ga0501038_0292721
769 Ga0501039_0035237
770 Ga0501039_0091413
771 Ga0501039_0173629
772 Ga0501043_0003126
773 Ga0501043_0064279
774 Ga0501043_0097960
775 Ga0501043_0221612
776 Ga0501046_0001833
777 Ga0501046_0076959
778 Ga0501046_0104698
779 Ga0501047_0007892
780 Ga0501047_0026802
781 Ga0501047_0034989
782 Ga0501047_0036304
783 Ga0501047_0064880
784 Ga0501047_0320841
785 Ga0501047_0535447
786 Ga0501048_0008028
787 Ga0501048_0096356
788 Ga0501048_0251436
789 Ga0501067_0038310
790 Ga0501068_0008550
791 Ga0501068_0099906
792 Ga0501068_0170655
793 Ga0501069_0000761
794 Ga0501069_0161639
795 Ga0501070_0005191
796 Ga0501070_0065125
797 Ga0501070_0137685
798 Ga0501070_0140536
799 Ga0501070_0193940
800 Ga0501070_0296144
801 Ga0501073_0001189
802 Ga0501073_0044234
803 Ga0501073_0145792
804 Ga0501073_0380308
805 Ga0501074_0006372
806 Ga0501075_0308997
807 Ga0501075_0416248
808 Ga0501079_0028962
809 Ga0501080_0000340
810 Ga0501080_0004640
811 Ga0501080_0163415
812 Ga0501080_0590713
813 Ga0501083_0002041
814 Ga0501083_0087627
815 Ga0501035_0001722
816 Ga0501035_0120024
817 Ga0501035_0146160
818 Ga0501044_0009277
819 Ga0501044_0012137
820 Ga0501044_0037282
821 Ga0501044_0077086
822 Ga0501044_0174180
823 Ga0501044_0401139
824 nmdc:mga0qj67_69065_c1
825 nmdc:mga06r32_259221_c1
826 nmdc:mga0a205_131892_c1
827 Ga0495601_0191601
828 Ga0495601_0300142
829 Ga0495619_0283948
830 Ga0500578_0277429
831 Ga0500651_0011465
832 Ga0500651_0077563
833 Ga0500651_0078160
834 Ga0500641_0094658
835 Ga0500650_0117072
836 Ga0500555_032206
837 Ga0500594_0008030
838 Ga0500658_0075129
839 Ga0500588_0006644
840 Ga0500600_0137457
841 Ga0500600_0174232
842 Ga0500604_0000685
843 Ga0500627_0100849
844 Ga0500609_012381
845 Ga0501084_0022182
846 Ga0501084_0037692
847 Ga0501082_0008225
848 Ga0501082_0008443
849 2508670851
850 2509373136
851 2509373140
852 2510316311
853 2510316315
854 2676204641
855 2753264668
856 2774849216
857 2858903826
858 2867507770
859 2869163025
860 2869253825
861 2869253829
862 2869269290
863 2869269294
864 2871462885
865 2871462889
866 2874131987
867 2874136224
868 2876378272
869 2889018342
870 2906365163
871 2906365167
872 2906375514
873 2906376889
874 2906395524
875 2906395528
876 2919397846
877 2922189194
878 2937873368
879 2938017436
880 2946033354
881 2958107438
882 2958175808
883 2965040965
884 2965040969
885 2965091865
886 2965091869
887 2965120130
888 2977917310
889 2977920835
890 2977953892
891 2977953896
892 2977974337
893 2979714741
894 2979745582
895 2995394321
896 3004199129
897 3004199133
898 8003862639
899 8003874949
900 8004214472
901 8004366670
902 8004366674
903 8018153701
904 8055415983

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

47

243

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

53

290

0.95

PF08659

KR

KR domain

47

228

0.86

PF23441

41

293

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ni5-assembly1.cif.gz_A crystal structure of a short chain dehydrogenase from brucella suis 0.9759 3 249
4ni5-assembly1.cif.gz_A crystal structure of a short chain dehydrogenase from brucella suis 0.9674 3 249
4ni5-assembly1.cif.gz_B crystal structure of a short chain dehydrogenase from brucella suis 0.9668 3 249
1uls-assembly1.cif.gz_C crystal structure of tt0140 from thermus thermophilus hb8 0.9661 3 249
1uzl-assembly1.cif.gz_A-2 maba from mycobacterium tuberculosis 0.9659 9 250
ID Description Score Start End Superfamily
4ni5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9759 3 249 3.40.50.720
af_A0A0P0X9U1_21_128_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9693 3 91 3.40.50.720
4ni5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9674 3 249 3.40.50.720
4wecC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9629 3 254 3.40.50.720
af_P9WGR9_1_247_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9627 4 245 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A838JNK8-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9917 2 179 GO:0016491
AF-A0A2S8M9C3-F1-model_v4 deleted 0.9917 3 163
AF-A0A4D4ML26-F1-model_v4 3-oxoacyl-ACP reductase 0.9915 4 193 GO:0016491
AF-A0A6J4N1L0-F1-model_v4 Short-chain dehydrogenase/reductase in hypothetical Actinobacterial gene cluster 0.9913 1 192 GO:0016491
AF-A0A7Y5NLW9-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9905 1 141 GO:0016491

Map