F447424

General Info

Members Datasets Scaffolds Average Seq Length
454 228 908 345

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_1386442|Ga0436364_1386442_33396_34601
Length 401
Sequence MTSSTGWGSARGVAARRVTALANEEASVTDQVSDRIRLTSLSHGAGCACKLPLSALDQLMATLGPGPDGGLAGAAGDLLVGAAEGDDAAVLRLDDDRALVLTTDFFTPIVDDARDWGRVAATNAMSDVYAMGGRPLIALNLTAWPGQTLPVELLADVLRGGAEAAAAAGCLVVGGHTIDDPEPKYGLAVVGMAHPDRLMTVDRARDGDLLVLTKPIGTGVIATAHKRGAAPDDVLAGAVAAMTTLNGPASEAALRAGVQAATDVTGFGLLGHLHRMLRASGVAAEVWADQVPLLPGAAGLAAAGFISGGTNANLSYLSDVTDVEPDTDPETAVLLFDAQTSGGLLLAVPPGQIDALGADLRGHGAEAALVGVVETGEPGRIAVRATTPASSAGESDGGAAR

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
90 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
145 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
146 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
147 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
148 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
149 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
156 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
157 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
158 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
159 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
160 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
161 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
162 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
163 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
164 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
165 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
166 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
167 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
168 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
193 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
194 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
195 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
196 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
197 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
198 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
199 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
200 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
201 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
202 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
203 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
206 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
210 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
211 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
212 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
213 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
216 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
217 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
221 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
224 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
225 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
226 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
227 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
228 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.3
Nodule 0
Rhizoplane 2.64
Rhizosphere 92.07
Stem 0
Stem Tuber 0
Unclassified 3.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_1386442 3300037853 Bacteria 37433
2 Ga0070683_100000802 3300005329 Bacteria 23249
3 Ga0070683_100010067 3300005329 Bacteria 8111
4 Ga0070683_100038991 3300005329 Bacteria 4358
5 Ga0070690_100164782 3300005330 Bacteria 1521
6 Ga0068869_100257701 3300005334 Bacteria 1395
7 Ga0070680_100005847 3300005336 Bacteria 9332
8 Ga0070680_100065566 3300005336 Bacteria 2976
9 Ga0070682_100037962 3300005337 Bacteria 2952
10 Ga0068868_100063103 3300005338 Bacteria 2939
11 Ga0070660_100022592 3300005339 Bacteria 4653
12 Ga0070692_10072233 3300005345 Bacteria 1841
13 Ga0070668_100025573 3300005347 Unclassified 4476
14 Ga0070675_100027515 3300005354 Unclassified 4569
15 Ga0070675_100279601 3300005354 Bacteria 1466
16 Ga0070673_100034707 3300005364 Bacteria 3819
17 Ga0070673_100049501 3300005364 Bacteria 3281
18 Ga0070659_100020741 3300005366 Bacteria 4996
19 Ga0070667_100067828 3300005367 Bacteria 3034
20 Ga0070703_10013378 3300005406 Bacteria 2330
21 Ga0070709_10000456 3300005434 Bacteria 24391
22 Ga0070714_100000591 3300005435 Bacteria 25994
23 Ga0070714_100000892 3300005435 Bacteria 21159
24 Ga0070714_100072916 3300005435 Bacteria 2974
25 Ga0070713_100000615 3300005436 Bacteria 22702
26 Ga0070710_10000162 3300005437 Bacteria 30904
27 Ga0070710_10026617 3300005437 Bacteria 3075
28 Ga0070701_10059670 3300005438 Bacteria 2007
29 Ga0070711_100000432 3300005439 Bacteria 21875
30 Ga0070705_100034986 3300005440 Bacteria 2812
31 Ga0070708_100000573 3300005445 Bacteria 27608
32 Ga0070708_100004222 3300005445 Bacteria 11280
33 Ga0070663_100008157 3300005455 Bacteria 6425
34 Ga0070678_100081269 3300005456 Bacteria 2456
35 Ga0070662_100008489 3300005457 Bacteria 6705
36 Ga0070662_100091396 3300005457 Unclassified 2286
37 Ga0070681_10043380 3300005458 Bacteria 4506
38 Ga0068867_100198567 3300005459 Bacteria 1604
39 Ga0070685_10011275 3300005466 Bacteria 4678
40 Ga0070685_10105970 3300005466 Bacteria 1724
41 Ga0070706_100109318 3300005467 Bacteria 2572
42 Ga0070707_100264358 3300005468 Bacteria 1673
43 Ga0070698_100000977 3300005471 Bacteria 31421
44 Ga0070698_100009349 3300005471 Bacteria 10511
45 Ga0070698_100127254 3300005471 Bacteria 2505
46 Ga0070699_100000847 3300005518 Bacteria 28330
47 Ga0070699_100118414 3300005518 Bacteria 2328
48 Ga0070679_100066622 3300005530 Bacteria 3589
49 Ga0070679_100091754 3300005530 Bacteria 3025
50 Ga0070684_100012060 3300005535 Bacteria 6910
51 Ga0070684_100014781 3300005535 Bacteria 6333
52 Ga0070684_100097861 3300005535 Bacteria 2617
53 Ga0070697_100041144 3300005536 Bacteria 3739
54 Ga0068853_100035604 3300005539 Bacteria 4229
55 Ga0068853_100390843 3300005539 Bacteria 1300
56 Ga0070686_100030204 3300005544 Bacteria 3303
57 Ga0070686_100037499 3300005544 Bacteria 3007
58 Ga0070695_100061926 3300005545 Bacteria 2429
59 Ga0070696_100110457 3300005546 Bacteria 1979
60 Ga0070693_100015984 3300005547 Bacteria 3876
61 Ga0070665_100081894 3300005548 Bacteria 3233
62 Ga0070664_100059125 3300005564 Bacteria 3261
63 Ga0070664_100131873 3300005564 Bacteria 2195
64 Ga0068857_100078772 3300005577 Bacteria 2941
65 Ga0068857_100160377 3300005577 Bacteria 2041
66 Ga0068854_100066105 3300005578 Bacteria 2631
67 Ga0068852_100029214 3300005616 Bacteria 4526
68 Ga0068870_10072259 3300005840 Bacteria 1885
69 Ga0068863_100079088 3300005841 Bacteria 3114
70 Ga0068858_100182930 3300005842 Bacteria 1979
71 Ga0068860_100273754 3300005843 Bacteria 1648
72 Ga0081455_10042774 3300005937 Bacteria 3969
73 Ga0081538_10000209 3300005981 Bacteria 65166
74 Ga0081538_10002121 3300005981 Bacteria 19774
75 Ga0081538_10012785 3300005981 Bacteria 6704
76 Ga0081538_10014064 3300005981 Bacteria 6289
77 Ga0081538_10089688 3300005981 Bacteria 1595
78 Ga0081539_10001597 3300005985 Bacteria 37367
79 Ga0081539_10004615 3300005985 Bacteria 15015
80 Ga0081539_10047599 3300005985 Bacteria 2447
81 Ga0070717_10006558 3300006028 Bacteria 8573
82 Ga0070717_10014490 3300006028 Bacteria 6067
83 Ga0070717_10133952 3300006028 Bacteria 2133
84 Ga0075365_10000990 3300006038 Bacteria 12120
85 Ga0075365_10003498 3300006038 Bacteria 8112
86 Ga0075365_10014358 3300006038 Bacteria 4762
87 Ga0075365_10017398 3300006038 Bacteria 4397
88 Ga0075363_100002444 3300006048 Bacteria 7593
89 Ga0075364_10011173 3300006051 Bacteria 5449
90 Ga0075364_10022725 3300006051 Bacteria 3965
91 Ga0075432_10040647 3300006058 Bacteria 1623
92 Ga0070715_10010169 3300006163 Bacteria 3344
93 Ga0070716_100000099 3300006173 Bacteria 34121
94 Ga0070716_100095684 3300006173 Bacteria 1808
95 Ga0070712_100005243 3300006175 Bacteria 8018
96 Ga0070712_100010908 3300006175 Bacteria 5746
97 Ga0075367_10059732 3300006178 Bacteria 2271
98 Ga0097621_100033143 3300006237 Bacteria 4111
99 Ga0068871_100075187 3300006358 Bacteria 2788
100 Ga0075428_100036121 3300006844 Bacteria 5445
101 Ga0075428_100088509 3300006844 Bacteria 3377
102 Ga0075430_100000232 3300006846 Bacteria 38628
103 Ga0075430_100015043 3300006846 Bacteria 6586
104 Ga0075431_100000621 3300006847 Bacteria 29956
105 Ga0075431_100030379 3300006847 Bacteria 5565
106 Ga0075431_100039335 3300006847 Bacteria 4872
107 Ga0075431_100123936 3300006847 Bacteria 2666
108 Ga0075434_100158983 3300006871 Bacteria 2279
109 Ga0075429_100007400 3300006880 Bacteria 9529
110 Ga0068865_100094726 3300006881 Bacteria 2174
111 Ga0075436_100030994 3300006914 Bacteria 3679
112 Ga0111539_10014980 3300009094 Bacteria 9665
113 Ga0111539_10075171 3300009094 Bacteria 3980
114 Ga0105245_10108862 3300009098 Bacteria 2574
115 Ga0114129_10018212 3300009147 Bacteria 10000
116 Ga0114129_10059721 3300009147 Bacteria 5331
117 Ga0114129_10162365 3300009147 Bacteria 3051
118 Ga0105243_10006345 3300009148 Bacteria 9131
119 Ga0105243_10093013 3300009148 Bacteria 2487
120 Ga0105241_10178423 3300009174 Bacteria 1760
121 Ga0105242_10144729 3300009176 Bacteria 2066
122 Ga0105248_10004746 3300009177 Bacteria 15049
123 Ga0105248_10096092 3300009177 Unclassified 3337
124 Ga0105248_10231218 3300009177 Bacteria 2081
125 Ga0105249_10142948 3300009553 Bacteria 2296
126 Ga0105239_10500595 3300010375 Bacteria 1381
127 Ga0105246_10041754 3300011119 Bacteria 3102
128 Ga0157373_10078134 3300013100 Bacteria 2334
129 Ga0157370_10317879 3300013104 Bacteria 1436
130 Ga0157375_10014647 3300013308 Bacteria 7004
131 Ga0163163_10168131 3300014325 Bacteria 2239
132 Ga0163163_10238208 3300014325 Bacteria 1869
133 Ga0157377_10001709 3300014745 Bacteria 9587
134 Ga0163161_10025214 3300017792 Bacteria 4207
135 Ga0206353_10640176 3300020082 Bacteria 3258
136 Ga0213875_10000499 3300021388 Bacteria 32899
137 Ga0213875_10006099 3300021388 Bacteria 6374
138 Ga0213875_10023883 3300021388 Bacteria 2917
139 Ga0207653_10009072 3300025885 Bacteria 3103
140 Ga0207692_10001342 3300025898 Bacteria 9179
141 Ga0207688_10003851 3300025901 Bacteria 8184
142 Ga0207688_10045107 3300025901 Bacteria 2459
143 Ga0207680_10013883 3300025903 Bacteria 4151
144 Ga0207647_10127670 3300025904 Bacteria 1496
145 Ga0207699_10000148 3300025906 Bacteria 45232
146 Ga0207699_10025621 3300025906 Bacteria 3240
147 Ga0207643_10015717 3300025908 Bacteria 4123
148 Ga0207684_10115227 3300025910 Bacteria 2302
149 Ga0207707_10058467 3300025912 Bacteria 3355
150 Ga0207693_10002634 3300025915 Bacteria 15581
151 Ga0207693_10005191 3300025915 Bacteria 10904
152 Ga0207693_10054902 3300025915 Bacteria 3125
153 Ga0207663_10005615 3300025916 Bacteria 6335
154 Ga0207660_10014462 3300025917 Bacteria 5192
155 Ga0207660_10156569 3300025917 Bacteria 1754
156 Ga0207662_10062721 3300025918 Bacteria 2234
157 Ga0207657_10005347 3300025919 Bacteria 13449
158 Ga0207657_10045528 3300025919 Bacteria 3850
159 Ga0207652_10069187 3300025921 Bacteria 3064
160 Ga0207646_10036054 3300025922 Bacteria 4465
161 Ga0207646_10087293 3300025922 Bacteria 2791
162 Ga0207646_10112234 3300025922 Bacteria 2447
163 Ga0207659_10054775 3300025926 Bacteria 2849
164 Ga0207700_10000423 3300025928 Bacteria 24876
165 Ga0207700_10010295 3300025928 Bacteria 5890
166 Ga0207664_10000246 3300025929 Bacteria 40614
167 Ga0207664_10028519 3300025929 Bacteria 4243
168 Ga0207706_10006346 3300025933 Bacteria 10984
169 Ga0207706_10104383 3300025933 Bacteria 2493
170 Ga0207709_10003087 3300025935 Bacteria 10051
171 Ga0207665_10000253 3300025939 Bacteria 36881
172 Ga0207665_10031793 3300025939 Bacteria 3493
173 Ga0207691_10009641 3300025940 Bacteria 9263
174 Ga0207691_10099418 3300025940 Unclassified 2597
175 Ga0207691_10110152 3300025940 Bacteria 2449
176 Ga0207711_10163830 3300025941 Bacteria 2014
177 Ga0207689_10210127 3300025942 Bacteria 1608
178 Ga0207661_10001178 3300025944 Bacteria 17477
179 Ga0207661_10075657 3300025944 Bacteria 2763
180 Ga0207679_10094248 3300025945 Bacteria 2324
181 Ga0207679_10180742 3300025945 Bacteria 1745
182 Ga0207651_10136533 3300025960 Bacteria 1887
183 Ga0207668_10009234 3300025972 Bacteria 5901
184 Ga0207640_10042089 3300025981 Bacteria 2910
185 Ga0207640_10064425 3300025981 Bacteria 2440
186 Ga0207658_10378447 3300025986 Bacteria 1239
187 Ga0207639_10038033 3300026041 Bacteria 3577
188 Ga0207639_10126527 3300026041 Bacteria 2108
189 Ga0207678_10012358 3300026067 Bacteria 7495
190 Ga0207708_10053874 3300026075 Bacteria 3066
191 Ga0207702_10072675 3300026078 Bacteria 2965
192 Ga0207702_10114490 3300026078 Bacteria 2403
193 Ga0207648_10024487 3300026089 Bacteria 5387
194 Ga0207676_10160016 3300026095 Bacteria 1949
195 Ga0207674_10022827 3300026116 Bacteria 6713
196 Ga0207674_10121525 3300026116 Bacteria 2579
197 Ga0207675_100001740 3300026118 Bacteria 21802
198 Ga0207675_100034653 3300026118 Bacteria 4708
199 Ga0207675_100059835 3300026118 Bacteria 3556
200 Ga0207675_100133141 3300026118 Unclassified 2357
201 Ga0207683_10001821 3300026121 Bacteria 18851
202 Ga0207683_10079784 3300026121 Bacteria 2902
203 Ga0207428_10004641 3300027907 Bacteria 13019
204 Ga0207428_10058130 3300027907 Bacteria 3070
205 Ga0268266_10046675 3300028379 Bacteria 3709
206 Ga0268266_10234909 3300028379 Bacteria 1690
207 Ga0307408_100059077 3300031548 Bacteria 2790
208 Ga0307408_100088261 3300031548 Bacteria 2335
209 Ga0307408_100104871 3300031548 Bacteria 2160
210 Ga0307408_100111832 3300031548 Bacteria 2099
211 Ga0307405_10004100 3300031731 Bacteria 6847
212 Ga0307405_10004505 3300031731 Bacteria 6594
213 Ga0307405_10039048 3300031731 Bacteria 2866
214 Ga0307405_10064934 3300031731 Bacteria 2321
215 Ga0307413_10004708 3300031824 Bacteria 5986
216 Ga0307413_10024829 3300031824 Bacteria 3274
217 Ga0307413_10064581 3300031824 Bacteria 2275
218 Ga0307410_10013861 3300031852 Bacteria 4720
219 Ga0307410_10025009 3300031852 Unclassified 3739
220 Ga0307410_10028379 3300031852 Bacteria 3549
221 Ga0307410_10028952 3300031852 Bacteria 3520
222 Ga0307406_10008561 3300031901 Bacteria 5712
223 Ga0307406_10028552 3300031901 Unclassified 3372
224 Ga0307406_10057792 3300031901 Bacteria 2490
225 Ga0307406_10161623 3300031901 Bacteria 1610
226 Ga0307407_10002349 3300031903 Bacteria 7369
227 Ga0307407_10018937 3300031903 Unclassified 3495
228 Ga0307407_10022120 3300031903 Bacteria 3292
229 Ga0307407_10030732 3300031903 Bacteria 2901
230 Ga0307412_10022836 3300031911 Unclassified 3842
231 Ga0307412_10099499 3300031911 Bacteria 2053
232 Ga0307409_100013928 3300031995 Bacteria 5203
233 Ga0307409_100031690 3300031995 Unclassified 3820
234 Ga0307409_100054236 3300031995 Bacteria 3086
235 Ga0307409_100074625 3300031995 Bacteria 2711
236 Ga0307409_100247165 3300031995 Bacteria 1628
237 Ga0307416_100012035 3300032002 Bacteria 5806
238 Ga0307416_100038011 3300032002 Unclassified 3709
239 Ga0307416_100058267 3300032002 Bacteria 3130
240 Ga0307416_100118270 3300032002 Bacteria 2354
241 Ga0307414_10015256 3300032004 Bacteria 4635
242 Ga0307414_10020931 3300032004 Bacteria 4089
243 Ga0307414_10032972 3300032004 Bacteria 3417
244 Ga0307414_10065261 3300032004 Bacteria 2596
245 Ga0307414_10128090 3300032004 Bacteria 1965
246 Ga0307411_10003177 3300032005 Bacteria 7553
247 Ga0307411_10015898 3300032005 Unclassified 4243
248 Ga0307415_100002173 3300032126 Bacteria 9728
249 Ga0307415_100025382 3300032126 Bacteria 3717
250 Ga0373948_0008335 3300034817 Bacteria 1763
251 Ga0373932_0005655 3300035112 Bacteria 2940
252 Ga0373939_0050036 3300035114 Bacteria 1294
253 Ga0373941_0010920 3300035115 Bacteria 2335
254 Ga0373946_0007222 3300035171 Bacteria 4054
255 Ga0373961_0032537 3300035241 Bacteria 1463
256 Ga0373937_0035591 3300036401 Bacteria 4533
257 Ga0395900_0125563 3300037418 Bacteria 2632
258 Ga0395900_0134486 3300037418 Bacteria 2533
259 Ga0395900_0166603 3300037418 Bacteria 2245
260 Ga0395900_0387279 3300037418 Bacteria 1365
261 Ga0395898_0009759 3300037466 Bacteria 10058
262 Ga0395898_0072916 3300037466 Bacteria 3316
263 Ga0395898_0100887 3300037466 Bacteria 2772
264 Ga0395898_0113399 3300037466 Bacteria 2598
265 Ga0395905_0026076 3300037471 Bacteria 5511
266 Ga0436364_0074680 3300037853 Bacteria 16334
267 Ga0436364_0604968 3300037853 Bacteria 2519
268 Ga0436364_0771738 3300037853 Bacteria 63638
269 Ga0395901_0010606 3300038443 Bacteria 9334
270 Ga0395901_0045728 3300038443 Bacteria 4544
271 Ga0395901_0092819 3300038443 Bacteria 3160
272 Ga0395901_0346524 3300038443 Bacteria 1534
273 Ga0436365_0606046 3300039437 Bacteria 10970
274 Ga0436363_1596742 3300039450 Bacteria 2476
275 Ga0439451_002201 3300042009 Bacteria 3925
276 Ga0439463_006797 3300042016 Bacteria 2827
277 Ga0439444_0002617 3300042437 Bacteria 2477
278 Ga0439440_0003299 3300042993 Bacteria 3100
279 Ga0466969_0009750 3300044656 Bacteria 5090
280 Ga0466971_0012760 3300044719 Bacteria 3685
281 Ga0495664_0034826 3300046477 Bacteria 2963
282 Ga0495618_0110063 3300046514 Unclassified 1764
283 Ga0495587_0144747 3300046536 Bacteria 1355
284 Ga0495635_0156886 3300046663 Bacteria 1549
285 Ga0495680_0029783 3300047322 Bacteria 4467
286 Ga0495684_0097306 3300047471 Bacteria 2226
287 Ga0496105_0093164 3300048908 Bacteria 2487
288 Ga0496106_0251336 3300048909 Bacteria 1413
289 Ga0496107_0034629 3300048910 Bacteria 3617
290 Ga0496108_0125230 3300048911 Bacteria 2206
291 Ga0496110_0005252 3300048913 Bacteria 10135
292 Ga0496110_0514996 3300048913 Bacteria 1088
293 Ga0496111_0041863 3300048914 Bacteria 3288
294 Ga0496111_0065451 3300048914 Bacteria 2638
295 Ga0496112_0156278 3300048915 Bacteria 2247
296 Ga0496113_0093093 3300048916 Bacteria 2326
297 Ga0496113_0368615 3300048916 Bacteria 1152
298 Ga0496114_0266707 3300048917 Bacteria 1508
299 Ga0501031_0027749 3300049568 Bacteria 3691
300 Ga0501031_0055707 3300049568 Bacteria 2576
301 Ga0501031_0085029 3300049568 Bacteria 2062
302 Ga0501032_0035614 3300049569 Bacteria 3401
303 Ga0501033_0017435 3300049570 Bacteria 5425
304 Ga0501033_0054962 3300049570 Bacteria 2944
305 Ga0501033_0056793 3300049570 Bacteria 2893
306 Ga0501034_0139276 3300049571 Bacteria 2407
307 Ga0501036_0006872 3300049572 Bacteria 9248
308 Ga0501036_0063811 3300049572 Bacteria 3118
309 Ga0501036_0087049 3300049572 Bacteria 2640
310 Ga0501036_0188923 3300049572 Bacteria 1733
311 Ga0501036_0226370 3300049572 Bacteria 1569
312 Ga0501037_0008483 3300049573 Bacteria 7533
313 Ga0501037_0118120 3300049573 Bacteria 1908
314 Ga0501037_0132173 3300049573 Bacteria 1789
315 Ga0501038_0000803 3300049574 Bacteria 27838
316 Ga0501038_0023813 3300049574 Bacteria 5468
317 Ga0501038_0114230 3300049574 Bacteria 2233
318 Ga0501038_0217368 3300049574 Bacteria 1526
319 Ga0501038_0235102 3300049574 Bacteria 1457
320 Ga0501039_0001436 3300049575 Bacteria 17550
321 Ga0501039_0008946 3300049575 Bacteria 7629
322 Ga0501039_0039843 3300049575 Bacteria 3627
323 Ga0501039_0099699 3300049575 Bacteria 2267
324 Ga0501039_0124791 3300049575 Bacteria 2019
325 Ga0501040_0000742 3300049576 Bacteria 20215
326 Ga0501040_0012575 3300049576 Bacteria 5548
327 Ga0501040_0023470 3300049576 Bacteria 4137
328 Ga0501040_0093375 3300049576 Bacteria 2092
329 Ga0501040_0174690 3300049576 Bacteria 1522
330 Ga0501040_0331190 3300049576 Bacteria 1089
331 Ga0501041_0003226 3300049577 Bacteria 9374
332 Ga0501041_0005415 3300049577 Bacteria 7475
333 Ga0501041_0025312 3300049577 Bacteria 3566
334 Ga0501041_0071344 3300049577 Bacteria 2132
335 Ga0501042_0001721 3300049578 Bacteria 13080
336 Ga0501042_0002501 3300049578 Bacteria 11316
337 Ga0501042_0022588 3300049578 Bacteria 4395
338 Ga0501042_0026472 3300049578 Bacteria 4075
339 Ga0501042_0094796 3300049578 Bacteria 2143
340 Ga0501043_0020297 3300049579 Bacteria 5213
341 Ga0501043_0028383 3300049579 Bacteria 4392
342 Ga0501043_0038961 3300049579 Bacteria 3736
343 Ga0501043_0132855 3300049579 Bacteria 1950
344 Ga0501043_0135479 3300049579 Bacteria 1929
345 Ga0501046_0002860 3300049580 Bacteria 16053
346 Ga0501046_0005184 3300049580 Bacteria 11666
347 Ga0501046_0106969 3300049580 Bacteria 2140
348 Ga0501046_0192761 3300049580 Bacteria 1519
349 Ga0501046_0276183 3300049580 Bacteria 1231
350 Ga0501048_0001046 3300049582 Bacteria 20746
351 Ga0501048_0001470 3300049582 Bacteria 17866
352 Ga0501048_0022518 3300049582 Bacteria 4607
353 Ga0501048_0028116 3300049582 Bacteria 4083
354 Ga0501067_0112119 3300049583 Bacteria 1517
355 Ga0501068_0020774 3300049584 Bacteria 3831
356 Ga0501068_0022674 3300049584 Bacteria 3673
357 Ga0501068_0068982 3300049584 Bacteria 2155
358 Ga0501069_0042712 3300049585 Bacteria 2508
359 Ga0501070_0168042 3300049586 Bacteria 1807
360 Ga0501071_0000918 3300049587 Bacteria 15927
361 Ga0501071_0022824 3300049587 Bacteria 4365
362 Ga0501071_0040573 3300049587 Bacteria 3330
363 Ga0501071_0058657 3300049587 Bacteria 2783
364 Ga0501071_0070367 3300049587 Bacteria 2548
365 Ga0501072_0005380 3300049588 Bacteria 9746
366 Ga0501072_0014904 3300049588 Bacteria 5959
367 Ga0501072_0070335 3300049588 Bacteria 2763
368 Ga0501073_0080564 3300049589 Bacteria 2265
369 Ga0501074_0002279 3300049590 Bacteria 13350
370 Ga0501074_0006265 3300049590 Bacteria 8589
371 Ga0501074_0011214 3300049590 Bacteria 6511
372 Ga0501074_0013624 3300049590 Bacteria 5910
373 Ga0501074_0159201 3300049590 Bacteria 1612
374 Ga0501075_0001767 3300049591 Bacteria 14213
375 Ga0501075_0023408 3300049591 Bacteria 4522
376 Ga0501075_0024026 3300049591 Bacteria 4463
377 Ga0501075_0123775 3300049591 Bacteria 1968
378 Ga0501075_0139626 3300049591 Bacteria 1846
379 Ga0501076_0004615 3300049592 Bacteria 9809
380 Ga0501076_0005653 3300049592 Bacteria 9011
381 Ga0501076_0095373 3300049592 Bacteria 2396
382 Ga0501076_0115155 3300049592 Bacteria 2175
383 Ga0501076_0400681 3300049592 Bacteria 1128
384 Ga0501077_0000255 3300049593 Bacteria 31553
385 Ga0501077_0004086 3300049593 Bacteria 8808
386 Ga0501077_0018684 3300049593 Bacteria 4384
387 Ga0501077_0081211 3300049593 Bacteria 2053
388 Ga0501077_0104321 3300049593 Bacteria 1796
389 Ga0501077_0129728 3300049593 Bacteria 1598
390 Ga0501079_0000477 3300049741 Bacteria 26430
391 Ga0501079_0000527 3300049741 Bacteria 24910
392 Ga0501079_0020457 3300049741 Bacteria 5059
393 Ga0501079_0044780 3300049741 Bacteria 3415
394 Ga0501079_0224806 3300049741 Bacteria 1466
395 Ga0501080_0008484 3300049742 Bacteria 9313
396 Ga0501080_0024192 3300049742 Bacteria 5631
397 Ga0501080_0171080 3300049742 Bacteria 2003
398 Ga0501081_0004763 3300049743 Bacteria 8729
399 Ga0501081_0011699 3300049743 Bacteria 5744
400 Ga0501081_0019664 3300049743 Bacteria 4498
401 Ga0501081_0154249 3300049743 Bacteria 1651
402 Ga0501083_0074138 3300049744 Bacteria 2261
403 Ga0501035_0003305 3300049822 Bacteria 15453
404 Ga0501035_0170493 3300049822 Bacteria 1880
405 Ga0501044_0274478 3300049823 Bacteria 1621
406 Ga0501045_0000524 3300049824 Bacteria 23886
407 Ga0501045_0000847 3300049824 Bacteria 19857
408 Ga0501045_0006434 3300049824 Bacteria 8135
409 Ga0501045_0019053 3300049824 Bacteria 4887
410 Ga0501045_0092187 3300049824 Bacteria 2240
411 nmdc:mga03n38_26498_c1 3300050490 Bacteria 2394
412 nmdc:mga00v17_21628_c1 3300050491 Bacteria 3699
413 nmdc:mga00v17_53208_c1 3300050491 Bacteria 2467
414 nmdc:mga0yw44_26303_c1 3300050492 Bacteria 3322
415 nmdc:mga0yw44_2862_c1 3300050492 Bacteria 7497
416 nmdc:mga0yw44_33117_c1 3300050492 Bacteria 3017
417 nmdc:mga06z11_53989_c1 3300050494 Bacteria 1522
418 nmdc:mga05p37_30100_c1 3300050507 Bacteria 6624
419 nmdc:mga05p37_412883_c1 3300050507 Bacteria 1573
420 nmdc:mga05p37_44995_c1 3300050507 Bacteria 5431
421 nmdc:mga05p37_48765_c1 3300050507 Bacteria 3142
422 nmdc:mga09592_2137_c1 3300050508 Bacteria 15968
423 nmdc:mga0qj67_3898_c1 3300050509 Bacteria 10776
424 nmdc:mga0qj67_7897_c1 3300050509 Bacteria 7862
425 nmdc:mga06r32_114533_c1 3300050510 Bacteria 2655
426 nmdc:mga06r32_204289_c1 3300050510 Bacteria 1963
427 nmdc:mga06r32_33122_c1 3300050510 Bacteria 4866
428 nmdc:mga06r32_8062_c1 3300050510 Bacteria 9478
429 nmdc:mga08y16_18548_c1 3300050511 Bacteria 7332
430 nmdc:mga08y16_338519_c1 3300050511 Bacteria 1547
431 nmdc:mga0n895_146977_c1 3300050512 Bacteria 2387
432 nmdc:mga0rr50_29585_c1 3300050513 Bacteria 3866
433 nmdc:mga0rr50_34531_c1 3300050513 Bacteria 3622
434 nmdc:mga08x19_37567_c1 3300050514 Bacteria 3074
435 nmdc:mga08x19_69677_c1 3300050514 Bacteria 2291
436 nmdc:mga0a205_106475_c1 3300050515 Bacteria 2702
437 nmdc:mga0a205_2249_c1 3300050515 Bacteria 3051
438 Ga0495619_0011681 3300053085 Bacteria 5532
439 Ga0501084_0000999 3300054114 Bacteria 21975
440 Ga0501084_0002492 3300054114 Bacteria 14817
441 Ga0501084_0036917 3300054114 Bacteria 4082
442 Ga0501084_0044516 3300054114 Bacteria 3716
443 Ga0501084_0093639 3300054114 Bacteria 2522
444 Ga0501084_0149425 3300054114 Bacteria 1968
445 Ga0590071_001962 3300059421 Bacteria 5259
446 Ga0590074_002405 3300059423 Bacteria 3073
447 Ga0501082_0000968 3300060353 Bacteria 25394
448 Ga0501082_0013784 3300060353 Bacteria 6950
449 Ga0501082_0028625 3300060353 Bacteria 4799
450 Ga0501082_0032246 3300060353 Bacteria 4518
451 Ga0501082_0117977 3300060353 Bacteria 2298
452 Ga0530510_0000559 3300061734 Bacteria 23951
453 Ga0530510_0001347 3300061734 Bacteria 16431
454 Ga0530510_0017788 3300061734 Bacteria 5039
455 Ga0436364_1386442
456 Ga0070683_100000802
457 Ga0070683_100010067
458 Ga0070683_100038991
459 Ga0070690_100164782
460 Ga0068869_100257701
461 Ga0070680_100005847
462 Ga0070680_100065566
463 Ga0070682_100037962
464 Ga0068868_100063103
465 Ga0070660_100022592
466 Ga0070692_10072233
467 Ga0070668_100025573
468 Ga0070675_100027515
469 Ga0070675_100279601
470 Ga0070673_100034707
471 Ga0070673_100049501
472 Ga0070659_100020741
473 Ga0070667_100067828
474 Ga0070703_10013378
475 Ga0070709_10000456
476 Ga0070714_100000591
477 Ga0070714_100000892
478 Ga0070714_100072916
479 Ga0070713_100000615
480 Ga0070710_10000162
481 Ga0070710_10026617
482 Ga0070701_10059670
483 Ga0070711_100000432
484 Ga0070705_100034986
485 Ga0070708_100000573
486 Ga0070708_100004222
487 Ga0070663_100008157
488 Ga0070678_100081269
489 Ga0070662_100008489
490 Ga0070662_100091396
491 Ga0070681_10043380
492 Ga0068867_100198567
493 Ga0070685_10011275
494 Ga0070685_10105970
495 Ga0070706_100109318
496 Ga0070707_100264358
497 Ga0070698_100000977
498 Ga0070698_100009349
499 Ga0070698_100127254
500 Ga0070699_100000847
501 Ga0070699_100118414
502 Ga0070679_100066622
503 Ga0070679_100091754
504 Ga0070684_100012060
505 Ga0070684_100014781
506 Ga0070684_100097861
507 Ga0070697_100041144
508 Ga0068853_100035604
509 Ga0068853_100390843
510 Ga0070686_100030204
511 Ga0070686_100037499
512 Ga0070695_100061926
513 Ga0070696_100110457
514 Ga0070693_100015984
515 Ga0070665_100081894
516 Ga0070664_100059125
517 Ga0070664_100131873
518 Ga0068857_100078772
519 Ga0068857_100160377
520 Ga0068854_100066105
521 Ga0068852_100029214
522 Ga0068870_10072259
523 Ga0068863_100079088
524 Ga0068858_100182930
525 Ga0068860_100273754
526 Ga0081455_10042774
527 Ga0081538_10000209
528 Ga0081538_10002121
529 Ga0081538_10012785
530 Ga0081538_10014064
531 Ga0081538_10089688
532 Ga0081539_10001597
533 Ga0081539_10004615
534 Ga0081539_10047599
535 Ga0070717_10006558
536 Ga0070717_10014490
537 Ga0070717_10133952
538 Ga0075365_10000990
539 Ga0075365_10003498
540 Ga0075365_10014358
541 Ga0075365_10017398
542 Ga0075363_100002444
543 Ga0075364_10011173
544 Ga0075364_10022725
545 Ga0075432_10040647
546 Ga0070715_10010169
547 Ga0070716_100000099
548 Ga0070716_100095684
549 Ga0070712_100005243
550 Ga0070712_100010908
551 Ga0075367_10059732
552 Ga0097621_100033143
553 Ga0068871_100075187
554 Ga0075428_100036121
555 Ga0075428_100088509
556 Ga0075430_100000232
557 Ga0075430_100015043
558 Ga0075431_100000621
559 Ga0075431_100030379
560 Ga0075431_100039335
561 Ga0075431_100123936
562 Ga0075434_100158983
563 Ga0075429_100007400
564 Ga0068865_100094726
565 Ga0075436_100030994
566 Ga0111539_10014980
567 Ga0111539_10075171
568 Ga0105245_10108862
569 Ga0114129_10018212
570 Ga0114129_10059721
571 Ga0114129_10162365
572 Ga0105243_10006345
573 Ga0105243_10093013
574 Ga0105241_10178423
575 Ga0105242_10144729
576 Ga0105248_10004746
577 Ga0105248_10096092
578 Ga0105248_10231218
579 Ga0105249_10142948
580 Ga0105239_10500595
581 Ga0105246_10041754
582 Ga0157373_10078134
583 Ga0157370_10317879
584 Ga0157375_10014647
585 Ga0163163_10168131
586 Ga0163163_10238208
587 Ga0157377_10001709
588 Ga0163161_10025214
589 Ga0206353_10640176
590 Ga0213875_10000499
591 Ga0213875_10006099
592 Ga0213875_10023883
593 Ga0207653_10009072
594 Ga0207692_10001342
595 Ga0207688_10003851
596 Ga0207688_10045107
597 Ga0207680_10013883
598 Ga0207647_10127670
599 Ga0207699_10000148
600 Ga0207699_10025621
601 Ga0207643_10015717
602 Ga0207684_10115227
603 Ga0207707_10058467
604 Ga0207693_10002634
605 Ga0207693_10005191
606 Ga0207693_10054902
607 Ga0207663_10005615
608 Ga0207660_10014462
609 Ga0207660_10156569
610 Ga0207662_10062721
611 Ga0207657_10005347
612 Ga0207657_10045528
613 Ga0207652_10069187
614 Ga0207646_10036054
615 Ga0207646_10087293
616 Ga0207646_10112234
617 Ga0207659_10054775
618 Ga0207700_10000423
619 Ga0207700_10010295
620 Ga0207664_10000246
621 Ga0207664_10028519
622 Ga0207706_10006346
623 Ga0207706_10104383
624 Ga0207709_10003087
625 Ga0207665_10000253
626 Ga0207665_10031793
627 Ga0207691_10009641
628 Ga0207691_10099418
629 Ga0207691_10110152
630 Ga0207711_10163830
631 Ga0207689_10210127
632 Ga0207661_10001178
633 Ga0207661_10075657
634 Ga0207679_10094248
635 Ga0207679_10180742
636 Ga0207651_10136533
637 Ga0207668_10009234
638 Ga0207640_10042089
639 Ga0207640_10064425
640 Ga0207658_10378447
641 Ga0207639_10038033
642 Ga0207639_10126527
643 Ga0207678_10012358
644 Ga0207708_10053874
645 Ga0207702_10072675
646 Ga0207702_10114490
647 Ga0207648_10024487
648 Ga0207676_10160016
649 Ga0207674_10022827
650 Ga0207674_10121525
651 Ga0207675_100001740
652 Ga0207675_100034653
653 Ga0207675_100059835
654 Ga0207675_100133141
655 Ga0207683_10001821
656 Ga0207683_10079784
657 Ga0207428_10004641
658 Ga0207428_10058130
659 Ga0268266_10046675
660 Ga0268266_10234909
661 Ga0307408_100059077
662 Ga0307408_100088261
663 Ga0307408_100104871
664 Ga0307408_100111832
665 Ga0307405_10004100
666 Ga0307405_10004505
667 Ga0307405_10039048
668 Ga0307405_10064934
669 Ga0307413_10004708
670 Ga0307413_10024829
671 Ga0307413_10064581
672 Ga0307410_10013861
673 Ga0307410_10025009
674 Ga0307410_10028379
675 Ga0307410_10028952
676 Ga0307406_10008561
677 Ga0307406_10028552
678 Ga0307406_10057792
679 Ga0307406_10161623
680 Ga0307407_10002349
681 Ga0307407_10018937
682 Ga0307407_10022120
683 Ga0307407_10030732
684 Ga0307412_10022836
685 Ga0307412_10099499
686 Ga0307409_100013928
687 Ga0307409_100031690
688 Ga0307409_100054236
689 Ga0307409_100074625
690 Ga0307409_100247165
691 Ga0307416_100012035
692 Ga0307416_100038011
693 Ga0307416_100058267
694 Ga0307416_100118270
695 Ga0307414_10015256
696 Ga0307414_10020931
697 Ga0307414_10032972
698 Ga0307414_10065261
699 Ga0307414_10128090
700 Ga0307411_10003177
701 Ga0307411_10015898
702 Ga0307415_100002173
703 Ga0307415_100025382
704 Ga0373948_0008335
705 Ga0373932_0005655
706 Ga0373939_0050036
707 Ga0373941_0010920
708 Ga0373946_0007222
709 Ga0373961_0032537
710 Ga0373937_0035591
711 Ga0395900_0125563
712 Ga0395900_0134486
713 Ga0395900_0166603
714 Ga0395900_0387279
715 Ga0395898_0009759
716 Ga0395898_0072916
717 Ga0395898_0100887
718 Ga0395898_0113399
719 Ga0395905_0026076
720 Ga0436364_0074680
721 Ga0436364_0604968
722 Ga0436364_0771738
723 Ga0395901_0010606
724 Ga0395901_0045728
725 Ga0395901_0092819
726 Ga0395901_0346524
727 Ga0436365_0606046
728 Ga0436363_1596742
729 Ga0439451_002201
730 Ga0439463_006797
731 Ga0439444_0002617
732 Ga0439440_0003299
733 Ga0466969_0009750
734 Ga0466971_0012760
735 Ga0495664_0034826
736 Ga0495618_0110063
737 Ga0495587_0144747
738 Ga0495635_0156886
739 Ga0495680_0029783
740 Ga0495684_0097306
741 Ga0496105_0093164
742 Ga0496106_0251336
743 Ga0496107_0034629
744 Ga0496108_0125230
745 Ga0496110_0005252
746 Ga0496110_0514996
747 Ga0496111_0041863
748 Ga0496111_0065451
749 Ga0496112_0156278
750 Ga0496113_0093093
751 Ga0496113_0368615
752 Ga0496114_0266707
753 Ga0501031_0027749
754 Ga0501031_0055707
755 Ga0501031_0085029
756 Ga0501032_0035614
757 Ga0501033_0017435
758 Ga0501033_0054962
759 Ga0501033_0056793
760 Ga0501034_0139276
761 Ga0501036_0006872
762 Ga0501036_0063811
763 Ga0501036_0087049
764 Ga0501036_0188923
765 Ga0501036_0226370
766 Ga0501037_0008483
767 Ga0501037_0118120
768 Ga0501037_0132173
769 Ga0501038_0000803
770 Ga0501038_0023813
771 Ga0501038_0114230
772 Ga0501038_0217368
773 Ga0501038_0235102
774 Ga0501039_0001436
775 Ga0501039_0008946
776 Ga0501039_0039843
777 Ga0501039_0099699
778 Ga0501039_0124791
779 Ga0501040_0000742
780 Ga0501040_0012575
781 Ga0501040_0023470
782 Ga0501040_0093375
783 Ga0501040_0174690
784 Ga0501040_0331190
785 Ga0501041_0003226
786 Ga0501041_0005415
787 Ga0501041_0025312
788 Ga0501041_0071344
789 Ga0501042_0001721
790 Ga0501042_0002501
791 Ga0501042_0022588
792 Ga0501042_0026472
793 Ga0501042_0094796
794 Ga0501043_0020297
795 Ga0501043_0028383
796 Ga0501043_0038961
797 Ga0501043_0132855
798 Ga0501043_0135479
799 Ga0501046_0002860
800 Ga0501046_0005184
801 Ga0501046_0106969
802 Ga0501046_0192761
803 Ga0501046_0276183
804 Ga0501048_0001046
805 Ga0501048_0001470
806 Ga0501048_0022518
807 Ga0501048_0028116
808 Ga0501067_0112119
809 Ga0501068_0020774
810 Ga0501068_0022674
811 Ga0501068_0068982
812 Ga0501069_0042712
813 Ga0501070_0168042
814 Ga0501071_0000918
815 Ga0501071_0022824
816 Ga0501071_0040573
817 Ga0501071_0058657
818 Ga0501071_0070367
819 Ga0501072_0005380
820 Ga0501072_0014904
821 Ga0501072_0070335
822 Ga0501073_0080564
823 Ga0501074_0002279
824 Ga0501074_0006265
825 Ga0501074_0011214
826 Ga0501074_0013624
827 Ga0501074_0159201
828 Ga0501075_0001767
829 Ga0501075_0023408
830 Ga0501075_0024026
831 Ga0501075_0123775
832 Ga0501075_0139626
833 Ga0501076_0004615
834 Ga0501076_0005653
835 Ga0501076_0095373
836 Ga0501076_0115155
837 Ga0501076_0400681
838 Ga0501077_0000255
839 Ga0501077_0004086
840 Ga0501077_0018684
841 Ga0501077_0081211
842 Ga0501077_0104321
843 Ga0501077_0129728
844 Ga0501079_0000477
845 Ga0501079_0000527
846 Ga0501079_0020457
847 Ga0501079_0044780
848 Ga0501079_0224806
849 Ga0501080_0008484
850 Ga0501080_0024192
851 Ga0501080_0171080
852 Ga0501081_0004763
853 Ga0501081_0011699
854 Ga0501081_0019664
855 Ga0501081_0154249
856 Ga0501083_0074138
857 Ga0501035_0003305
858 Ga0501035_0170493
859 Ga0501044_0274478
860 Ga0501045_0000524
861 Ga0501045_0000847
862 Ga0501045_0006434
863 Ga0501045_0019053
864 Ga0501045_0092187
865 nmdc:mga03n38_26498_c1
866 nmdc:mga00v17_21628_c1
867 nmdc:mga00v17_53208_c1
868 nmdc:mga0yw44_26303_c1
869 nmdc:mga0yw44_2862_c1
870 nmdc:mga0yw44_33117_c1
871 nmdc:mga06z11_53989_c1
872 nmdc:mga05p37_30100_c1
873 nmdc:mga05p37_412883_c1
874 nmdc:mga05p37_44995_c1
875 nmdc:mga05p37_48765_c1
876 nmdc:mga09592_2137_c1
877 nmdc:mga0qj67_3898_c1
878 nmdc:mga0qj67_7897_c1
879 nmdc:mga06r32_114533_c1
880 nmdc:mga06r32_204289_c1
881 nmdc:mga06r32_33122_c1
882 nmdc:mga06r32_8062_c1
883 nmdc:mga08y16_18548_c1
884 nmdc:mga08y16_338519_c1
885 nmdc:mga0n895_146977_c1
886 nmdc:mga0rr50_29585_c1
887 nmdc:mga0rr50_34531_c1
888 nmdc:mga08x19_37567_c1
889 nmdc:mga08x19_69677_c1
890 nmdc:mga0a205_106475_c1
891 nmdc:mga0a205_2249_c1
892 Ga0495619_0011681
893 Ga0501084_0000999
894 Ga0501084_0002492
895 Ga0501084_0036917
896 Ga0501084_0044516
897 Ga0501084_0093639
898 Ga0501084_0149425
899 Ga0590071_001962
900 Ga0590074_002405
901 Ga0501082_0000968
902 Ga0501082_0013784
903 Ga0501082_0028625
904 Ga0501082_0032246
905 Ga0501082_0117977
906 Ga0530510_0000559
907 Ga0530510_0001347
908 Ga0530510_0017788

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00586

AIRS

AIR synthase related protein, N-terminal domain

85

193

0.96

PF02769

AIRS_C

AIR synthase related protein, C-terminal domain

205

384

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zau-assembly1.cif.gz_C-2 crystal structure of an n-terminally truncated selenophosphate synthetase from aquifex aeolicus 0.9451 62 356
2yye-assembly1.cif.gz_A crystal structure of selenophosphate synthetase from aquifex aeolicus complexed with ampcpp 0.9449 14 356
2zau-assembly1.cif.gz_B-2 crystal structure of an n-terminally truncated selenophosphate synthetase from aquifex aeolicus 0.9439 61 356
2zau-assembly1.cif.gz_A-2 crystal structure of an n-terminally truncated selenophosphate synthetase from aquifex aeolicus 0.9409 59 356
2yye-assembly1.cif.gz_A crystal structure of selenophosphate synthetase from aquifex aeolicus complexed with ampcpp 0.9314 14 356
ID Description Score Start End Superfamily
3u0oB01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.9844 60 170 3.30.1330.10
3u0oA01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.9349 45 172 3.30.1330.10
2yydA02 Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain 0.9335 174 356 3.90.650.10
2yydA02 Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain 0.9285 174 356 3.90.650.10
2yyeA01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.917 14 173 3.30.1330.10
ID Description Score Start End GO Terms
AF-C0AQN0-F1-model_v4 deleted 0.9908 81 165
AF-A0A1F9NMA7-F1-model_v4 Selenide, water dikinase SelD 0.9893 66 251 GO:0004756
GO:0005524
GO:0005737
GO:0016260
AF-A0A1F3Q0Q7-F1-model_v4 Selenide, water dikinase SelD 0.9875 98 324 GO:0004756
GO:0005524
GO:0005737
GO:0016260
AF-A0A7C3F926-F1-model_v4 Selenide, water dikinase SelD (EC 2.7.9.3) 0.9864 84 356 GO:0004756
GO:0005524
GO:0005737
GO:0016260
AF-X1P2R4-F1-model_v4 PurM-like N-terminal domain-containing protein 0.9845 102 230 GO:0004756
GO:0005524
GO:0005737
GO:0016260

Map