F447322

General Info

Members Datasets Scaffolds Average Seq Length
454 278 908 181

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100008528|Ga0070690_1000085286
Length 192
Sequence MRTGLTLASAGASEWLFCATSVCALAPASAFAVDYLSAEQAAKLMFPDAESFDSRQIKLDSSQMQQLDSQGVQARSARWVVRTAQRGKTPLGFVVIDEVIGKFELITYAVGLGLDGAVKQVEILSYRESHGQEIRLPAWRKQFVGKTSASPIHVGDDIANISGATLSCKHVSDGVKRVVTVVDLARKNGALQ

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
91 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
92 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
102 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
153 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
154 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
155 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
156 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
157 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
158 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
161 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
162 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
163 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
164 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
165 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
166 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
178 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
179 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
180 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
181 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
182 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
183 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
184 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
185 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
186 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
187 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
188 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
189 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
190 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
191 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
197 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
198 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
199 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
200 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
201 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
202 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
203 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
204 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
205 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
206 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
207 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
208 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
209 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
210 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
211 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
212 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
213 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
214 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
215 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
216 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
217 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
218 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
219 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
220 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
221 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
222 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
223 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
224 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
225 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
226 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
227 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
228 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
229 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
230 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
231 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
232 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
233 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
234 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
235 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
236 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
237 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
238 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
239 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
240 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
241 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
242 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
243 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
244 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
245 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
246 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
247 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
248 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
249 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
250 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
251 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
252 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
253 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
254 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
255 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
256 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
257 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
258 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
259 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
260 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
261 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
262 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
263 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
264 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
265 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
266 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
267 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
268 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
273 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
274 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
275 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
276 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
277 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
278 2818991436 Collimonas arenae 515 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.12
Metatranscriptomes 0.66
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.96
Nodule 0
Rhizoplane 4.19
Rhizosphere 89.21
Stem 0
Stem Tuber 0
Unclassified 7.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100008528 3300005330 Bacteria 5908
2 JGI25162J39368_1000001 3300002737 Bacteria 740113
3 JGI25164J39214_1005291 3300002772 Bacteria 1410
4 JGI25165J46597_1000001 3300003214 Bacteria 1111887
5 rootH1_10097045 3300003316 Bacteria 3367
6 Ga0055538_1000001 3300003751 Bacteria 1111887
7 Ga0055539_1000001 3300003752 Bacteria 1111887
8 Ga0055533_1000003 3300003756 Bacteria 1111887
9 Ga0055525_1000003 3300003759 Bacteria 962094
10 Ga0055541_1000001 3300003841 Bacteria 1111887
11 Ga0070676_10007635 3300005328 Bacteria 5811
12 Ga0070683_100003129 3300005329 Bacteria 13332
13 Ga0070670_100278932 3300005331 Bacteria 1459
14 Ga0068869_100041740 3300005334 Bacteria 3286
15 Ga0068869_100207019 3300005334 Unclassified 1549
16 Ga0068869_100586539 3300005334 Bacteria 940
17 Ga0070666_10068381 3300005335 Bacteria 2414
18 Ga0068868_100029570 3300005338 Bacteria 4196
19 Ga0068868_100129539 3300005338 Bacteria 2064
20 Ga0070689_100001907 3300005340 Bacteria 13473
21 Ga0070691_10057241 3300005341 Unclassified 1870
22 Ga0070661_100015973 3300005344 Bacteria 5299
23 Ga0070692_10065737 3300005345 Archaea 1921
24 Ga0070668_100023874 3300005347 Bacteria 4630
25 Ga0070669_100050381 3300005353 Bacteria 3041
26 Ga0070669_100057560 3300005353 Bacteria 2852
27 Ga0070675_100147633 3300005354 Bacteria 2014
28 Ga0070675_100166032 3300005354 Unclassified 1901
29 Ga0070671_100048217 3300005355 Bacteria 3542
30 Ga0070671_100188921 3300005355 Bacteria 1746
31 Ga0070674_100020245 3300005356 Bacteria 4245
32 Ga0070688_100078897 3300005365 Bacteria 2125
33 Ga0070659_100023425 3300005366 Bacteria 4724
34 Ga0070667_100001103 3300005367 Bacteria 24743
35 Ga0070667_100328665 3300005367 Bacteria 1381
36 Ga0070667_100431612 3300005367 Bacteria 1202
37 Ga0070703_10118101 3300005406 Unclassified 958
38 Ga0070701_10000209 3300005438 Bacteria 18356
39 Ga0070705_100253872 3300005440 Unclassified 1236
40 Ga0070700_100005465 3300005441 Bacteria 6740
41 Ga0070700_100026261 3300005441 Bacteria 3438
42 Ga0070694_100013681 3300005444 Bacteria 5071
43 Ga0070663_100000491 3300005455 Bacteria 20863
44 Ga0070663_100350346 3300005455 Archaea 1195
45 Ga0070678_100032604 3300005456 Bacteria 3607
46 Ga0070678_100091404 3300005456 Bacteria 2336
47 Ga0070678_100822152 3300005456 Bacteria 845
48 Ga0070662_100004646 3300005457 Bacteria 8707
49 Ga0068867_100000086 3300005459 Bacteria 58298
50 Ga0068867_100004032 3300005459 Bacteria 10331
51 Ga0068867_100399761 3300005459 Unclassified 1158
52 Ga0070706_100042991 3300005467 Bacteria 4175
53 Ga0070707_100489777 3300005468 Bacteria 1191
54 Ga0070684_100020799 3300005535 Bacteria 5445
55 Ga0068853_100006300 3300005539 Bacteria 9415
56 Ga0068853_100651868 3300005539 Bacteria 1002
57 Ga0070672_100021578 3300005543 Bacteria 4716
58 Ga0070686_100001022 3300005544 Bacteria 16090
59 Ga0070686_100140018 3300005544 Bacteria 1683
60 Ga0070695_100166206 3300005545 Unclassified 1553
61 Ga0070695_100394760 3300005545 Archaea 1047
62 Ga0070696_100008837 3300005546 Bacteria 6738
63 Ga0070693_100005116 3300005547 Bacteria 6269
64 Ga0070693_100011680 3300005547 Bacteria 4426
65 Ga0070704_100010941 3300005549 Bacteria 5535
66 Ga0068855_100100222 3300005563 Bacteria 3335
67 Ga0068855_100762571 3300005563 Bacteria 1031
68 Ga0070664_100017058 3300005564 Bacteria 5961
69 Ga0070664_100502521 3300005564 Archaea 1117
70 Ga0068854_100118039 3300005578 Bacteria 2009
71 Ga0068856_100027090 3300005614 Bacteria 5591
72 Ga0068856_101419833 3300005614 Bacteria 708
73 Ga0070702_100006277 3300005615 Bacteria 5614
74 Ga0070702_100290292 3300005615 Bacteria 1127
75 Ga0068852_100020764 3300005616 Bacteria 5226
76 Ga0068852_100175801 3300005616 Bacteria 2010
77 Ga0068859_101143909 3300005617 Bacteria 857
78 Ga0068864_100018314 3300005618 Bacteria 5848
79 Ga0068864_100094168 3300005618 Bacteria 2647
80 Ga0068866_10000537 3300005718 Bacteria 17337
81 Ga0068866_10007549 3300005718 Bacteria 4557
82 Ga0068866_10189794 3300005718 Bacteria 1220
83 Ga0068861_100007615 3300005719 Bacteria 7430
84 Ga0068861_100011432 3300005719 Bacteria 6172
85 Ga0068851_10008534 3300005834 Bacteria 4740
86 Ga0068863_100052616 3300005841 Bacteria 3859
87 Ga0068863_100228180 3300005841 Archaea 1795
88 Ga0068863_100525377 3300005841 Bacteria 1167
89 Ga0068863_100646175 3300005841 Bacteria 1049
90 Ga0068863_101538054 3300005841 Bacteria 674
91 Ga0068858_100022836 3300005842 Bacteria 5835
92 Ga0068858_100052992 3300005842 Bacteria 3754
93 Ga0068858_100822076 3300005842 Bacteria 907
94 Ga0068860_100001000 3300005843 Bacteria 31313
95 Ga0068862_100026260 3300005844 Bacteria 4895
96 Ga0068862_100197663 3300005844 Archaea 1812
97 Ga0075366_10003289 3300006195 Bacteria 8497
98 Ga0097621_100003289 3300006237 Bacteria 11115
99 Ga0068871_100083688 3300006358 Bacteria 2647
100 Ga0068865_100000609 3300006881 Bacteria 20055
101 Ga0068865_100018838 3300006881 Bacteria 4461
102 Ga0097620_101143822 3300006931 Bacteria 857
103 Ga0105245_10014330 3300009098 Bacteria 6907
104 Ga0105245_10023437 3300009098 Bacteria 5418
105 Ga0105245_10147756 3300009098 Bacteria 2219
106 Ga0114129_11151006 3300009147 Bacteria 969
107 Ga0105243_10004372 3300009148 Bacteria 11184
108 Ga0105243_10116096 3300009148 Bacteria 2248
109 Ga0105241_10481456 3300009174 Archaea 1103
110 Ga0105242_10005037 3300009176 Bacteria 10207
111 Ga0105248_10001017 3300009177 Bacteria 30997
112 Ga0105248_10031668 3300009177 Bacteria 5908
113 Ga0105248_10058187 3300009177 Bacteria 4340
114 Ga0105238_10025454 3300009551 Bacteria 6032
115 Ga0105238_10074807 3300009551 Bacteria 3380
116 Ga0105249_10014144 3300009553 Bacteria 7055
117 Ga0105249_10368416 3300009553 Bacteria 1460
118 Ga0105239_10021735 3300010375 Bacteria 7073
119 Ga0105246_10351145 3300011119 Unclassified 1208
120 Ga0157369_10054244 3300013105 Bacteria 4329
121 Ga0157374_10030904 3300013296 Bacteria 4864
122 Ga0157374_10117584 3300013296 Unclassified 2562
123 Ga0157374_10626057 3300013296 Bacteria 1087
124 Ga0157378_10003237 3300013297 Bacteria 14493
125 Ga0157378_10059239 3300013297 Bacteria 3416
126 Ga0163162_10003690 3300013306 Bacteria 14687
127 Ga0163162_10611361 3300013306 Unclassified 1216
128 Ga0157372_10027708 3300013307 Bacteria 6174
129 Ga0157372_10045730 3300013307 Bacteria 4858
130 Ga0157375_10157028 3300013308 Bacteria 2414
131 Ga0157375_10715549 3300013308 Archaea 1154
132 Ga0163163_10692790 3300014325 Bacteria 1082
133 Ga0157380_10004801 3300014326 Bacteria 9421
134 Ga0157380_10056711 3300014326 Bacteria 3117
135 Ga0182008_10150159 3300014497 Bacteria 1168
136 Ga0157377_10000039 3300014745 Bacteria 112711
137 Ga0157377_10002676 3300014745 Bacteria 7907
138 Ga0157379_10016795 3300014968 Bacteria 6442
139 Ga0157379_10029618 3300014968 Bacteria 4867
140 Ga0157379_10341207 3300014968 Bacteria 1370
141 Ga0157376_10434328 3300014969 Archaea 1277
142 Ga0157376_11332652 3300014969 Bacteria 748
143 Ga0182006_1085836 3300015261 Bacteria 1140
144 Ga0182007_10001680 3300015262 Bacteria 11717
145 Ga0182005_1000741 3300015265 Bacteria 14944
146 Ga0163161_10101383 3300017792 Bacteria 2143
147 Ga0163161_10180227 3300017792 Bacteria 1619
148 Ga0213872_10000550 3300021361 Bacteria 29141
149 Ga0213872_10001493 3300021361 Bacteria 15098
150 Ga0213872_10001896 3300021361 Bacteria 12853
151 Ga0213872_10003083 3300021361 Bacteria 9390
152 Ga0213872_10063732 3300021361 Bacteria 1665
153 Ga0213872_10087666 3300021361 Bacteria 1394
154 Ga0213876_10036866 3300021384 Bacteria 2580
155 Ga0209784_100004 3300025224 Bacteria 1378156
156 Ga0209566_100004 3300025225 Bacteria 1531866
157 Ga0209674_100006 3300025226 Bacteria 1531866
158 Ga0209563_100009 3300025230 Bacteria 1378156
159 Ga0207427_103876 3300025231 Bacteria 2825
160 Ga0209437_100004 3300025233 Bacteria 1378156
161 Ga0209677_100005 3300025253 Bacteria 1378156
162 Ga0209233_1000005 3300025261 Bacteria 1531866
163 Ga0207656_10058909 3300025321 Bacteria 1679
164 Ga0207642_10023761 3300025899 Bacteria 2454
165 Ga0207688_10166630 3300025901 Archaea 1309
166 Ga0207680_10105845 3300025903 Bacteria 1815
167 Ga0207645_10013129 3300025907 Bacteria 5596
168 Ga0207645_10027466 3300025907 Bacteria 3674
169 Ga0207643_10130630 3300025908 Unclassified 1494
170 Ga0207684_10292110 3300025910 Bacteria 1405
171 Ga0207654_10162030 3300025911 Bacteria 1446
172 Ga0207695_10676355 3300025913 Bacteria 913
173 Ga0207671_10437550 3300025914 Archaea 1041
174 Ga0207657_10020809 3300025919 Bacteria 6190
175 Ga0207649_10035346 3300025920 Bacteria 3002
176 Ga0207649_10199671 3300025920 Archaea 1412
177 Ga0207646_10966582 3300025922 Bacteria 754
178 Ga0207681_10007683 3300025923 Bacteria 6605
179 Ga0207694_10200328 3300025924 Bacteria 1624
180 Ga0207650_10853307 3300025925 Bacteria 773
181 Ga0207659_10014224 3300025926 Bacteria 5122
182 Ga0207687_10046938 3300025927 Bacteria 2992
183 Ga0207687_10099353 3300025927 Bacteria 2138
184 Ga0207644_10110140 3300025931 Bacteria 2081
185 Ga0207644_10179399 3300025931 Bacteria 1659
186 Ga0207644_10207470 3300025931 Bacteria 1548
187 Ga0207690_10023973 3300025932 Bacteria 3816
188 Ga0207706_10007155 3300025933 Bacteria 10320
189 Ga0207709_10000538 3300025935 Bacteria 32529
190 Ga0207669_10144375 3300025937 Unclassified 1657
191 Ga0207704_10001924 3300025938 Bacteria 9293
192 Ga0207704_10488266 3300025938 Unclassified 990
193 Ga0207665_10409993 3300025939 Bacteria 1033
194 Ga0207711_10017998 3300025941 Bacteria 5872
195 Ga0207711_10035227 3300025941 Bacteria 4242
196 Ga0207711_10217677 3300025941 Bacteria 1746
197 Ga0207689_10002393 3300025942 Bacteria 17493
198 Ga0207689_10007331 3300025942 Bacteria 9675
199 Ga0207661_10216564 3300025944 Bacteria 1690
200 Ga0207661_11014245 3300025944 Archaea 764
201 Ga0207679_10390340 3300025945 Bacteria 1222
202 Ga0207679_10450546 3300025945 Archaea 1141
203 Ga0207679_10689824 3300025945 Bacteria 926
204 Ga0207667_10070134 3300025949 Bacteria 3648
205 Ga0207667_10319798 3300025949 Bacteria 1585
206 Ga0207668_10064349 3300025972 Bacteria 2591
207 Ga0207640_10101904 3300025981 Bacteria 2016
208 Ga0207640_10122711 3300025981 Bacteria 1864
209 Ga0207658_10000856 3300025986 Bacteria 25445
210 Ga0207658_10054577 3300025986 Bacteria 2957
211 Ga0207658_10204995 3300025986 Bacteria 1649
212 Ga0207677_10032829 3300026023 Bacteria 3341
213 Ga0207677_10234422 3300026023 Bacteria 1481
214 Ga0207703_10023071 3300026035 Bacteria 4887
215 Ga0207703_10052798 3300026035 Bacteria 3302
216 Ga0207639_10347372 3300026041 Bacteria 1324
217 Ga0207639_10585464 3300026041 Bacteria 1028
218 Ga0207678_10001741 3300026067 Bacteria 19919
219 Ga0207678_10016001 3300026067 Bacteria 6589
220 Ga0207708_10001483 3300026075 Bacteria 17511
221 Ga0207708_10020486 3300026075 Bacteria 4987
222 Ga0207702_10473286 3300026078 Bacteria 1218
223 Ga0207702_11614112 3300026078 Bacteria 642
224 Ga0207641_10050079 3300026088 Bacteria 3533
225 Ga0207641_10511335 3300026088 Bacteria 1167
226 Ga0207641_10990044 3300026088 Bacteria 837
227 Ga0207641_11253117 3300026088 Bacteria 742
228 Ga0207648_10000053 3300026089 Bacteria 107516
229 Ga0207648_10002714 3300026089 Bacteria 18812
230 Ga0207648_10007859 3300026089 Bacteria 10408
231 Ga0207648_10078345 3300026089 Bacteria 2883
232 Ga0207648_10822423 3300026089 Unclassified 865
233 Ga0207676_10017686 3300026095 Bacteria 5171
234 Ga0207676_10048855 3300026095 Bacteria 3287
235 Ga0207674_10019273 3300026116 Bacteria 7394
236 Ga0207674_10039583 3300026116 Bacteria 4886
237 Ga0207675_100004700 3300026118 Bacteria 13141
238 Ga0207675_100008070 3300026118 Bacteria 9917
239 Ga0207683_10437464 3300026121 Bacteria 1205
240 Ga0207683_10784345 3300026121 Bacteria 884
241 Ga0207698_10019062 3300026142 Bacteria 4688
242 Ga0207698_10027797 3300026142 Bacteria 4021
243 Ga0207698_10081304 3300026142 Bacteria 2615
244 Ga0268265_11224282 3300028380 Archaea 749
245 Ga0268264_10000860 3300028381 Bacteria 32169
246 Ga0268264_10121192 3300028381 Bacteria 2305
247 Ga0268264_10416671 3300028381 Bacteria 1294
248 Ga0265319_1047674 3300028563 Bacteria 1425
249 Ga0307517_10070707 3300028786 Bacteria 3139
250 Ga0307515_10331554 3300028794 Bacteria 1180
251 Ga0265327_10000174 3300031251 Bacteria 138922
252 Ga0265316_10000349 3300031344 Bacteria 51876
253 Ga0307513_10129625 3300031456 Bacteria 2470
254 Ga0307509_10097768 3300031507 Bacteria 2983
255 Ga0307509_10372889 3300031507 Unclassified 1143
256 Ga0307408_100974478 3300031548 Bacteria 780
257 Ga0307516_10218819 3300031730 Bacteria 1615
258 Ga0373938_0025243 3300034957 Bacteria 1235
259 Ga0373926_0118676 3300035083 Bacteria 996
260 Ga0373932_0016066 3300035112 Bacteria 1906
261 Ga0373939_0033248 3300035114 Bacteria 1505
262 Ga0373943_0499795 3300035170 Bacteria 710
263 Ga0373955_0478398 3300035172 Unclassified 760
264 Ga0373931_0026051 3300035691 Bacteria 2972
265 Ga0373927_0021365 3300035695 Bacteria 4242
266 Ga0373947_0263675 3300035725 Bacteria 1142
267 Ga0373925_0271845 3300037068 Bacteria 1363
268 Ga0373925_0304957 3300037068 Bacteria 1286
269 Ga0395899_0000249 3300037312 Bacteria 71998
270 Ga0395899_0001858 3300037312 Bacteria 17464
271 Ga0395899_0004998 3300037312 Bacteria 10320
272 Ga0395899_0680344 3300037312 Bacteria 647
273 Ga0395900_0009597 3300037418 Bacteria 9922
274 Ga0395898_0000811 3300037466 Bacteria 52404
275 Ga0395905_0013556 3300037471 Bacteria 7810
276 Ga0395905_0089416 3300037471 Bacteria 2886
277 Ga0395905_0112501 3300037471 Bacteria 2557
278 Ga0395905_0553279 3300037471 Bacteria 1052
279 Ga0395905_0587612 3300037471 Bacteria 1015
280 Ga0395901_0137257 3300038443 Bacteria 2570
281 Ga0436365_1184142 3300039437 Bacteria 4445
282 Ga0436361_0099372 3300039447 Bacteria 18108
283 Ga0436361_0269741 3300039447 Bacteria 10162
284 Ga0436361_0317472 3300039447 Bacteria 1915
285 Ga0436361_0548371 3300039447 Bacteria 6237
286 Ga0436361_0554758 3300039447 Unclassified 857
287 Ga0436361_0568030 3300039447 Bacteria 3831
288 Ga0436361_0607078 3300039447 Bacteria 31051
289 Ga0436361_0801349 3300039447 Bacteria 4025
290 Ga0451577_0038376 3300042876 Bacteria 4309
291 Ga0466969_0093279 3300044656 Bacteria 1424
292 Ga0466972_0000060 3300044658 Bacteria 109789
293 Ga0466972_0049981 3300044658 Bacteria 2019
294 Ga0466972_0203327 3300044658 Unclassified 928
295 Ga0466965_0001324 3300044683 Bacteria 9898
296 Ga0466965_0014236 3300044683 Bacteria 3764
297 Ga0466965_0047480 3300044683 Bacteria 2126
298 Ga0466965_0109896 3300044683 Bacteria 1416
299 Ga0466966_0015316 3300044684 Bacteria 5070
300 Ga0466966_0115853 3300044684 Bacteria 1649
301 Ga0466961_0002147 3300044693 Bacteria 12260
302 Ga0466961_0046017 3300044693 Bacteria 2791
303 Ga0466963_0640116 3300044694 Bacteria 750
304 Ga0466964_0004251 3300044706 Bacteria 5274
305 Ga0466964_0007815 3300044706 Bacteria 4004
306 Ga0453684_0031135 3300044712 Bacteria 7508
307 Ga0466971_0006194 3300044719 Bacteria 5200
308 Ga0466971_0009918 3300044719 Bacteria 4160
309 Ga0466968_0001361 3300044735 Bacteria 8733
310 Ga0466968_0028810 3300044735 Bacteria 2292
311 Ga0466970_0001201 3300044765 Bacteria 12573
312 Ga0466970_0009105 3300044765 Bacteria 5010
313 Ga0466957_0006340 3300044842 Bacteria 6672
314 Ga0466957_0050946 3300044842 Bacteria 2520
315 Ga0466960_0086960 3300044901 Bacteria 1586
316 Ga0466960_0674774 3300044901 Unclassified 618
317 Ga0466959_0000041 3300045049 Bacteria 100097
318 Ga0466959_0018965 3300045049 Bacteria 5055
319 Ga0466959_0133774 3300045049 Bacteria 1756
320 Ga0466959_0198500 3300045049 Bacteria 1397
321 Ga0451576_0090440 3300045051 Bacteria 3184
322 Ga0466958_0858061 3300045836 Bacteria 592
323 Ga0466967_0179197 3300045976 Bacteria 1998
324 Ga0466967_1354673 3300045976 Bacteria 709
325 Ga0495603_0019251 3300046455 Bacteria 4133
326 Ga0495603_0223287 3300046455 Unclassified 1087
327 Ga0495629_0009630 3300046459 Bacteria 7057
328 Ga0495629_0318953 3300046459 Bacteria 1062
329 Ga0495651_0004269 3300046462 Bacteria 10961
330 Ga0495653_0208950 3300046463 Bacteria 1319
331 Ga0495580_0261496 3300046472 Bacteria 1183
332 Ga0495582_0143034 3300046473 Bacteria 1356
333 Ga0495605_0030061 3300046474 Unclassified 2788
334 Ga0495664_0296120 3300046477 Bacteria 977
335 Ga0495584_0098212 3300046491 Unclassified 1479
336 Ga0495585_0000447 3300046492 Bacteria 39452
337 Ga0495585_0052085 3300046492 Bacteria 2266
338 Ga0495594_0014849 3300046499 Bacteria 4086
339 Ga0495594_0035712 3300046499 Bacteria 2708
340 Ga0495594_0280986 3300046499 Bacteria 949
341 Ga0495596_0000835 3300046500 Bacteria 18636
342 Ga0495583_0000563 3300046506 Bacteria 51367
343 Ga0495583_0316105 3300046506 Bacteria 619
344 Ga0495608_0115249 3300046511 Bacteria 1725
345 Ga0495616_0262882 3300046513 Bacteria 738
346 Ga0495618_0092832 3300046514 Bacteria 1930
347 Ga0495628_0000137 3300046516 Bacteria 62400
348 Ga0495628_0061017 3300046516 Bacteria 2958
349 Ga0495628_0144250 3300046516 Bacteria 1816
350 Ga0495628_0257216 3300046516 Unclassified 1302
351 Ga0495630_0276627 3300046517 Bacteria 1282
352 Ga0495631_0003859 3300046518 Bacteria 8120
353 Ga0495643_0011354 3300046522 Bacteria 5429
354 Ga0495643_0033138 3300046522 Bacteria 2861
355 Ga0495644_0016615 3300046523 Bacteria 2816
356 Ga0495666_0050556 3300046526 Bacteria 1998
357 Ga0495666_0095681 3300046526 Bacteria 1400
358 Ga0495642_0001701 3300046528 Bacteria 9488
359 Ga0495642_0048997 3300046528 Bacteria 1734
360 Ga0495642_0116948 3300046528 Bacteria 1143
361 Ga0495642_0129907 3300046528 Bacteria 1084
362 Ga0495652_0002204 3300046529 Bacteria 20452
363 Ga0495652_0035412 3300046529 Bacteria 4345
364 Ga0495652_0061332 3300046529 Bacteria 3175
365 Ga0495665_0001201 3300046531 Bacteria 13802
366 Ga0495665_0108189 3300046531 Bacteria 1458
367 Ga0495586_0004416 3300046535 Bacteria 7509
368 Ga0495586_0202615 3300046535 Bacteria 1125
369 Ga0495609_0014353 3300046538 Bacteria 3726
370 Ga0495597_0000752 3300046542 Bacteria 25607
371 Ga0495597_0020524 3300046542 Bacteria 3076
372 Ga0495645_0368070 3300046543 Unclassified 922
373 Ga0495622_0001036 3300046557 Bacteria 14791
374 Ga0495622_0007623 3300046557 Bacteria 5026
375 Ga0495622_0037392 3300046557 Bacteria 2261
376 Ga0495656_0000082 3300046615 Bacteria 42150
377 Ga0495668_0169487 3300046616 Bacteria 1196
378 Ga0495611_0049375 3300046648 Unclassified 1893
379 Ga0495625_0012162 3300046660 Bacteria 6983
380 Ga0495625_0475465 3300046660 Bacteria 768
381 Ga0495635_0214626 3300046663 Bacteria 1303
382 Ga0495661_0000979 3300046665 Bacteria 25811
383 Ga0495661_0206789 3300046665 Bacteria 1024
384 Ga0495588_0101823 3300046674 Bacteria 1509
385 Ga0495588_0419875 3300046674 Bacteria 702
386 Ga0495657_0491298 3300046675 Bacteria 716
387 Ga0495623_0102959 3300046679 Bacteria 1737
388 Ga0495646_0004343 3300046680 Bacteria 8932
389 Ga0495646_0121582 3300046680 Bacteria 1477
390 Ga0495646_0174148 3300046680 Bacteria 1184
391 Ga0495647_0068810 3300046681 Bacteria 1413
392 Ga0495658_0129769 3300046683 Bacteria 1533
393 Ga0495613_0043217 3300046689 Bacteria 3333
394 Ga0495613_0257777 3300046689 Bacteria 1216
395 Ga0495624_0012037 3300046690 Bacteria 5928
396 Ga0495624_0064467 3300046690 Bacteria 2290
397 Ga0495670_0074567 3300046691 Bacteria 1721
398 Ga0495600_0008662 3300046809 Bacteria 6259
399 Ga0495581_0085854 3300047315 Bacteria 1824
400 Ga0495604_0035774 3300047317 Bacteria 3919
401 Ga0495636_0023203 3300047318 Bacteria 2510
402 Ga0495674_0139135 3300047319 Bacteria 2041
403 Ga0495674_0374951 3300047319 Bacteria 1152
404 Ga0495674_0516302 3300047319 Bacteria 954
405 Ga0495676_0057736 3300047321 Bacteria 3058
406 Ga0495676_0060682 3300047321 Bacteria 2962
407 Ga0495676_0094996 3300047321 Bacteria 2220
408 Ga0495676_0149591 3300047321 Bacteria 1663
409 Ga0495683_0193346 3300047323 Unclassified 922
410 Ga0495687_015797 3300047443 Bacteria 3823
411 Ga0495687_069360 3300047443 Bacteria 1419
412 Ga0495677_0075010 3300047445 Unclassified 1263
413 Ga0495673_0063614 3300047469 Unclassified 1572
414 Ga0495681_0130970 3300047470 Unclassified 1067
415 Ga0495602_0020316 3300048088 Bacteria 6565
416 Ga0495602_0159406 3300048088 Bacteria 1763
417 Ga0495614_0035602 3300048089 Bacteria 2139
418 Ga0495614_0081651 3300048089 Bacteria 1401
419 Ga0495626_0090992 3300048091 Bacteria 1341
420 Ga0495626_0273271 3300048091 Bacteria 673
421 Ga0496100_0203971 3300048903 Bacteria 1443
422 Ga0496106_0022865 3300048909 Bacteria 4643
423 Ga0496107_0032704 3300048910 Bacteria 3718
424 Ga0496108_0055699 3300048911 Bacteria 3321
425 Ga0496108_0188329 3300048911 Bacteria 1788
426 Ga0496109_0008620 3300048912 Bacteria 8681
427 Ga0496109_0061399 3300048912 Bacteria 3436
428 Ga0496110_0053450 3300048913 Bacteria 3551
429 Ga0496110_0320364 3300048913 Unclassified 1412
430 Ga0496110_0396953 3300048913 Bacteria 1257
431 Ga0496112_0026238 3300048915 Bacteria 5603
432 Ga0496112_0201533 3300048915 Bacteria 1949
433 Ga0496113_0440409 3300048916 Archaea 1047
434 Ga0496114_0038279 3300048917 Bacteria 3968
435 Ga0496115_0003150 3300048918 Bacteria 11862
436 Ga0496115_0016510 3300048918 Bacteria 5624
437 Ga0496115_0151021 3300048918 Bacteria 1918
438 Ga0496115_0173315 3300048918 Bacteria 1784
439 Ga0496115_0234398 3300048918 Bacteria 1513
440 Ga0496124_0673530 3300048927 Bacteria 660
441 Ga0496125_0021028 3300048928 Bacteria 6100
442 Ga0495682_0006249 3300049460 Bacteria 4841
443 Ga0501326_00161 3300049542 Unclassified 2319
444 Ga0501335_025300 3300049551 Bacteria 650
445 Ga0501336_001472 3300049552 Unclassified 1407
446 Ga0501034_0568912 3300049571 Bacteria 1041
447 Ga0501035_0919654 3300049822 Bacteria 692
448 nmdc:mga0k408_5045_c1 3300050493 Bacteria 6991
449 nmdc:mga0n895_1440822_c1 3300050512 Bacteria 656
450 Ga0495601_0240874 3300053077 Bacteria 1181
451 Ga0495619_0080498 3300053085 Bacteria 2192
452 Ga0466962_0005105 3300061719 Bacteria 6314
453 Ga0466962_0087866 3300061719 Bacteria 1489
454 2819542507 2818991436 Bacteria 5376622
455 Ga0070690_100008528
456 JGI25162J39368_1000001
457 JGI25164J39214_1005291
458 JGI25165J46597_1000001
459 rootH1_10097045
460 Ga0055538_1000001
461 Ga0055539_1000001
462 Ga0055533_1000003
463 Ga0055525_1000003
464 Ga0055541_1000001
465 Ga0070676_10007635
466 Ga0070683_100003129
467 Ga0070670_100278932
468 Ga0068869_100041740
469 Ga0068869_100207019
470 Ga0068869_100586539
471 Ga0070666_10068381
472 Ga0068868_100029570
473 Ga0068868_100129539
474 Ga0070689_100001907
475 Ga0070691_10057241
476 Ga0070661_100015973
477 Ga0070692_10065737
478 Ga0070668_100023874
479 Ga0070669_100050381
480 Ga0070669_100057560
481 Ga0070675_100147633
482 Ga0070675_100166032
483 Ga0070671_100048217
484 Ga0070671_100188921
485 Ga0070674_100020245
486 Ga0070688_100078897
487 Ga0070659_100023425
488 Ga0070667_100001103
489 Ga0070667_100328665
490 Ga0070667_100431612
491 Ga0070703_10118101
492 Ga0070701_10000209
493 Ga0070705_100253872
494 Ga0070700_100005465
495 Ga0070700_100026261
496 Ga0070694_100013681
497 Ga0070663_100000491
498 Ga0070663_100350346
499 Ga0070678_100032604
500 Ga0070678_100091404
501 Ga0070678_100822152
502 Ga0070662_100004646
503 Ga0068867_100000086
504 Ga0068867_100004032
505 Ga0068867_100399761
506 Ga0070706_100042991
507 Ga0070707_100489777
508 Ga0070684_100020799
509 Ga0068853_100006300
510 Ga0068853_100651868
511 Ga0070672_100021578
512 Ga0070686_100001022
513 Ga0070686_100140018
514 Ga0070695_100166206
515 Ga0070695_100394760
516 Ga0070696_100008837
517 Ga0070693_100005116
518 Ga0070693_100011680
519 Ga0070704_100010941
520 Ga0068855_100100222
521 Ga0068855_100762571
522 Ga0070664_100017058
523 Ga0070664_100502521
524 Ga0068854_100118039
525 Ga0068856_100027090
526 Ga0068856_101419833
527 Ga0070702_100006277
528 Ga0070702_100290292
529 Ga0068852_100020764
530 Ga0068852_100175801
531 Ga0068859_101143909
532 Ga0068864_100018314
533 Ga0068864_100094168
534 Ga0068866_10000537
535 Ga0068866_10007549
536 Ga0068866_10189794
537 Ga0068861_100007615
538 Ga0068861_100011432
539 Ga0068851_10008534
540 Ga0068863_100052616
541 Ga0068863_100228180
542 Ga0068863_100525377
543 Ga0068863_100646175
544 Ga0068863_101538054
545 Ga0068858_100022836
546 Ga0068858_100052992
547 Ga0068858_100822076
548 Ga0068860_100001000
549 Ga0068862_100026260
550 Ga0068862_100197663
551 Ga0075366_10003289
552 Ga0097621_100003289
553 Ga0068871_100083688
554 Ga0068865_100000609
555 Ga0068865_100018838
556 Ga0097620_101143822
557 Ga0105245_10014330
558 Ga0105245_10023437
559 Ga0105245_10147756
560 Ga0114129_11151006
561 Ga0105243_10004372
562 Ga0105243_10116096
563 Ga0105241_10481456
564 Ga0105242_10005037
565 Ga0105248_10001017
566 Ga0105248_10031668
567 Ga0105248_10058187
568 Ga0105238_10025454
569 Ga0105238_10074807
570 Ga0105249_10014144
571 Ga0105249_10368416
572 Ga0105239_10021735
573 Ga0105246_10351145
574 Ga0157369_10054244
575 Ga0157374_10030904
576 Ga0157374_10117584
577 Ga0157374_10626057
578 Ga0157378_10003237
579 Ga0157378_10059239
580 Ga0163162_10003690
581 Ga0163162_10611361
582 Ga0157372_10027708
583 Ga0157372_10045730
584 Ga0157375_10157028
585 Ga0157375_10715549
586 Ga0163163_10692790
587 Ga0157380_10004801
588 Ga0157380_10056711
589 Ga0182008_10150159
590 Ga0157377_10000039
591 Ga0157377_10002676
592 Ga0157379_10016795
593 Ga0157379_10029618
594 Ga0157379_10341207
595 Ga0157376_10434328
596 Ga0157376_11332652
597 Ga0182006_1085836
598 Ga0182007_10001680
599 Ga0182005_1000741
600 Ga0163161_10101383
601 Ga0163161_10180227
602 Ga0213872_10000550
603 Ga0213872_10001493
604 Ga0213872_10001896
605 Ga0213872_10003083
606 Ga0213872_10063732
607 Ga0213872_10087666
608 Ga0213876_10036866
609 Ga0209784_100004
610 Ga0209566_100004
611 Ga0209674_100006
612 Ga0209563_100009
613 Ga0207427_103876
614 Ga0209437_100004
615 Ga0209677_100005
616 Ga0209233_1000005
617 Ga0207656_10058909
618 Ga0207642_10023761
619 Ga0207688_10166630
620 Ga0207680_10105845
621 Ga0207645_10013129
622 Ga0207645_10027466
623 Ga0207643_10130630
624 Ga0207684_10292110
625 Ga0207654_10162030
626 Ga0207695_10676355
627 Ga0207671_10437550
628 Ga0207657_10020809
629 Ga0207649_10035346
630 Ga0207649_10199671
631 Ga0207646_10966582
632 Ga0207681_10007683
633 Ga0207694_10200328
634 Ga0207650_10853307
635 Ga0207659_10014224
636 Ga0207687_10046938
637 Ga0207687_10099353
638 Ga0207644_10110140
639 Ga0207644_10179399
640 Ga0207644_10207470
641 Ga0207690_10023973
642 Ga0207706_10007155
643 Ga0207709_10000538
644 Ga0207669_10144375
645 Ga0207704_10001924
646 Ga0207704_10488266
647 Ga0207665_10409993
648 Ga0207711_10017998
649 Ga0207711_10035227
650 Ga0207711_10217677
651 Ga0207689_10002393
652 Ga0207689_10007331
653 Ga0207661_10216564
654 Ga0207661_11014245
655 Ga0207679_10390340
656 Ga0207679_10450546
657 Ga0207679_10689824
658 Ga0207667_10070134
659 Ga0207667_10319798
660 Ga0207668_10064349
661 Ga0207640_10101904
662 Ga0207640_10122711
663 Ga0207658_10000856
664 Ga0207658_10054577
665 Ga0207658_10204995
666 Ga0207677_10032829
667 Ga0207677_10234422
668 Ga0207703_10023071
669 Ga0207703_10052798
670 Ga0207639_10347372
671 Ga0207639_10585464
672 Ga0207678_10001741
673 Ga0207678_10016001
674 Ga0207708_10001483
675 Ga0207708_10020486
676 Ga0207702_10473286
677 Ga0207702_11614112
678 Ga0207641_10050079
679 Ga0207641_10511335
680 Ga0207641_10990044
681 Ga0207641_11253117
682 Ga0207648_10000053
683 Ga0207648_10002714
684 Ga0207648_10007859
685 Ga0207648_10078345
686 Ga0207648_10822423
687 Ga0207676_10017686
688 Ga0207676_10048855
689 Ga0207674_10019273
690 Ga0207674_10039583
691 Ga0207675_100004700
692 Ga0207675_100008070
693 Ga0207683_10437464
694 Ga0207683_10784345
695 Ga0207698_10019062
696 Ga0207698_10027797
697 Ga0207698_10081304
698 Ga0268265_11224282
699 Ga0268264_10000860
700 Ga0268264_10121192
701 Ga0268264_10416671
702 Ga0265319_1047674
703 Ga0307517_10070707
704 Ga0307515_10331554
705 Ga0265327_10000174
706 Ga0265316_10000349
707 Ga0307513_10129625
708 Ga0307509_10097768
709 Ga0307509_10372889
710 Ga0307408_100974478
711 Ga0307516_10218819
712 Ga0373938_0025243
713 Ga0373926_0118676
714 Ga0373932_0016066
715 Ga0373939_0033248
716 Ga0373943_0499795
717 Ga0373955_0478398
718 Ga0373931_0026051
719 Ga0373927_0021365
720 Ga0373947_0263675
721 Ga0373925_0271845
722 Ga0373925_0304957
723 Ga0395899_0000249
724 Ga0395899_0001858
725 Ga0395899_0004998
726 Ga0395899_0680344
727 Ga0395900_0009597
728 Ga0395898_0000811
729 Ga0395905_0013556
730 Ga0395905_0089416
731 Ga0395905_0112501
732 Ga0395905_0553279
733 Ga0395905_0587612
734 Ga0395901_0137257
735 Ga0436365_1184142
736 Ga0436361_0099372
737 Ga0436361_0269741
738 Ga0436361_0317472
739 Ga0436361_0548371
740 Ga0436361_0554758
741 Ga0436361_0568030
742 Ga0436361_0607078
743 Ga0436361_0801349
744 Ga0451577_0038376
745 Ga0466969_0093279
746 Ga0466972_0000060
747 Ga0466972_0049981
748 Ga0466972_0203327
749 Ga0466965_0001324
750 Ga0466965_0014236
751 Ga0466965_0047480
752 Ga0466965_0109896
753 Ga0466966_0015316
754 Ga0466966_0115853
755 Ga0466961_0002147
756 Ga0466961_0046017
757 Ga0466963_0640116
758 Ga0466964_0004251
759 Ga0466964_0007815
760 Ga0453684_0031135
761 Ga0466971_0006194
762 Ga0466971_0009918
763 Ga0466968_0001361
764 Ga0466968_0028810
765 Ga0466970_0001201
766 Ga0466970_0009105
767 Ga0466957_0006340
768 Ga0466957_0050946
769 Ga0466960_0086960
770 Ga0466960_0674774
771 Ga0466959_0000041
772 Ga0466959_0018965
773 Ga0466959_0133774
774 Ga0466959_0198500
775 Ga0451576_0090440
776 Ga0466958_0858061
777 Ga0466967_0179197
778 Ga0466967_1354673
779 Ga0495603_0019251
780 Ga0495603_0223287
781 Ga0495629_0009630
782 Ga0495629_0318953
783 Ga0495651_0004269
784 Ga0495653_0208950
785 Ga0495580_0261496
786 Ga0495582_0143034
787 Ga0495605_0030061
788 Ga0495664_0296120
789 Ga0495584_0098212
790 Ga0495585_0000447
791 Ga0495585_0052085
792 Ga0495594_0014849
793 Ga0495594_0035712
794 Ga0495594_0280986
795 Ga0495596_0000835
796 Ga0495583_0000563
797 Ga0495583_0316105
798 Ga0495608_0115249
799 Ga0495616_0262882
800 Ga0495618_0092832
801 Ga0495628_0000137
802 Ga0495628_0061017
803 Ga0495628_0144250
804 Ga0495628_0257216
805 Ga0495630_0276627
806 Ga0495631_0003859
807 Ga0495643_0011354
808 Ga0495643_0033138
809 Ga0495644_0016615
810 Ga0495666_0050556
811 Ga0495666_0095681
812 Ga0495642_0001701
813 Ga0495642_0048997
814 Ga0495642_0116948
815 Ga0495642_0129907
816 Ga0495652_0002204
817 Ga0495652_0035412
818 Ga0495652_0061332
819 Ga0495665_0001201
820 Ga0495665_0108189
821 Ga0495586_0004416
822 Ga0495586_0202615
823 Ga0495609_0014353
824 Ga0495597_0000752
825 Ga0495597_0020524
826 Ga0495645_0368070
827 Ga0495622_0001036
828 Ga0495622_0007623
829 Ga0495622_0037392
830 Ga0495656_0000082
831 Ga0495668_0169487
832 Ga0495611_0049375
833 Ga0495625_0012162
834 Ga0495625_0475465
835 Ga0495635_0214626
836 Ga0495661_0000979
837 Ga0495661_0206789
838 Ga0495588_0101823
839 Ga0495588_0419875
840 Ga0495657_0491298
841 Ga0495623_0102959
842 Ga0495646_0004343
843 Ga0495646_0121582
844 Ga0495646_0174148
845 Ga0495647_0068810
846 Ga0495658_0129769
847 Ga0495613_0043217
848 Ga0495613_0257777
849 Ga0495624_0012037
850 Ga0495624_0064467
851 Ga0495670_0074567
852 Ga0495600_0008662
853 Ga0495581_0085854
854 Ga0495604_0035774
855 Ga0495636_0023203
856 Ga0495674_0139135
857 Ga0495674_0374951
858 Ga0495674_0516302
859 Ga0495676_0057736
860 Ga0495676_0060682
861 Ga0495676_0094996
862 Ga0495676_0149591
863 Ga0495683_0193346
864 Ga0495687_015797
865 Ga0495687_069360
866 Ga0495677_0075010
867 Ga0495673_0063614
868 Ga0495681_0130970
869 Ga0495602_0020316
870 Ga0495602_0159406
871 Ga0495614_0035602
872 Ga0495614_0081651
873 Ga0495626_0090992
874 Ga0495626_0273271
875 Ga0496100_0203971
876 Ga0496106_0022865
877 Ga0496107_0032704
878 Ga0496108_0055699
879 Ga0496108_0188329
880 Ga0496109_0008620
881 Ga0496109_0061399
882 Ga0496110_0053450
883 Ga0496110_0320364
884 Ga0496110_0396953
885 Ga0496112_0026238
886 Ga0496112_0201533
887 Ga0496113_0440409
888 Ga0496114_0038279
889 Ga0496115_0003150
890 Ga0496115_0016510
891 Ga0496115_0151021
892 Ga0496115_0173315
893 Ga0496115_0234398
894 Ga0496124_0673530
895 Ga0496125_0021028
896 Ga0495682_0006249
897 Ga0501326_00161
898 Ga0501335_025300
899 Ga0501336_001472
900 Ga0501034_0568912
901 Ga0501035_0919654
902 nmdc:mga0k408_5045_c1
903 nmdc:mga0n895_1440822_c1
904 Ga0495601_0240874
905 Ga0495619_0080498
906 Ga0466962_0005105
907 Ga0466962_0087866
908 2819542507

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04205

FMN_bind

FMN-binding domain

101

180

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
7zc6-assembly1.cif.gz_G na+ - translocating ferredoxin: nad+ reductase (rnf) of c. tetanomorphum 0.7322 27 177
4tvw-assembly2.cif.gz_B resorufin ligase with bound resorufin-amp analog 0.7307 82 135
8crj-assembly1.cif.gz_A crystal structure of lpla1 in complex with lipoyl-amp (listeria monocytogenes) 0.6652 77 135
8ahx-assembly1.cif.gz_G cryo-em structure of the nitrogen-fixation associated nadh:ferredoxin oxidoreductase rnf from azotobacter vinelandii 0.6633 39 165
1w9h-assembly1.cif.gz_A the structure of a piwi protein from archaeoglobus fulgidus. 0.6428 84 116
ID Description Score Start End Superfamily
af_P15081_4_110_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.798 84 116 3.90.1010.10
af_Q2G147_253_340_3.30.390.50 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;CO dehydrogenase flavoprotein, C-terminal domain 0.6596 82 135 3.30.390.50
2bggB02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.6587 84 114 3.30.420.10
4aybB04 Alpha Beta;Alpha-Beta Complex;Dna-directed Rna Polymerase Ii 140kd Polypeptide; Chain: B; domain 3;RNA polymerase Rpb2, domain 2 0.6326 69 113 3.90.1110.10
af_O60183_318_437_2.60.40.640 Mainly Beta;Sandwich;Immunoglobulin-like; 0.6178 71 110 2.60.40.640
ID Description Score Start End GO Terms
AF-H1SF73-F1-model_v4 Fmn-binding domain protein 0.9451 17 172 GO:0010181
GO:0016020
AF-A0A3S0CA15-F1-model_v4 FMN-binding protein 0.9425 25 175 GO:0005886
GO:0009055
GO:0010181
GO:0022900
AF-A0A2H0MMW8-F1-model_v4 FMN-binding domain-containing protein 0.9414 23 176 GO:0005886
GO:0009055
GO:0010181
GO:0022900
AF-A0A7C2PK41-F1-model_v4 FMN-binding protein 0.9402 20 178 GO:0005886
GO:0009055
GO:0010181
GO:0022900
AF-A0A523MWY0-F1-model_v4 FMN-binding protein 0.938 42 176 GO:0005886
GO:0009055
GO:0010181
GO:0022900

Map