F447320

General Info

Members Datasets Scaffolds Average Seq Length
454 212 908 92

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100001825|Ga0070683_10000182514
Length 93
Sequence MIVRISGEGQYELPDEDAERLNELDNQAVAAVEAGDEAEFHELWKKMLDFVCEEKGRALEDDELVESDVILPPRDSTFEEAKADFTGEGLIPD

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
69 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
70 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
73 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
121 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
122 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
123 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
124 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
125 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
134 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
135 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
136 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
137 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
138 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
139 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
140 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
141 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
142 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
143 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
144 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
145 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
148 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
149 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
150 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
151 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
156 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
157 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
158 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
159 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
160 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
161 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
162 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
163 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
164 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
165 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
168 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
177 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
188 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
189 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
190 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
191 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
192 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
193 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
194 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
195 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
196 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
197 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
198 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
199 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
200 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
201 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
202 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
203 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
204 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
205 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
206 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
207 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
212 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.8
Metatranscriptomes 2.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.54
Nodule 0
Rhizoplane 4.41
Rhizosphere 85.02
Stem 0
Stem Tuber 0
Unclassified 5.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100001825 3300005329 Bacteria 16608
2 JGI25407J50210_10002681 3300003373 Bacteria 4225
3 JGI25407J50210_10008612 3300003373 Bacteria 2574
4 JGI25407J50210_10009454 3300003373 Bacteria 2470
5 JGI25407J50210_10023708 3300003373 Bacteria 1592
6 JGI25407J50210_10041829 3300003373 Bacteria 1173
7 JGI25407J50210_10059492 3300003373 Bacteria 961
8 JGI25407J50210_10110715 3300003373 Bacteria 677
9 Ga0070680_100642705 3300005336 Bacteria 912
10 Ga0070680_100666064 3300005336 Bacteria 895
11 Ga0070680_101310633 3300005336 Bacteria 627
12 Ga0070660_101702282 3300005339 Bacteria 537
13 Ga0070691_10550952 3300005341 Bacteria 674
14 Ga0070661_100812637 3300005344 Bacteria 768
15 Ga0070661_100864915 3300005344 Bacteria 745
16 Ga0070661_101034741 3300005344 Bacteria 682
17 Ga0070692_10116785 3300005345 Bacteria 1483
18 Ga0070692_10380879 3300005345 Bacteria 885
19 Ga0070692_10600744 3300005345 Bacteria 728
20 Ga0070668_100108114 3300005347 Bacteria 2211
21 Ga0070669_100433525 3300005353 Bacteria 1081
22 Ga0070659_102100704 3300005366 Bacteria 508
23 Ga0070714_100062956 3300005435 Bacteria 3189
24 Ga0070711_101632613 3300005439 Bacteria 564
25 Ga0070700_100144923 3300005441 Bacteria 1618
26 Ga0070700_101118221 3300005441 Bacteria 654
27 Ga0070700_101732476 3300005441 Bacteria 537
28 Ga0070678_101002145 3300005456 Bacteria 768
29 Ga0070662_100185984 3300005457 Bacteria 1640
30 Ga0070662_100194821 3300005457 Bacteria 1605
31 Ga0070662_100858777 3300005457 Bacteria 773
32 Ga0070681_10388385 3300005458 Bacteria 1307
33 Ga0068867_101524165 3300005459 Bacteria 623
34 Ga0070679_100290299 3300005530 Bacteria 1587
35 Ga0070679_100335391 3300005530 Bacteria 1460
36 Ga0070684_100210322 3300005535 Bacteria 1773
37 Ga0070684_100350675 3300005535 Bacteria 1357
38 Ga0070684_101289484 3300005535 Bacteria 687
39 Ga0070684_101918766 3300005535 Bacteria 559
40 Ga0068853_101217096 3300005539 Bacteria 727
41 Ga0070695_100132893 3300005545 Bacteria 1717
42 Ga0070696_100034776 3300005546 Bacteria 3468
43 Ga0070693_100473854 3300005547 Bacteria 883
44 Ga0070704_100518377 3300005549 Bacteria 1037
45 Ga0070704_101290121 3300005549 Bacteria 668
46 Ga0070664_101600996 3300005564 Bacteria 617
47 Ga0068854_100059121 3300005578 Bacteria 2769
48 Ga0068854_100363607 3300005578 Bacteria 1188
49 Ga0068854_101068377 3300005578 Unclassified 718
50 Ga0068854_101643590 3300005578 Bacteria 586
51 Ga0068856_100257604 3300005614 Bacteria 1760
52 Ga0070702_100261946 3300005615 Bacteria 1178
53 Ga0070702_100365694 3300005615 Bacteria 1021
54 Ga0068852_100385021 3300005616 Bacteria 1376
55 Ga0068866_11265045 3300005718 Unclassified 535
56 Ga0068861_100009502 3300005719 Bacteria 6718
57 Ga0068861_102646269 3300005719 Unclassified 506
58 Ga0068862_100250479 3300005844 Bacteria 1614
59 Ga0081455_10025718 3300005937 Bacteria 5428
60 Ga0081455_10082537 3300005937 Bacteria 2629
61 Ga0081455_10247282 3300005937 Bacteria 1307
62 Ga0081538_10000750 3300005981 Bacteria 35412
63 Ga0081538_10000953 3300005981 Bacteria 31063
64 Ga0081538_10000963 3300005981 Bacteria 30702
65 Ga0081538_10001919 3300005981 Bacteria 20823
66 Ga0081538_10002876 3300005981 Bacteria 16445
67 Ga0081538_10003307 3300005981 Bacteria 15279
68 Ga0081538_10006729 3300005981 Bacteria 10054
69 Ga0081538_10007687 3300005981 Bacteria 9293
70 Ga0081538_10013289 3300005981 Bacteria 6528
71 Ga0081538_10013636 3300005981 Bacteria 6427
72 Ga0081538_10032774 3300005981 Bacteria 3473
73 Ga0081538_10037359 3300005981 Bacteria 3152
74 Ga0081538_10060414 3300005981 Bacteria 2180
75 Ga0081538_10115254 3300005981 Bacteria 1307
76 Ga0081538_10136255 3300005981 Bacteria 1142
77 Ga0081538_10150315 3300005981 Bacteria 1056
78 Ga0081538_10218032 3300005981 Bacteria 760
79 Ga0081538_10259131 3300005981 Bacteria 658
80 Ga0081539_10041633 3300005985 Bacteria 2683
81 Ga0075363_100127440 3300006048 Bacteria 1426
82 Ga0075364_10313602 3300006051 Bacteria 1068
83 Ga0075364_10697569 3300006051 Bacteria 693
84 Ga0075432_10040035 3300006058 Bacteria 1635
85 Ga0075428_100029426 3300006844 Bacteria 6077
86 Ga0075428_100069055 3300006844 Bacteria 3865
87 Ga0075428_100201835 3300006844 Bacteria 2149
88 Ga0075428_100235518 3300006844 Bacteria 1975
89 Ga0075428_100492712 3300006844 Bacteria 1311
90 Ga0075430_100007186 3300006846 Bacteria 9393
91 Ga0075430_100064326 3300006846 Bacteria 3082
92 Ga0075430_100121797 3300006846 Bacteria 2174
93 Ga0075431_100030038 3300006847 Bacteria 5596
94 Ga0075431_100437761 3300006847 Bacteria 1305
95 Ga0075433_10062934 3300006852 Bacteria 3250
96 Ga0075434_101228827 3300006871 Bacteria 761
97 Ga0075434_101494635 3300006871 Bacteria 685
98 Ga0075429_100190708 3300006880 Bacteria 1796
99 Ga0068865_100983652 3300006881 Bacteria 738
100 Ga0075435_100881267 3300007076 Bacteria 780
101 Ga0105240_10327149 3300009093 Bacteria 1745
102 Ga0111539_10012332 3300009094 Bacteria 10710
103 Ga0111539_10034628 3300009094 Bacteria 6119
104 Ga0111539_10801191 3300009094 Bacteria 1096
105 Ga0111539_12343401 3300009094 Unclassified 619
106 Ga0111539_13370001 3300009094 Bacteria 514
107 Ga0105245_10012415 3300009098 Bacteria 7414
108 Ga0105245_10295588 3300009098 Bacteria 1587
109 Ga0105245_10407660 3300009098 Bacteria 1360
110 Ga0105245_12752998 3300009098 Unclassified 545
111 Ga0114129_10016879 3300009147 Bacteria 10394
112 Ga0114129_11100530 3300009147 Bacteria 995
113 Ga0114129_11815328 3300009147 Bacteria 741
114 Ga0105243_11020553 3300009148 Bacteria 831
115 Ga0105243_11247055 3300009148 Bacteria 759
116 Ga0105238_10976963 3300009551 Bacteria 867
117 Ga0105238_11241791 3300009551 Bacteria 770
118 Ga0105249_10002549 3300009553 Bacteria 15771
119 Ga0105249_11194342 3300009553 Bacteria 832
120 Ga0105239_11044809 3300010375 Bacteria 940
121 Ga0105239_13610183 3300010375 Bacteria 503
122 Ga0105246_11373401 3300011119 Bacteria 658
123 Ga0157369_11158481 3300013105 Bacteria 789
124 Ga0157378_11187487 3300013297 Bacteria 802
125 Ga0163162_10092175 3300013306 Bacteria 3113
126 Ga0157372_10200081 3300013307 Bacteria 2314
127 Ga0163163_10902790 3300014325 Bacteria 947
128 Ga0163163_11871050 3300014325 Bacteria 660
129 Ga0182008_10602008 3300014497 Unclassified 617
130 Ga0163161_10132419 3300017792 Bacteria 1882
131 Ga0197907_10617764 3300020069 Unclassified 743
132 Ga0197907_10885265 3300020069 Bacteria 755
133 Ga0206352_10223583 3300020078 Bacteria 1441
134 Ga0206350_10505195 3300020080 Bacteria 684
135 Ga0206354_11035504 3300020081 Bacteria 871
136 Ga0206353_11431017 3300020082 Bacteria 689
137 Ga0206353_11811917 3300020082 Bacteria 703
138 Ga0213873_10203298 3300021358 Bacteria 615
139 Ga0213872_10227112 3300021361 Bacteria 793
140 Ga0213874_10000485 3300021377 Bacteria 7990
141 Ga0213874_10013331 3300021377 Bacteria 2127
142 Ga0213874_10061611 3300021377 Bacteria 1176
143 Ga0213876_10008089 3300021384 Bacteria 5700
144 Ga0213876_10012574 3300021384 Bacteria 4503
145 Ga0213876_10014154 3300021384 Bacteria 4231
146 Ga0213876_10041130 3300021384 Bacteria 2442
147 Ga0213876_10270502 3300021384 Bacteria 903
148 Ga0213876_10601882 3300021384 Unclassified 585
149 Ga0213875_10010839 3300021388 Bacteria 4556
150 Ga0213875_10012464 3300021388 Bacteria 4197
151 Ga0213875_10045426 3300021388 Bacteria 2061
152 Ga0213875_10098376 3300021388 Bacteria 1365
153 Ga0213875_10636226 3300021388 Bacteria 516
154 Ga0224712_10171918 3300022467 Bacteria 972
155 Ga0224712_10188808 3300022467 Bacteria 932
156 Ga0207642_10728042 3300025899 Bacteria 627
157 Ga0207688_10354401 3300025901 Bacteria 904
158 Ga0207645_10080266 3300025907 Bacteria 2091
159 Ga0207707_10891220 3300025912 Bacteria 736
160 Ga0207707_11018405 3300025912 Bacteria 679
161 Ga0207695_10238492 3300025913 Bacteria 1720
162 Ga0207663_10027684 3300025916 Bacteria 3308
163 Ga0207660_11207347 3300025917 Bacteria 615
164 Ga0207657_10334736 3300025919 Bacteria 1195
165 Ga0207649_10258665 3300025920 Bacteria 1257
166 Ga0207652_10309576 3300025921 Bacteria 1426
167 Ga0207694_11060883 3300025924 Bacteria 686
168 Ga0207687_10103241 3300025927 Bacteria 2102
169 Ga0207687_11438263 3300025927 Unclassified 592
170 Ga0207700_11534360 3300025928 Bacteria 590
171 Ga0207664_10160922 3300025929 Bacteria 1914
172 Ga0207664_10488368 3300025929 Bacteria 1102
173 Ga0207690_10594474 3300025932 Bacteria 903
174 Ga0207690_11782712 3300025932 Bacteria 514
175 Ga0207690_11872472 3300025932 Bacteria 501
176 Ga0207706_10002182 3300025933 Bacteria 19087
177 Ga0207706_10081597 3300025933 Bacteria 2842
178 Ga0207686_10378796 3300025934 Bacteria 1072
179 Ga0207709_10672152 3300025935 Bacteria 826
180 Ga0207669_10549388 3300025937 Bacteria 932
181 Ga0207704_10514784 3300025938 Bacteria 967
182 Ga0207704_11679884 3300025938 Bacteria 546
183 Ga0207661_10006609 3300025944 Bacteria 8196
184 Ga0207661_11264135 3300025944 Bacteria 679
185 Ga0207679_10334822 3300025945 Bacteria 1315
186 Ga0207668_10220243 3300025972 Bacteria 1523
187 Ga0207668_10262874 3300025972 Bacteria 1407
188 Ga0207668_11004129 3300025972 Bacteria 746
189 Ga0207640_10865197 3300025981 Bacteria 787
190 Ga0207639_10840222 3300026041 Unclassified 857
191 Ga0207678_10262663 3300026067 Bacteria 1480
192 Ga0207678_10581155 3300026067 Bacteria 981
193 Ga0207708_10052861 3300026075 Unclassified 3094
194 Ga0207708_10075035 3300026075 Bacteria 2592
195 Ga0207708_10602619 3300026075 Bacteria 931
196 Ga0207708_11219884 3300026075 Bacteria 658
197 Ga0207702_10230849 3300026078 Bacteria 1729
198 Ga0207648_11012102 3300026089 Bacteria 778
199 Ga0207674_10809326 3300026116 Bacteria 904
200 Ga0207674_10986347 3300026116 Bacteria 811
201 Ga0207675_100007207 3300026118 Bacteria 10502
202 Ga0207675_101610794 3300026118 Bacteria 670
203 Ga0207683_10083798 3300026121 Bacteria 2833
204 Ga0207428_10021879 3300027907 Bacteria 5406
205 Ga0268265_10148136 3300028380 Bacteria 1976
206 Ga0307408_100038521 3300031548 Bacteria 3374
207 Ga0307408_100053028 3300031548 Bacteria 2927
208 Ga0307405_10032009 3300031731 Bacteria 3103
209 Ga0307405_10747616 3300031731 Bacteria 814
210 Ga0307405_11430301 3300031731 Unclassified 605
211 Ga0307405_11470397 3300031731 Bacteria 598
212 Ga0307405_11512424 3300031731 Bacteria 590
213 Ga0307413_10233320 3300031824 Bacteria 1353
214 Ga0307413_10572641 3300031824 Bacteria 920
215 Ga0307413_10646070 3300031824 Bacteria 872
216 Ga0307410_10024225 3300031852 Bacteria 3789
217 Ga0307410_10057681 3300031852 Bacteria 2645
218 Ga0307410_10072421 3300031852 Bacteria 2393
219 Ga0307410_10336036 3300031852 Bacteria 1203
220 Ga0307410_11789746 3300031852 Bacteria 545
221 Ga0307410_12125138 3300031852 Bacteria 502
222 Ga0307406_10005275 3300031901 Bacteria 7065
223 Ga0307406_10131205 3300031901 Bacteria 1759
224 Ga0307406_10206126 3300031901 Bacteria 1451
225 Ga0307407_10048028 3300031903 Bacteria 2426
226 Ga0307407_10053148 3300031903 Bacteria 2330
227 Ga0307407_10316309 3300031903 Bacteria 1094
228 Ga0307407_10735280 3300031903 Bacteria 746
229 Ga0307412_10159782 3300031911 Unclassified 1673
230 Ga0307412_10356824 3300031911 Bacteria 1176
231 Ga0307412_11543107 3300031911 Bacteria 605
232 Ga0307409_100019766 3300031995 Bacteria 4572
233 Ga0307409_100051862 3300031995 Bacteria 3142
234 Ga0307409_100099666 3300031995 Bacteria 2406
235 Ga0307409_100149818 3300031995 Bacteria 2023
236 Ga0307409_100814119 3300031995 Bacteria 942
237 Ga0307409_101398889 3300031995 Bacteria 726
238 Ga0307409_101645321 3300031995 Bacteria 670
239 Ga0307416_100020134 3300032002 Bacteria 4752
240 Ga0307416_100100620 3300032002 Bacteria 2514
241 Ga0307416_100148029 3300032002 Bacteria 2148
242 Ga0307416_100358114 3300032002 Bacteria 1480
243 Ga0307416_100638170 3300032002 Bacteria 1149
244 Ga0307416_100642354 3300032002 Bacteria 1145
245 Ga0307416_100789705 3300032002 Bacteria 1044
246 Ga0307416_101372848 3300032002 Bacteria 812
247 Ga0307416_102050055 3300032002 Bacteria 674
248 Ga0307414_10049007 3300032004 Bacteria 2918
249 Ga0307411_10496898 3300032005 Bacteria 1030
250 Ga0307411_11269270 3300032005 Bacteria 670
251 Ga0307411_11608191 3300032005 Unclassified 600
252 Ga0307415_100040783 3300032126 Bacteria 3078
253 Ga0307415_100228830 3300032126 Bacteria 1496
254 Ga0307415_100458948 3300032126 Bacteria 1103
255 Ga0307415_100893843 3300032126 Bacteria 818
256 Ga0373940_0218653 3300035088 Unclassified 632
257 Ga0373949_0058395 3300035090 Bacteria 987
258 Ga0373941_0109932 3300035115 Bacteria 970
259 Ga0373960_0015980 3300035121 Bacteria 1924
260 Ga0373961_0005543 3300035241 Bacteria 3033
261 Ga0373931_0668742 3300035691 Bacteria 684
262 Ga0395899_0320955 3300037312 Bacteria 1043
263 Ga0395899_0693503 3300037312 Bacteria 639
264 Ga0395900_0005271 3300037418 Bacteria 13556
265 Ga0395900_0560031 3300037418 Bacteria 1087
266 Ga0395898_0008552 3300037466 Bacteria 10805
267 Ga0395898_0340959 3300037466 Bacteria 1429
268 Ga0395898_1690136 3300037466 Bacteria 556
269 Ga0395905_0043110 3300037471 Bacteria 4233
270 Ga0395905_1247634 3300037471 Bacteria 647
271 Ga0395905_1323383 3300037471 Unclassified 624
272 Ga0395905_1401322 3300037471 Bacteria 603
273 Ga0436364_0034902 3300037853 Bacteria 12619
274 Ga0436364_0087113 3300037853 Unclassified 901
275 Ga0436364_0273608 3300037853 Bacteria 4240
276 Ga0436364_0493476 3300037853 Bacteria 1143
277 Ga0436364_0985449 3300037853 Bacteria 1335
278 Ga0436364_1030028 3300037853 Bacteria 4545
279 Ga0436364_1038287 3300037853 Bacteria 1432
280 Ga0436364_1132411 3300037853 Bacteria 58691
281 Ga0436364_1156703 3300037853 Bacteria 2728
282 Ga0395901_0121531 3300038443 Bacteria 2744
283 Ga0395901_0130062 3300038443 Bacteria 2645
284 Ga0395901_0138301 3300038443 Bacteria 2560
285 Ga0395901_0384002 3300038443 Bacteria 1445
286 Ga0395901_0776584 3300038443 Bacteria 949
287 Ga0395901_1145506 3300038443 Bacteria 746
288 Ga0395901_1595674 3300038443 Bacteria 606
289 Ga0436365_0148001 3300039437 Bacteria 5272
290 Ga0436365_0262453 3300039437 Bacteria 28030
291 Ga0436365_0414932 3300039437 Bacteria 3489
292 Ga0436365_0531671 3300039437 Bacteria 2118
293 Ga0436365_0904156 3300039437 Bacteria 7410
294 Ga0436365_1041860 3300039437 Archaea 551
295 Ga0436365_1146000 3300039437 Bacteria 2721
296 Ga0436365_1174289 3300039437 Bacteria 19637
297 Ga0436365_1694259 3300039437 Bacteria 2550
298 Ga0436360_1156607 3300039438 Bacteria 2188
299 Ga0436361_0690694 3300039447 Bacteria 1137
300 Ga0436361_1073856 3300039447 Bacteria 1026
301 Ga0436363_0023854 3300039450 Bacteria 702
302 Ga0436363_0254906 3300039450 Bacteria 3139
303 Ga0436363_0460114 3300039450 Bacteria 793
304 Ga0436363_0527187 3300039450 Bacteria 1749
305 Ga0436363_0678117 3300039450 Bacteria 33768
306 Ga0436363_0766470 3300039450 Bacteria 2025
307 Ga0436363_0788415 3300039450 Bacteria 1066
308 Ga0436363_1097893 3300039450 Unclassified 631
309 Ga0436363_1185741 3300039450 Bacteria 511
310 Ga0436362_0187948 3300039453 Bacteria 2184
311 Ga0436362_0290569 3300039453 Bacteria 1698
312 Ga0436362_0904988 3300039453 Bacteria 788
313 Ga0436362_0925347 3300039453 Bacteria 2541
314 Ga0451802_0612694 3300041460 Bacteria 600
315 Ga0451807_1686243 3300041486 Bacteria 669
316 Ga0439463_151510 3300042016 Bacteria 601
317 Ga0450888_001932 3300042126 Bacteria 2013
318 Ga0439460_0088760 3300042461 Bacteria 980
319 Ga0439440_0170097 3300042993 Bacteria 633
320 Ga0466969_0301051 3300044656 Bacteria 726
321 Ga0466966_0171856 3300044684 Bacteria 1317
322 Ga0466966_0290457 3300044684 Bacteria 983
323 Ga0466966_0319371 3300044684 Bacteria 933
324 Ga0466961_0304710 3300044693 Bacteria 973
325 Ga0466961_0713042 3300044693 Bacteria 601
326 Ga0466963_0009843 3300044694 Bacteria 5769
327 Ga0466963_0146372 3300044694 Bacteria 1639
328 Ga0466963_0273664 3300044694 Bacteria 1186
329 Ga0466963_0462615 3300044694 Bacteria 895
330 Ga0466963_0463624 3300044694 Bacteria 894
331 Ga0466963_0949901 3300044694 Unclassified 605
332 Ga0466963_1201663 3300044694 Bacteria 533
333 Ga0466963_1282061 3300044694 Unclassified 514
334 Ga0466963_1311929 3300044694 Bacteria 508
335 Ga0466964_0215768 3300044706 Bacteria 929
336 Ga0466964_0231842 3300044706 Bacteria 901
337 Ga0466964_0640733 3300044706 Bacteria 587
338 Ga0466971_0046741 3300044719 Bacteria 1945
339 Ga0466971_0146633 3300044719 Bacteria 1101
340 Ga0466968_0195336 3300044735 Bacteria 946
341 Ga0466970_0717608 3300044765 Unclassified 583
342 Ga0466957_0100591 3300044842 Bacteria 1822
343 Ga0466957_0270913 3300044842 Bacteria 1134
344 Ga0466957_0408617 3300044842 Bacteria 930
345 Ga0466957_1263736 3300044842 Bacteria 535
346 Ga0466959_0103024 3300045049 Bacteria 2042
347 Ga0466959_0449514 3300045049 Bacteria 873
348 Ga0466959_0796434 3300045049 Bacteria 632
349 Ga0466959_0838243 3300045049 Bacteria 614
350 Ga0466958_0000261 3300045836 Bacteria 20448
351 Ga0466958_0186641 3300045836 Bacteria 1317
352 Ga0466958_0384157 3300045836 Bacteria 906
353 Ga0466967_0041581 3300045976 Bacteria 3965
354 Ga0466967_0074826 3300045976 Bacteria 3043
355 Ga0466967_0096110 3300045976 Bacteria 2702
356 Ga0466967_0238016 3300045976 Bacteria 1735
357 Ga0466967_0741194 3300045976 Bacteria 974
358 Ga0466967_1132545 3300045976 Bacteria 780
359 Ga0466967_1232289 3300045976 Unclassified 745
360 Ga0466967_1572797 3300045976 Bacteria 655
361 Ga0495605_0239454 3300046474 Bacteria 779
362 Ga0495584_0242232 3300046491 Bacteria 917
363 Ga0495644_0346157 3300046523 Bacteria 585
364 Ga0495663_0179951 3300046525 Bacteria 732
365 Ga0495642_0411444 3300046528 Bacteria 597
366 Ga0495654_0178292 3300046530 Bacteria 922
367 Ga0495609_0217280 3300046538 Bacteria 795
368 Ga0495656_0191207 3300046615 Bacteria 1011
369 Ga0495656_0687099 3300046615 Bacteria 550
370 Ga0495656_0738224 3300046615 Bacteria 531
371 Ga0495668_0111940 3300046616 Bacteria 1493
372 Ga0495661_0419499 3300046665 Bacteria 648
373 Ga0495661_0461663 3300046665 Bacteria 610
374 Ga0495670_0836942 3300046691 Unclassified 502
375 Ga0495674_1045331 3300047319 Bacteria 624
376 Ga0495680_0653746 3300047322 Unclassified 698
377 Ga0495626_0324412 3300048091 Bacteria 605
378 Ga0496102_1522619 3300048905 Bacteria 587
379 Ga0496103_0356099 3300048906 Bacteria 941
380 Ga0496108_0403792 3300048911 Bacteria 1193
381 Ga0496108_1611058 3300048911 Bacteria 537
382 Ga0496109_0173390 3300048912 Bacteria 2024
383 Ga0496109_0221465 3300048912 Bacteria 1779
384 Ga0496109_0955079 3300048912 Unclassified 795
385 Ga0496109_0990914 3300048912 Bacteria 778
386 Ga0496110_0226415 3300048913 Bacteria 1700
387 Ga0496110_0508630 3300048913 Bacteria 1096
388 Ga0496111_0758754 3300048914 Bacteria 703
389 Ga0496111_1347330 3300048914 Bacteria 501
390 Ga0496112_0034744 3300048915 Bacteria 4907
391 Ga0496112_0118476 3300048915 Bacteria 2618
392 Ga0496112_0132053 3300048915 Bacteria 2468
393 Ga0496113_0113159 3300048916 Bacteria 2115
394 Ga0496113_0598960 3300048916 Bacteria 883
395 Ga0496113_0768800 3300048916 Bacteria 766
396 Ga0501317_097505 3300049533 Bacteria 527
397 Ga0501031_0237557 3300049568 Bacteria 1185
398 Ga0501031_0603602 3300049568 Bacteria 706
399 Ga0501036_0858338 3300049572 Bacteria 746
400 Ga0501039_0311258 3300049575 Bacteria 1238
401 Ga0501039_1219226 3300049575 Bacteria 582
402 Ga0501040_0382050 3300049576 Bacteria 1010
403 Ga0501041_0734569 3300049577 Bacteria 632
404 Ga0501042_0488442 3300049578 Bacteria 894
405 Ga0501048_0156279 3300049582 Bacteria 1613
406 Ga0501070_0647019 3300049586 Bacteria 840
407 Ga0501070_0801131 3300049586 Bacteria 740
408 Ga0501072_0345223 3300049588 Bacteria 1182
409 Ga0501072_0461056 3300049588 Bacteria 1006
410 Ga0501074_0604940 3300049590 Bacteria 775
411 Ga0501075_0182002 3300049591 Bacteria 1603
412 Ga0501075_0379423 3300049591 Bacteria 1078
413 Ga0501076_0043205 3300049592 Bacteria 3550
414 Ga0501076_0483955 3300049592 Bacteria 1020
415 Ga0501076_1520941 3300049592 Unclassified 549
416 Ga0501209_235990 3300049656 Bacteria 569
417 Ga0501079_0063537 3300049741 Bacteria 2848
418 Ga0501081_0193975 3300049743 Bacteria 1471
419 Ga0501045_0291079 3300049824 Bacteria 1215
420 Ga0501045_0907562 3300049824 Bacteria 647
421 nmdc:mga03n38_356576_c1 3300050490 Bacteria 797
422 nmdc:mga0yw44_144471_c1 3300050492 Bacteria 1548
423 nmdc:mga0yw44_647794_c1 3300050492 Bacteria 718
424 nmdc:mga06z11_366488_c1 3300050494 Bacteria 864
425 nmdc:mga05p37_1309260_c1 3300050507 Bacteria 738
426 nmdc:mga05p37_14553_c1 3300050507 Bacteria 9448
427 nmdc:mga05p37_514559_c1 3300050507 Bacteria 1370
428 nmdc:mga09592_206835_c1 3300050508 Bacteria 1700
429 nmdc:mga09592_654336_c1 3300050508 Bacteria 897
430 nmdc:mga0qj67_115016_c1 3300050509 Bacteria 2173
431 nmdc:mga0qj67_198139_c1 3300050509 Bacteria 1632
432 nmdc:mga0qj67_26177_c1 3300050509 Bacteria 4514
433 nmdc:mga0qj67_787446_c1 3300050509 Bacteria 753
434 nmdc:mga0qj67_850608_c1 3300050509 Bacteria 720
435 nmdc:mga06r32_170405_c1 3300050510 Bacteria 2161
436 nmdc:mga06r32_264065_c1 3300050510 Bacteria 1709
437 nmdc:mga08y16_1066300_c1 3300050511 Bacteria 785
438 nmdc:mga08y16_66206_c1 3300050511 Bacteria 3771
439 nmdc:mga0n895_1118634_c1 3300050512 Bacteria 764
440 nmdc:mga0n895_300442_c1 3300050512 Bacteria 1627
441 nmdc:mga0rr50_1024980_c1 3300050513 Bacteria 703
442 nmdc:mga0a205_1502837_c1 3300050515 Bacteria 522
443 nmdc:mga0a205_21789_c1 3300050515 Bacteria 6059
444 Ga0495612_0204056 3300053078 Bacteria 873
445 Ga0495655_0009153 3300053083 Bacteria 1910
446 Ga0495595_0284983 3300053084 Bacteria 830
447 Ga0501084_0517113 3300054114 Bacteria 1009
448 Ga0590071_213410 3300059421 Unclassified 509
449 Ga0501082_0146526 3300060353 Bacteria 2050
450 Ga0501082_0611627 3300060353 Bacteria 954
451 Ga0466962_0104594 3300061719 Bacteria 1360
452 Ga0466962_0757431 3300061719 Bacteria 500
453 Ga0530510_0040226 3300061734 Bacteria 3374
454 Ga0530510_0267110 3300061734 Bacteria 1277
455 Ga0070683_100001825
456 JGI25407J50210_10002681
457 JGI25407J50210_10008612
458 JGI25407J50210_10009454
459 JGI25407J50210_10023708
460 JGI25407J50210_10041829
461 JGI25407J50210_10059492
462 JGI25407J50210_10110715
463 Ga0070680_100642705
464 Ga0070680_100666064
465 Ga0070680_101310633
466 Ga0070660_101702282
467 Ga0070691_10550952
468 Ga0070661_100812637
469 Ga0070661_100864915
470 Ga0070661_101034741
471 Ga0070692_10116785
472 Ga0070692_10380879
473 Ga0070692_10600744
474 Ga0070668_100108114
475 Ga0070669_100433525
476 Ga0070659_102100704
477 Ga0070714_100062956
478 Ga0070711_101632613
479 Ga0070700_100144923
480 Ga0070700_101118221
481 Ga0070700_101732476
482 Ga0070678_101002145
483 Ga0070662_100185984
484 Ga0070662_100194821
485 Ga0070662_100858777
486 Ga0070681_10388385
487 Ga0068867_101524165
488 Ga0070679_100290299
489 Ga0070679_100335391
490 Ga0070684_100210322
491 Ga0070684_100350675
492 Ga0070684_101289484
493 Ga0070684_101918766
494 Ga0068853_101217096
495 Ga0070695_100132893
496 Ga0070696_100034776
497 Ga0070693_100473854
498 Ga0070704_100518377
499 Ga0070704_101290121
500 Ga0070664_101600996
501 Ga0068854_100059121
502 Ga0068854_100363607
503 Ga0068854_101068377
504 Ga0068854_101643590
505 Ga0068856_100257604
506 Ga0070702_100261946
507 Ga0070702_100365694
508 Ga0068852_100385021
509 Ga0068866_11265045
510 Ga0068861_100009502
511 Ga0068861_102646269
512 Ga0068862_100250479
513 Ga0081455_10025718
514 Ga0081455_10082537
515 Ga0081455_10247282
516 Ga0081538_10000750
517 Ga0081538_10000953
518 Ga0081538_10000963
519 Ga0081538_10001919
520 Ga0081538_10002876
521 Ga0081538_10003307
522 Ga0081538_10006729
523 Ga0081538_10007687
524 Ga0081538_10013289
525 Ga0081538_10013636
526 Ga0081538_10032774
527 Ga0081538_10037359
528 Ga0081538_10060414
529 Ga0081538_10115254
530 Ga0081538_10136255
531 Ga0081538_10150315
532 Ga0081538_10218032
533 Ga0081538_10259131
534 Ga0081539_10041633
535 Ga0075363_100127440
536 Ga0075364_10313602
537 Ga0075364_10697569
538 Ga0075432_10040035
539 Ga0075428_100029426
540 Ga0075428_100069055
541 Ga0075428_100201835
542 Ga0075428_100235518
543 Ga0075428_100492712
544 Ga0075430_100007186
545 Ga0075430_100064326
546 Ga0075430_100121797
547 Ga0075431_100030038
548 Ga0075431_100437761
549 Ga0075433_10062934
550 Ga0075434_101228827
551 Ga0075434_101494635
552 Ga0075429_100190708
553 Ga0068865_100983652
554 Ga0075435_100881267
555 Ga0105240_10327149
556 Ga0111539_10012332
557 Ga0111539_10034628
558 Ga0111539_10801191
559 Ga0111539_12343401
560 Ga0111539_13370001
561 Ga0105245_10012415
562 Ga0105245_10295588
563 Ga0105245_10407660
564 Ga0105245_12752998
565 Ga0114129_10016879
566 Ga0114129_11100530
567 Ga0114129_11815328
568 Ga0105243_11020553
569 Ga0105243_11247055
570 Ga0105238_10976963
571 Ga0105238_11241791
572 Ga0105249_10002549
573 Ga0105249_11194342
574 Ga0105239_11044809
575 Ga0105239_13610183
576 Ga0105246_11373401
577 Ga0157369_11158481
578 Ga0157378_11187487
579 Ga0163162_10092175
580 Ga0157372_10200081
581 Ga0163163_10902790
582 Ga0163163_11871050
583 Ga0182008_10602008
584 Ga0163161_10132419
585 Ga0197907_10617764
586 Ga0197907_10885265
587 Ga0206352_10223583
588 Ga0206350_10505195
589 Ga0206354_11035504
590 Ga0206353_11431017
591 Ga0206353_11811917
592 Ga0213873_10203298
593 Ga0213872_10227112
594 Ga0213874_10000485
595 Ga0213874_10013331
596 Ga0213874_10061611
597 Ga0213876_10008089
598 Ga0213876_10012574
599 Ga0213876_10014154
600 Ga0213876_10041130
601 Ga0213876_10270502
602 Ga0213876_10601882
603 Ga0213875_10010839
604 Ga0213875_10012464
605 Ga0213875_10045426
606 Ga0213875_10098376
607 Ga0213875_10636226
608 Ga0224712_10171918
609 Ga0224712_10188808
610 Ga0207642_10728042
611 Ga0207688_10354401
612 Ga0207645_10080266
613 Ga0207707_10891220
614 Ga0207707_11018405
615 Ga0207695_10238492
616 Ga0207663_10027684
617 Ga0207660_11207347
618 Ga0207657_10334736
619 Ga0207649_10258665
620 Ga0207652_10309576
621 Ga0207694_11060883
622 Ga0207687_10103241
623 Ga0207687_11438263
624 Ga0207700_11534360
625 Ga0207664_10160922
626 Ga0207664_10488368
627 Ga0207690_10594474
628 Ga0207690_11782712
629 Ga0207690_11872472
630 Ga0207706_10002182
631 Ga0207706_10081597
632 Ga0207686_10378796
633 Ga0207709_10672152
634 Ga0207669_10549388
635 Ga0207704_10514784
636 Ga0207704_11679884
637 Ga0207661_10006609
638 Ga0207661_11264135
639 Ga0207679_10334822
640 Ga0207668_10220243
641 Ga0207668_10262874
642 Ga0207668_11004129
643 Ga0207640_10865197
644 Ga0207639_10840222
645 Ga0207678_10262663
646 Ga0207678_10581155
647 Ga0207708_10052861
648 Ga0207708_10075035
649 Ga0207708_10602619
650 Ga0207708_11219884
651 Ga0207702_10230849
652 Ga0207648_11012102
653 Ga0207674_10809326
654 Ga0207674_10986347
655 Ga0207675_100007207
656 Ga0207675_101610794
657 Ga0207683_10083798
658 Ga0207428_10021879
659 Ga0268265_10148136
660 Ga0307408_100038521
661 Ga0307408_100053028
662 Ga0307405_10032009
663 Ga0307405_10747616
664 Ga0307405_11430301
665 Ga0307405_11470397
666 Ga0307405_11512424
667 Ga0307413_10233320
668 Ga0307413_10572641
669 Ga0307413_10646070
670 Ga0307410_10024225
671 Ga0307410_10057681
672 Ga0307410_10072421
673 Ga0307410_10336036
674 Ga0307410_11789746
675 Ga0307410_12125138
676 Ga0307406_10005275
677 Ga0307406_10131205
678 Ga0307406_10206126
679 Ga0307407_10048028
680 Ga0307407_10053148
681 Ga0307407_10316309
682 Ga0307407_10735280
683 Ga0307412_10159782
684 Ga0307412_10356824
685 Ga0307412_11543107
686 Ga0307409_100019766
687 Ga0307409_100051862
688 Ga0307409_100099666
689 Ga0307409_100149818
690 Ga0307409_100814119
691 Ga0307409_101398889
692 Ga0307409_101645321
693 Ga0307416_100020134
694 Ga0307416_100100620
695 Ga0307416_100148029
696 Ga0307416_100358114
697 Ga0307416_100638170
698 Ga0307416_100642354
699 Ga0307416_100789705
700 Ga0307416_101372848
701 Ga0307416_102050055
702 Ga0307414_10049007
703 Ga0307411_10496898
704 Ga0307411_11269270
705 Ga0307411_11608191
706 Ga0307415_100040783
707 Ga0307415_100228830
708 Ga0307415_100458948
709 Ga0307415_100893843
710 Ga0373940_0218653
711 Ga0373949_0058395
712 Ga0373941_0109932
713 Ga0373960_0015980
714 Ga0373961_0005543
715 Ga0373931_0668742
716 Ga0395899_0320955
717 Ga0395899_0693503
718 Ga0395900_0005271
719 Ga0395900_0560031
720 Ga0395898_0008552
721 Ga0395898_0340959
722 Ga0395898_1690136
723 Ga0395905_0043110
724 Ga0395905_1247634
725 Ga0395905_1323383
726 Ga0395905_1401322
727 Ga0436364_0034902
728 Ga0436364_0087113
729 Ga0436364_0273608
730 Ga0436364_0493476
731 Ga0436364_0985449
732 Ga0436364_1030028
733 Ga0436364_1038287
734 Ga0436364_1132411
735 Ga0436364_1156703
736 Ga0395901_0121531
737 Ga0395901_0130062
738 Ga0395901_0138301
739 Ga0395901_0384002
740 Ga0395901_0776584
741 Ga0395901_1145506
742 Ga0395901_1595674
743 Ga0436365_0148001
744 Ga0436365_0262453
745 Ga0436365_0414932
746 Ga0436365_0531671
747 Ga0436365_0904156
748 Ga0436365_1041860
749 Ga0436365_1146000
750 Ga0436365_1174289
751 Ga0436365_1694259
752 Ga0436360_1156607
753 Ga0436361_0690694
754 Ga0436361_1073856
755 Ga0436363_0023854
756 Ga0436363_0254906
757 Ga0436363_0460114
758 Ga0436363_0527187
759 Ga0436363_0678117
760 Ga0436363_0766470
761 Ga0436363_0788415
762 Ga0436363_1097893
763 Ga0436363_1185741
764 Ga0436362_0187948
765 Ga0436362_0290569
766 Ga0436362_0904988
767 Ga0436362_0925347
768 Ga0451802_0612694
769 Ga0451807_1686243
770 Ga0439463_151510
771 Ga0450888_001932
772 Ga0439460_0088760
773 Ga0439440_0170097
774 Ga0466969_0301051
775 Ga0466966_0171856
776 Ga0466966_0290457
777 Ga0466966_0319371
778 Ga0466961_0304710
779 Ga0466961_0713042
780 Ga0466963_0009843
781 Ga0466963_0146372
782 Ga0466963_0273664
783 Ga0466963_0462615
784 Ga0466963_0463624
785 Ga0466963_0949901
786 Ga0466963_1201663
787 Ga0466963_1282061
788 Ga0466963_1311929
789 Ga0466964_0215768
790 Ga0466964_0231842
791 Ga0466964_0640733
792 Ga0466971_0046741
793 Ga0466971_0146633
794 Ga0466968_0195336
795 Ga0466970_0717608
796 Ga0466957_0100591
797 Ga0466957_0270913
798 Ga0466957_0408617
799 Ga0466957_1263736
800 Ga0466959_0103024
801 Ga0466959_0449514
802 Ga0466959_0796434
803 Ga0466959_0838243
804 Ga0466958_0000261
805 Ga0466958_0186641
806 Ga0466958_0384157
807 Ga0466967_0041581
808 Ga0466967_0074826
809 Ga0466967_0096110
810 Ga0466967_0238016
811 Ga0466967_0741194
812 Ga0466967_1132545
813 Ga0466967_1232289
814 Ga0466967_1572797
815 Ga0495605_0239454
816 Ga0495584_0242232
817 Ga0495644_0346157
818 Ga0495663_0179951
819 Ga0495642_0411444
820 Ga0495654_0178292
821 Ga0495609_0217280
822 Ga0495656_0191207
823 Ga0495656_0687099
824 Ga0495656_0738224
825 Ga0495668_0111940
826 Ga0495661_0419499
827 Ga0495661_0461663
828 Ga0495670_0836942
829 Ga0495674_1045331
830 Ga0495680_0653746
831 Ga0495626_0324412
832 Ga0496102_1522619
833 Ga0496103_0356099
834 Ga0496108_0403792
835 Ga0496108_1611058
836 Ga0496109_0173390
837 Ga0496109_0221465
838 Ga0496109_0955079
839 Ga0496109_0990914
840 Ga0496110_0226415
841 Ga0496110_0508630
842 Ga0496111_0758754
843 Ga0496111_1347330
844 Ga0496112_0034744
845 Ga0496112_0118476
846 Ga0496112_0132053
847 Ga0496113_0113159
848 Ga0496113_0598960
849 Ga0496113_0768800
850 Ga0501317_097505
851 Ga0501031_0237557
852 Ga0501031_0603602
853 Ga0501036_0858338
854 Ga0501039_0311258
855 Ga0501039_1219226
856 Ga0501040_0382050
857 Ga0501041_0734569
858 Ga0501042_0488442
859 Ga0501048_0156279
860 Ga0501070_0647019
861 Ga0501070_0801131
862 Ga0501072_0345223
863 Ga0501072_0461056
864 Ga0501074_0604940
865 Ga0501075_0182002
866 Ga0501075_0379423
867 Ga0501076_0043205
868 Ga0501076_0483955
869 Ga0501076_1520941
870 Ga0501209_235990
871 Ga0501079_0063537
872 Ga0501081_0193975
873 Ga0501045_0291079
874 Ga0501045_0907562
875 nmdc:mga03n38_356576_c1
876 nmdc:mga0yw44_144471_c1
877 nmdc:mga0yw44_647794_c1
878 nmdc:mga06z11_366488_c1
879 nmdc:mga05p37_1309260_c1
880 nmdc:mga05p37_14553_c1
881 nmdc:mga05p37_514559_c1
882 nmdc:mga09592_206835_c1
883 nmdc:mga09592_654336_c1
884 nmdc:mga0qj67_115016_c1
885 nmdc:mga0qj67_198139_c1
886 nmdc:mga0qj67_26177_c1
887 nmdc:mga0qj67_787446_c1
888 nmdc:mga0qj67_850608_c1
889 nmdc:mga06r32_170405_c1
890 nmdc:mga06r32_264065_c1
891 nmdc:mga08y16_1066300_c1
892 nmdc:mga08y16_66206_c1
893 nmdc:mga0n895_1118634_c1
894 nmdc:mga0n895_300442_c1
895 nmdc:mga0rr50_1024980_c1
896 nmdc:mga0a205_1502837_c1
897 nmdc:mga0a205_21789_c1
898 Ga0495612_0204056
899 Ga0495655_0009153
900 Ga0495595_0284983
901 Ga0501084_0517113
902 Ga0590071_213410
903 Ga0501082_0146526
904 Ga0501082_0611627
905 Ga0466962_0104594
906 Ga0466962_0757431
907 Ga0530510_0040226
908 Ga0530510_0267110

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22743

PspAA

PspA-Associated protein

1

93

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nw9-assembly1.cif.gz_B crystal structure of tryptophan 2,3-dioxygenase (tdo) from xanthomonas campestris in complex with ferrous heme and 6-fluoro-tryptophan. northeast structural genomics target xcr13 1.006 16 50
7rdr-assembly1.cif.gz_A circular tandem repeat protein with novel repeat topology and enhanced subunit contact surfaces 0.9898 17 52
6e9r-assembly1.cif.gz_B dhf46 filament 0.9897 14 50
6ei6-assembly2.cif.gz_B cc2d1b coordinates esrct-iii activity during the mitotic reformation of the nuclear envelope 0.9746 15 50
8fiq-assembly1.cif.gz_A multi-state design of two-state switchable hinge proteins 0.9726 15 50
ID Description Score Start End Superfamily
2nw9B00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 1.006 16 50 1.20.58.480
af_A4HS36_54_357_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9981 17 52 1.25.40.10
af_F4IB75_8_187_1.20.1260.60 Mainly Alpha;Up-down Bundle;Ferritin;Vacuolar protein sorting-associated protein Ist1 0.9951 16 50 1.20.1260.60
5xflC02 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.9926 16 50 1.20.120.230
af_I1K4U3_1_326_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9859 16 53 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A7W1MY19-F1-model_v4 PspA-associated domain-containing protein 1 1 59
AF-A0A0U5IJC5-F1-model_v4 Multi-sensor hybrid histidine kinase 0.9937 13 48 GO:0000160
GO:0004672
GO:0005524
GO:0005886
AF-A0A0K2QW16-F1-model_v4 deleted 0.9873 13 52
AF-A0A7C2BIG1-F1-model_v4 PspA-associated domain-containing protein 0.9847 1 92
AF-A0A7W1MY19-F1-model_v4 PspA-associated domain-containing protein 0.9833 1 59

Map