F447317
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 454 | 252 | 454 | 260 |
Family's Representative Sequence
| Representative Sequence | 3300005327|Ga0070658_10376320|Ga0070658_103763203 |
| Length | 267 |
| Sequence | VNVDQLIAQFGEQQVASFMLVLGRVGPLFLLAPMFSSRMMPARAKGVAAVALAIGIAPVAMRAAGSASGHLPDDVLGFAGLMFKEILVGTAFAFALGAFFAAVSVAGTLLDTFVGFSFGSLVDPVTGNAGGALNQLYALVGVGIFIAIGGDTWVITGLARTYEAVPLLSAPDIGSLVEGMQVAFSGIFGAALEVCAPVLLAVVLTDAAFGVVSKVVPQLNVFAVGFPAKVTVGLVVIGASLPFLAGWLDDELQRSVASALHALKVAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 48 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 51 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 53 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 54 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 57 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 58 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 59 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 128 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 129 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 130 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 131 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 132 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 133 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 134 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 135 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 136 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 137 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 138 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 139 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 140 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 141 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 142 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 143 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 144 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 145 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 146 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 147 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 148 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 149 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 150 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 151 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 152 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 153 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 154 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 155 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 156 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 157 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 158 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 159 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 160 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 161 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 162 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 163 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 164 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 165 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 166 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 167 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 168 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 190 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 191 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 192 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 193 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 194 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 195 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 196 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 197 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 199 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 200 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 201 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 202 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 203 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 204 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 205 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 206 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 207 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 208 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 209 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 210 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 211 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 247 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 248 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 249 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 252 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.88 |
| Nodule | 0 |
| Rhizoplane | 8.15 |
| Rhizosphere | 86.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10005493 | 3300001979 | Bacteria | 5357 |
| 2 | JGI24743J22301_10004039 | 3300001991 | Bacteria | 2362 |
| 3 | JGI25407J50210_10016653 | 3300003373 | Bacteria | 1904 |
| 4 | Ga0070658_10246340 | 3300005327 | Bacteria | 1516 |
| 5 | Ga0070658_10376320 | 3300005327 | Bacteria | 1218 |
| 6 | Ga0070683_100074598 | 3300005329 | Bacteria | 3168 |
| 7 | Ga0070683_100346518 | 3300005329 | Bacteria | 1415 |
| 8 | Ga0068869_100038071 | 3300005334 | Bacteria | 3424 |
| 9 | Ga0068869_100320399 | 3300005334 | Unclassified | 1257 |
| 10 | Ga0070666_10362507 | 3300005335 | Bacteria | 1038 |
| 11 | Ga0070682_100056010 | 3300005337 | Bacteria | 2478 |
| 12 | Ga0070682_100065706 | 3300005337 | Bacteria | 2306 |
| 13 | Ga0068868_100050716 | 3300005338 | Bacteria | 3260 |
| 14 | Ga0068868_100082853 | 3300005338 | Bacteria | 2573 |
| 15 | Ga0068868_100349385 | 3300005338 | Bacteria | 1266 |
| 16 | Ga0070660_100023186 | 3300005339 | Bacteria | 4597 |
| 17 | Ga0070660_100279119 | 3300005339 | Bacteria | 1367 |
| 18 | Ga0070689_100018764 | 3300005340 | Bacteria | 5102 |
| 19 | Ga0070691_10117503 | 3300005341 | Bacteria | 1336 |
| 20 | Ga0070687_100030116 | 3300005343 | Bacteria | 2650 |
| 21 | Ga0070661_100102786 | 3300005344 | Bacteria | 2127 |
| 22 | Ga0070661_100184467 | 3300005344 | Bacteria | 1589 |
| 23 | Ga0070661_100506513 | 3300005344 | Bacteria | 967 |
| 24 | Ga0070668_100139111 | 3300005347 | Bacteria | 1955 |
| 25 | Ga0070675_100178778 | 3300005354 | Bacteria | 1833 |
| 26 | Ga0070674_100062356 | 3300005356 | Bacteria | 2605 |
| 27 | Ga0070673_100291304 | 3300005364 | Bacteria | 1434 |
| 28 | Ga0070688_100006905 | 3300005365 | Bacteria | 6094 |
| 29 | Ga0070659_100000002 | 3300005366 | Bacteria | 369239 |
| 30 | Ga0070659_100242630 | 3300005366 | Bacteria | 1492 |
| 31 | Ga0070667_100002431 | 3300005367 | Bacteria | 16284 |
| 32 | Ga0070667_100220598 | 3300005367 | Bacteria | 1688 |
| 33 | Ga0070703_10110714 | 3300005406 | Bacteria | 982 |
| 34 | Ga0070714_100000019 | 3300005435 | Bacteria | 169455 |
| 35 | Ga0070714_100058067 | 3300005435 | Bacteria | 3313 |
| 36 | Ga0070714_100213810 | 3300005435 | Bacteria | 1769 |
| 37 | Ga0070714_100399667 | 3300005435 | Bacteria | 1298 |
| 38 | Ga0070713_100024779 | 3300005436 | Bacteria | 4681 |
| 39 | Ga0070713_100213376 | 3300005436 | Bacteria | 1748 |
| 40 | Ga0070710_10000007 | 3300005437 | Bacteria | 215320 |
| 41 | Ga0070710_10011679 | 3300005437 | Bacteria | 4345 |
| 42 | Ga0070710_10326528 | 3300005437 | Bacteria | 1009 |
| 43 | Ga0070701_10128817 | 3300005438 | Bacteria | 1435 |
| 44 | Ga0070711_100022507 | 3300005439 | Bacteria | 4086 |
| 45 | Ga0070711_100129065 | 3300005439 | Bacteria | 1880 |
| 46 | Ga0070705_100002330 | 3300005440 | Bacteria | 9581 |
| 47 | Ga0070700_100066722 | 3300005441 | Bacteria | 2285 |
| 48 | Ga0070663_100013344 | 3300005455 | Bacteria | 5235 |
| 49 | Ga0070663_100072369 | 3300005455 | Bacteria | 2511 |
| 50 | Ga0070662_100110949 | 3300005457 | Bacteria | 2089 |
| 51 | Ga0070681_10120990 | 3300005458 | Bacteria | 2553 |
| 52 | Ga0068867_100082799 | 3300005459 | Bacteria | 2421 |
| 53 | Ga0068867_100153147 | 3300005459 | Bacteria | 1813 |
| 54 | Ga0070685_10117116 | 3300005466 | Bacteria | 1649 |
| 55 | Ga0070679_100004738 | 3300005530 | Bacteria | 12543 |
| 56 | Ga0068853_100684135 | 3300005539 | Bacteria | 978 |
| 57 | Ga0070672_100043362 | 3300005543 | Bacteria | 3468 |
| 58 | Ga0070665_100001875 | 3300005548 | Bacteria | 23884 |
| 59 | Ga0070665_100025731 | 3300005548 | Bacteria | 5928 |
| 60 | Ga0070665_100139022 | 3300005548 | Bacteria | 2432 |
| 61 | Ga0070665_100606386 | 3300005548 | Bacteria | 1108 |
| 62 | Ga0070665_100738086 | 3300005548 | Bacteria | 998 |
| 63 | Ga0070704_100128986 | 3300005549 | Bacteria | 1956 |
| 64 | Ga0070664_100148545 | 3300005564 | Bacteria | 2068 |
| 65 | Ga0070664_100389371 | 3300005564 | Bacteria | 1273 |
| 66 | Ga0070664_100435273 | 3300005564 | Bacteria | 1202 |
| 67 | Ga0070664_100489856 | 3300005564 | Bacteria | 1132 |
| 68 | Ga0068857_100203168 | 3300005577 | Bacteria | 1806 |
| 69 | Ga0068854_100020848 | 3300005578 | Bacteria | 4440 |
| 70 | Ga0068856_100398174 | 3300005614 | Bacteria | 1397 |
| 71 | Ga0068856_100567789 | 3300005614 | Bacteria | 1156 |
| 72 | Ga0070702_100027104 | 3300005615 | Bacteria | 3087 |
| 73 | Ga0068852_100107822 | 3300005616 | Bacteria | 2527 |
| 74 | Ga0068852_100215774 | 3300005616 | Bacteria | 1823 |
| 75 | Ga0068859_100099840 | 3300005617 | Bacteria | 2958 |
| 76 | Ga0068866_10033301 | 3300005718 | Bacteria | 2499 |
| 77 | Ga0068861_100033238 | 3300005719 | Bacteria | 3803 |
| 78 | Ga0068861_100039727 | 3300005719 | Bacteria | 3514 |
| 79 | Ga0068861_100210955 | 3300005719 | Bacteria | 1636 |
| 80 | Ga0068861_100534842 | 3300005719 | Unclassified | 1065 |
| 81 | Ga0068858_100102020 | 3300005842 | Bacteria | 2676 |
| 82 | Ga0081455_10026307 | 3300005937 | Bacteria | 5355 |
| 83 | Ga0081455_10321265 | 3300005937 | Bacteria | 1102 |
| 84 | Ga0081538_10000665 | 3300005981 | Bacteria | 37855 |
| 85 | Ga0081538_10010972 | 3300005981 | Bacteria | 7377 |
| 86 | Ga0081540_1001663 | 3300005983 | Bacteria | 18921 |
| 87 | Ga0081540_1032658 | 3300005983 | Bacteria | 2838 |
| 88 | Ga0081540_1035945 | 3300005983 | Bacteria | 2649 |
| 89 | Ga0081539_10003690 | 3300005985 | Bacteria | 18292 |
| 90 | Ga0081539_10007612 | 3300005985 | Bacteria | 9781 |
| 91 | Ga0081539_10018156 | 3300005985 | Bacteria | 4896 |
| 92 | Ga0070717_10000024 | 3300006028 | Bacteria | 158890 |
| 93 | Ga0070717_10061046 | 3300006028 | Bacteria | 3123 |
| 94 | Ga0070712_100000021 | 3300006175 | Bacteria | 83687 |
| 95 | Ga0070712_100188196 | 3300006175 | Bacteria | 1613 |
| 96 | Ga0075428_100611359 | 3300006844 | Bacteria | 1164 |
| 97 | Ga0075428_100679820 | 3300006844 | Bacteria | 1097 |
| 98 | Ga0075430_100000833 | 3300006846 | Bacteria | 24117 |
| 99 | Ga0075434_100545878 | 3300006871 | Bacteria | 1179 |
| 100 | Ga0068865_100137365 | 3300006881 | Bacteria | 1839 |
| 101 | Ga0097620_100099840 | 3300006931 | Bacteria | 2958 |
| 102 | Ga0105244_10100310 | 3300009036 | Bacteria | 1417 |
| 103 | Ga0105240_10042190 | 3300009093 | Bacteria | 5815 |
| 104 | Ga0105240_10241646 | 3300009093 | Bacteria | 2093 |
| 105 | Ga0105245_10006824 | 3300009098 | Bacteria | 10018 |
| 106 | Ga0105245_10084221 | 3300009098 | Bacteria | 2912 |
| 107 | Ga0105245_10088301 | 3300009098 | Bacteria | 2847 |
| 108 | Ga0105245_10131983 | 3300009098 | Bacteria | 2344 |
| 109 | Ga0105247_10072462 | 3300009101 | Bacteria | 2156 |
| 110 | Ga0105247_10110492 | 3300009101 | Bacteria | 1769 |
| 111 | Ga0105243_10080439 | 3300009148 | Bacteria | 2658 |
| 112 | Ga0105243_10092154 | 3300009148 | Bacteria | 2497 |
| 113 | Ga0105243_10304705 | 3300009148 | Bacteria | 1445 |
| 114 | Ga0105241_10338247 | 3300009174 | Bacteria | 1303 |
| 115 | Ga0105242_10162262 | 3300009176 | Bacteria | 1957 |
| 116 | Ga0105242_10492301 | 3300009176 | Bacteria | 1164 |
| 117 | Ga0105237_10492748 | 3300009545 | Bacteria | 1232 |
| 118 | Ga0105238_10100129 | 3300009551 | Bacteria | 2881 |
| 119 | Ga0105238_10273638 | 3300009551 | Bacteria | 1669 |
| 120 | Ga0105238_10319885 | 3300009551 | Bacteria | 1537 |
| 121 | Ga0105249_10050371 | 3300009553 | Bacteria | 3796 |
| 122 | Ga0105249_10340584 | 3300009553 | Bacteria | 1516 |
| 123 | Ga0105249_10402746 | 3300009553 | Bacteria | 1399 |
| 124 | Ga0105239_10091093 | 3300010375 | Bacteria | 3365 |
| 125 | Ga0105239_10102484 | 3300010375 | Bacteria | 3167 |
| 126 | Ga0105239_10955817 | 3300010375 | Bacteria | 984 |
| 127 | Ga0105239_11017418 | 3300010375 | Bacteria | 953 |
| 128 | Ga0105246_10003723 | 3300011119 | Bacteria | 9231 |
| 129 | Ga0105246_10058444 | 3300011119 | Bacteria | 2672 |
| 130 | Ga0105246_10226338 | 3300011119 | Bacteria | 1469 |
| 131 | Ga0157369_10391806 | 3300013105 | Bacteria | 1441 |
| 132 | Ga0157378_10117761 | 3300013297 | Bacteria | 2444 |
| 133 | Ga0163162_10492758 | 3300013306 | Bacteria | 1356 |
| 134 | Ga0157375_10380374 | 3300013308 | Bacteria | 1578 |
| 135 | Ga0163163_10486471 | 3300014325 | Bacteria | 1295 |
| 136 | Ga0157380_10050202 | 3300014326 | Bacteria | 3294 |
| 137 | Ga0157376_10214803 | 3300014969 | Bacteria | 1778 |
| 138 | Ga0157376_10244157 | 3300014969 | Bacteria | 1674 |
| 139 | Ga0207426_1007947 | 3300025302 | Bacteria | 4369 |
| 140 | Ga0207692_10000001 | 3300025898 | Bacteria | 558345 |
| 141 | Ga0207692_10033546 | 3300025898 | Bacteria | 2478 |
| 142 | Ga0207692_10125689 | 3300025898 | Bacteria | 1442 |
| 143 | Ga0207642_10233582 | 3300025899 | Bacteria | 1034 |
| 144 | Ga0207710_10100783 | 3300025900 | Bacteria | 1362 |
| 145 | Ga0207710_10182523 | 3300025900 | Bacteria | 1030 |
| 146 | Ga0207710_10196571 | 3300025900 | Bacteria | 995 |
| 147 | Ga0207688_10010571 | 3300025901 | Bacteria | 5019 |
| 148 | Ga0207688_10070741 | 3300025901 | Bacteria | 1979 |
| 149 | Ga0207680_10399415 | 3300025903 | Bacteria | 971 |
| 150 | Ga0207647_10022339 | 3300025904 | Bacteria | 4203 |
| 151 | Ga0207699_10071102 | 3300025906 | Bacteria | 2127 |
| 152 | Ga0207645_10034359 | 3300025907 | Bacteria | 3258 |
| 153 | Ga0207643_10017145 | 3300025908 | Bacteria | 3956 |
| 154 | Ga0207643_10213962 | 3300025908 | Bacteria | 1177 |
| 155 | Ga0207705_10259908 | 3300025909 | Bacteria | 1325 |
| 156 | Ga0207705_10266465 | 3300025909 | Bacteria | 1309 |
| 157 | Ga0207705_10338708 | 3300025909 | Bacteria | 1157 |
| 158 | Ga0207654_10244684 | 3300025911 | Bacteria | 1200 |
| 159 | Ga0207695_10161729 | 3300025913 | Bacteria | 2170 |
| 160 | Ga0207693_10000001 | 3300025915 | Bacteria | 469535 |
| 161 | Ga0207693_10001833 | 3300025915 | Bacteria | 18624 |
| 162 | Ga0207663_10073927 | 3300025916 | Bacteria | 2207 |
| 163 | Ga0207663_10181306 | 3300025916 | Bacteria | 1504 |
| 164 | Ga0207660_10182611 | 3300025917 | Bacteria | 1630 |
| 165 | Ga0207662_10002962 | 3300025918 | Bacteria | 8640 |
| 166 | Ga0207662_10049250 | 3300025918 | Bacteria | 2499 |
| 167 | Ga0207657_10033647 | 3300025919 | Bacteria | 4617 |
| 168 | Ga0207657_10045503 | 3300025919 | Bacteria | 3851 |
| 169 | Ga0207652_10000947 | 3300025921 | Bacteria | 27268 |
| 170 | Ga0207659_10136697 | 3300025926 | Bacteria | 1898 |
| 171 | Ga0207687_10056074 | 3300025927 | Bacteria | 2763 |
| 172 | Ga0207687_10081742 | 3300025927 | Bacteria | 2336 |
| 173 | Ga0207687_10178803 | 3300025927 | Bacteria | 1642 |
| 174 | Ga0207687_10234246 | 3300025927 | Bacteria | 1452 |
| 175 | Ga0207700_10024215 | 3300025928 | Bacteria | 4197 |
| 176 | Ga0207700_10200298 | 3300025928 | Bacteria | 1682 |
| 177 | Ga0207664_10000008 | 3300025929 | Bacteria | 309301 |
| 178 | Ga0207664_10004951 | 3300025929 | Bacteria | 9063 |
| 179 | Ga0207664_10118803 | 3300025929 | Bacteria | 2209 |
| 180 | Ga0207690_10000024 | 3300025932 | Bacteria | 194416 |
| 181 | Ga0207706_10063389 | 3300025933 | Bacteria | 3254 |
| 182 | Ga0207706_10263606 | 3300025933 | Bacteria | 1504 |
| 183 | Ga0207706_10373635 | 3300025933 | Bacteria | 1238 |
| 184 | Ga0207709_10350618 | 3300025935 | Bacteria | 1114 |
| 185 | Ga0207704_10108336 | 3300025938 | Bacteria | 1871 |
| 186 | Ga0207691_10051339 | 3300025940 | Bacteria | 3771 |
| 187 | Ga0207689_10013144 | 3300025942 | Bacteria | 7065 |
| 188 | Ga0207689_10050438 | 3300025942 | Bacteria | 3432 |
| 189 | Ga0207661_10195976 | 3300025944 | Bacteria | 1773 |
| 190 | Ga0207661_10504883 | 3300025944 | Bacteria | 1105 |
| 191 | Ga0207679_10173002 | 3300025945 | Bacteria | 1780 |
| 192 | Ga0207679_10297908 | 3300025945 | Bacteria | 1389 |
| 193 | Ga0207651_10217875 | 3300025960 | Bacteria | 1541 |
| 194 | Ga0207712_10294054 | 3300025961 | Bacteria | 1330 |
| 195 | Ga0207712_10491507 | 3300025961 | Bacteria | 1048 |
| 196 | Ga0207668_10071651 | 3300025972 | Bacteria | 2476 |
| 197 | Ga0207668_10334630 | 3300025972 | Bacteria | 1261 |
| 198 | Ga0207640_10105042 | 3300025981 | Bacteria | 1989 |
| 199 | Ga0207640_10168458 | 3300025981 | Bacteria | 1629 |
| 200 | Ga0207677_10120542 | 3300026023 | Bacteria | 1972 |
| 201 | Ga0207639_10038928 | 3300026041 | Bacteria | 3540 |
| 202 | Ga0207678_10019644 | 3300026067 | Bacteria | 5941 |
| 203 | Ga0207678_10075553 | 3300026067 | Bacteria | 2886 |
| 204 | Ga0207678_10169512 | 3300026067 | Bacteria | 1864 |
| 205 | Ga0207708_10023060 | 3300026075 | Bacteria | 4702 |
| 206 | Ga0207708_10138666 | 3300026075 | Bacteria | 1906 |
| 207 | Ga0207702_10166857 | 3300026078 | Bacteria | 2015 |
| 208 | Ga0207702_10695564 | 3300026078 | Bacteria | 1002 |
| 209 | Ga0207648_10022753 | 3300026089 | Bacteria | 5624 |
| 210 | Ga0207648_10064883 | 3300026089 | Bacteria | 3183 |
| 211 | Ga0207676_10033139 | 3300026095 | Bacteria | 3901 |
| 212 | Ga0207676_10046517 | 3300026095 | Bacteria | 3358 |
| 213 | Ga0207674_10064591 | 3300026116 | Bacteria | 3692 |
| 214 | Ga0207674_10072685 | 3300026116 | Bacteria | 3454 |
| 215 | Ga0207675_100059210 | 3300026118 | Bacteria | 3574 |
| 216 | Ga0207675_100232204 | 3300026118 | Bacteria | 1780 |
| 217 | Ga0207675_100514911 | 3300026118 | Bacteria | 1192 |
| 218 | Ga0207683_10061166 | 3300026121 | Bacteria | 3314 |
| 219 | Ga0207698_10274103 | 3300026142 | Bacteria | 1557 |
| 220 | Ga0207698_10700455 | 3300026142 | Bacteria | 1008 |
| 221 | Ga0268266_10000369 | 3300028379 | Bacteria | 69354 |
| 222 | Ga0268266_10010641 | 3300028379 | Bacteria | 8015 |
| 223 | Ga0268266_10061020 | 3300028379 | Bacteria | 3251 |
| 224 | Ga0268266_10520246 | 3300028379 | Bacteria | 1138 |
| 225 | Ga0268266_10707741 | 3300028379 | Bacteria | 971 |
| 226 | Ga0265326_10000004 | 3300028558 | Bacteria | 283947 |
| 227 | Ga0265319_1001287 | 3300028563 | Bacteria | 15198 |
| 228 | Ga0265319_1001310 | 3300028563 | Bacteria | 15057 |
| 229 | Ga0265318_10000571 | 3300028577 | Bacteria | 25972 |
| 230 | Ga0265318_10028919 | 3300028577 | Bacteria | 2164 |
| 231 | Ga0265336_10000049 | 3300028666 | Bacteria | 120719 |
| 232 | Ga0265336_10001251 | 3300028666 | Bacteria | 12040 |
| 233 | Ga0265338_10000046 | 3300028800 | Bacteria | 223068 |
| 234 | Ga0265338_10002452 | 3300028800 | Bacteria | 27769 |
| 235 | Ga0265338_10007450 | 3300028800 | Bacteria | 13582 |
| 236 | Ga0265324_10004699 | 3300029957 | Bacteria | 6065 |
| 237 | Ga0265320_10099651 | 3300031240 | Bacteria | 1338 |
| 238 | Ga0265325_10118001 | 3300031241 | Bacteria | 1282 |
| 239 | Ga0265340_10000003 | 3300031247 | Bacteria | 320583 |
| 240 | Ga0265339_10017899 | 3300031249 | Bacteria | 4188 |
| 241 | Ga0265327_10003738 | 3300031251 | Bacteria | 14151 |
| 242 | Ga0265327_10023536 | 3300031251 | Bacteria | 3647 |
| 243 | Ga0265327_10027460 | 3300031251 | Bacteria | 3275 |
| 244 | Ga0265316_10033558 | 3300031344 | Bacteria | 4178 |
| 245 | Ga0265316_10406781 | 3300031344 | Bacteria | 979 |
| 246 | Ga0307408_100257825 | 3300031548 | Bacteria | 1442 |
| 247 | Ga0265314_10201366 | 3300031711 | Bacteria | 1177 |
| 248 | Ga0307413_10160794 | 3300031824 | Bacteria | 1578 |
| 249 | Ga0307413_10390180 | 3300031824 | Bacteria | 1088 |
| 250 | Ga0307410_10331213 | 3300031852 | Bacteria | 1211 |
| 251 | Ga0307406_10098400 | 3300031901 | Bacteria | 1986 |
| 252 | Ga0307409_100285715 | 3300031995 | Bacteria | 1527 |
| 253 | Ga0307416_100662657 | 3300032002 | Unclassified | 1129 |
| 254 | Ga0307415_100211357 | 3300032126 | Bacteria | 1548 |
| 255 | Ga0307415_100273824 | 3300032126 | Bacteria | 1384 |
| 256 | Ga0307415_100283234 | 3300032126 | Bacteria | 1364 |
| 257 | Ga0373953_0052814 | 3300035117 | Bacteria | 1646 |
| 258 | Ga0373943_0110759 | 3300035170 | Bacteria | 1448 |
| 259 | Ga0373943_0320462 | 3300035170 | Bacteria | 884 |
| 260 | Ga0373924_0066876 | 3300035410 | Bacteria | 1511 |
| 261 | Ga0373947_0226117 | 3300035725 | Bacteria | 1231 |
| 262 | Ga0395899_0128678 | 3300037312 | Bacteria | 1810 |
| 263 | Ga0395900_0202239 | 3300037418 | Bacteria | 2009 |
| 264 | Ga0395900_0630508 | 3300037418 | Bacteria | 1010 |
| 265 | Ga0395898_0030279 | 3300037466 | Bacteria | 5417 |
| 266 | Ga0395898_0095576 | 3300037466 | Bacteria | 2855 |
| 267 | Ga0395898_0110043 | 3300037466 | Bacteria | 2641 |
| 268 | Ga0395898_0128049 | 3300037466 | Bacteria | 2432 |
| 269 | Ga0395905_0240427 | 3300037471 | Bacteria | 1692 |
| 270 | Ga0395905_0516650 | 3300037471 | Bacteria | 1095 |
| 271 | Ga0395901_0011241 | 3300038443 | Bacteria | 9068 |
| 272 | Ga0395901_0088071 | 3300038443 | Bacteria | 3247 |
| 273 | Ga0451853_2753551 | 3300041512 | Bacteria | 2649 |
| 274 | Ga0466969_0012858 | 3300044656 | Bacteria | 4411 |
| 275 | Ga0466965_0054349 | 3300044683 | Bacteria | 1991 |
| 276 | Ga0466966_0041956 | 3300044684 | Bacteria | 2939 |
| 277 | Ga0466963_0012479 | 3300044694 | Bacteria | 5203 |
| 278 | Ga0466963_0108474 | 3300044694 | Bacteria | 1904 |
| 279 | Ga0466963_0212363 | 3300044694 | Bacteria | 1354 |
| 280 | Ga0466964_0132105 | 3300044706 | Bacteria | 1138 |
| 281 | Ga0466964_0189726 | 3300044706 | Bacteria | 980 |
| 282 | Ga0466971_0006544 | 3300044719 | Bacteria | 5064 |
| 283 | Ga0466970_0095415 | 3300044765 | Bacteria | 1617 |
| 284 | Ga0466960_0000426 | 3300044901 | Bacteria | 14428 |
| 285 | Ga0466960_0017495 | 3300044901 | Bacteria | 3126 |
| 286 | Ga0466960_0111801 | 3300044901 | Bacteria | 1420 |
| 287 | Ga0466960_0368531 | 3300044901 | Unclassified | 822 |
| 288 | Ga0466959_0020329 | 3300045049 | Bacteria | 4891 |
| 289 | Ga0466959_0021126 | 3300045049 | Bacteria | 4799 |
| 290 | Ga0466958_0103720 | 3300045836 | Bacteria | 1771 |
| 291 | Ga0466958_0110420 | 3300045836 | Bacteria | 1716 |
| 292 | Ga0466958_0214843 | 3300045836 | Bacteria | 1226 |
| 293 | Ga0466967_0011863 | 3300045976 | Bacteria | 6630 |
| 294 | Ga0466967_0018019 | 3300045976 | Bacteria | 5630 |
| 295 | Ga0466967_0100861 | 3300045976 | Bacteria | 2638 |
| 296 | Ga0466967_0217143 | 3300045976 | Bacteria | 1815 |
| 297 | Ga0466967_0217679 | 3300045976 | Bacteria | 1813 |
| 298 | Ga0466967_0233005 | 3300045976 | Bacteria | 1754 |
| 299 | Ga0466967_0459684 | 3300045976 | Bacteria | 1245 |
| 300 | Ga0466967_0469357 | 3300045976 | Bacteria | 1232 |
| 301 | Ga0495629_0061933 | 3300046459 | Bacteria | 2615 |
| 302 | Ga0495653_0094924 | 3300046463 | Bacteria | 2172 |
| 303 | Ga0495650_0000049 | 3300046471 | Bacteria | 325092 |
| 304 | Ga0495584_0079953 | 3300046491 | Bacteria | 1645 |
| 305 | Ga0495608_0006162 | 3300046511 | Bacteria | 8515 |
| 306 | Ga0495618_0085118 | 3300046514 | Bacteria | 2020 |
| 307 | Ga0495628_0261126 | 3300046516 | Bacteria | 1291 |
| 308 | Ga0495652_0032377 | 3300046529 | Bacteria | 4573 |
| 309 | Ga0495587_0199294 | 3300046536 | Bacteria | 1132 |
| 310 | Ga0495667_0006202 | 3300046559 | Bacteria | 8099 |
| 311 | Ga0495634_0048538 | 3300046642 | Bacteria | 2858 |
| 312 | Ga0495635_0065760 | 3300046663 | Bacteria | 2487 |
| 313 | Ga0495657_0074589 | 3300046675 | Bacteria | 2207 |
| 314 | Ga0495599_0022077 | 3300046678 | Bacteria | 3973 |
| 315 | Ga0495623_0022794 | 3300046679 | Bacteria | 4043 |
| 316 | Ga0495646_0048509 | 3300046680 | Bacteria | 2579 |
| 317 | Ga0495604_0044828 | 3300047317 | Bacteria | 3453 |
| 318 | Ga0495674_0028464 | 3300047319 | Bacteria | 5094 |
| 319 | Ga0495680_0016204 | 3300047322 | Bacteria | 6408 |
| 320 | Ga0495684_0048838 | 3300047471 | Bacteria | 3235 |
| 321 | Ga0495602_0009457 | 3300048088 | Bacteria | 10136 |
| 322 | Ga0496100_0035050 | 3300048903 | Bacteria | 3154 |
| 323 | Ga0496100_0260997 | 3300048903 | Bacteria | 1285 |
| 324 | Ga0496100_0298542 | 3300048903 | Bacteria | 1205 |
| 325 | Ga0496100_0591421 | 3300048903 | Bacteria | 861 |
| 326 | Ga0496101_0002690 | 3300048904 | Bacteria | 10906 |
| 327 | Ga0496101_0046073 | 3300048904 | Bacteria | 3126 |
| 328 | Ga0496101_0171541 | 3300048904 | Bacteria | 1667 |
| 329 | Ga0496101_0474113 | 3300048904 | Bacteria | 988 |
| 330 | Ga0496101_0604550 | 3300048904 | Bacteria | 867 |
| 331 | Ga0496102_0014451 | 3300048905 | Bacteria | 6860 |
| 332 | Ga0496102_0024520 | 3300048905 | Bacteria | 5364 |
| 333 | Ga0496102_0058357 | 3300048905 | Bacteria | 3526 |
| 334 | Ga0496103_0018988 | 3300048906 | Bacteria | 4127 |
| 335 | Ga0496103_0158915 | 3300048906 | Bacteria | 1449 |
| 336 | Ga0496104_0002080 | 3300048907 | Bacteria | 17353 |
| 337 | Ga0496104_0003989 | 3300048907 | Bacteria | 12780 |
| 338 | Ga0496104_0077073 | 3300048907 | Bacteria | 3176 |
| 339 | Ga0496105_0008283 | 3300048908 | Bacteria | 8082 |
| 340 | Ga0496105_0145136 | 3300048908 | Bacteria | 1952 |
| 341 | Ga0496105_0695901 | 3300048908 | Bacteria | 781 |
| 342 | Ga0496106_0234677 | 3300048909 | Bacteria | 1465 |
| 343 | Ga0496107_0119334 | 3300048910 | Bacteria | 1942 |
| 344 | Ga0496108_0009653 | 3300048911 | Bacteria | 7822 |
| 345 | Ga0496108_0050475 | 3300048911 | Bacteria | 3482 |
| 346 | Ga0496108_0880707 | 3300048911 | Bacteria | 769 |
| 347 | Ga0496109_0002592 | 3300048912 | Bacteria | 15138 |
| 348 | Ga0496109_0050157 | 3300048912 | Bacteria | 3801 |
| 349 | Ga0496109_0537999 | 3300048912 | Bacteria | 1102 |
| 350 | Ga0496110_0007072 | 3300048913 | Bacteria | 8927 |
| 351 | Ga0496110_0462514 | 3300048913 | Bacteria | 1156 |
| 352 | Ga0496110_0601876 | 3300048913 | Bacteria | 997 |
| 353 | Ga0496111_0030928 | 3300048914 | Bacteria | 3810 |
| 354 | Ga0496111_0061907 | 3300048914 | Bacteria | 2713 |
| 355 | Ga0496111_0302117 | 3300048914 | Bacteria | 1186 |
| 356 | Ga0496112_0000237 | 3300048915 | Bacteria | 35381 |
| 357 | Ga0496112_0015954 | 3300048915 | Bacteria | 7022 |
| 358 | Ga0496112_0018457 | 3300048915 | Bacteria | 6568 |
| 359 | Ga0496117_0002047 | 3300048920 | Bacteria | 26701 |
| 360 | Ga0496118_0000424 | 3300048921 | Bacteria | 70137 |
| 361 | Ga0496118_0159537 | 3300048921 | Bacteria | 1397 |
| 362 | Ga0496119_0036783 | 3300048922 | Bacteria | 3189 |
| 363 | Ga0496120_0005403 | 3300048923 | Bacteria | 10201 |
| 364 | Ga0496121_0002788 | 3300048924 | Bacteria | 25903 |
| 365 | Ga0496121_0077553 | 3300048924 | Bacteria | 2645 |
| 366 | Ga0496121_0088169 | 3300048924 | Bacteria | 2433 |
| 367 | Ga0496121_0197868 | 3300048924 | Bacteria | 1435 |
| 368 | Ga0496123_0186401 | 3300048926 | Unclassified | 1078 |
| 369 | Ga0496124_0059369 | 3300048927 | Bacteria | 3214 |
| 370 | Ga0496124_0084792 | 3300048927 | Bacteria | 2597 |
| 371 | Ga0496125_0079725 | 3300048928 | Bacteria | 2510 |
| 372 | Ga0496125_0222388 | 3300048928 | Bacteria | 1215 |
| 373 | Ga0496126_0029114 | 3300048929 | Bacteria | 5250 |
| 374 | Ga0496126_0076127 | 3300048929 | Bacteria | 2977 |
| 375 | Ga0496126_0194394 | 3300048929 | Bacteria | 1716 |
| 376 | Ga0496126_0194628 | 3300048929 | Bacteria | 1715 |
| 377 | Ga0501031_0000142 | 3300049568 | Bacteria | 40303 |
| 378 | Ga0501031_0034919 | 3300049568 | Bacteria | 3281 |
| 379 | Ga0501031_0104839 | 3300049568 | Bacteria | 1845 |
| 380 | Ga0501032_0000578 | 3300049569 | Bacteria | 29631 |
| 381 | Ga0501033_0000688 | 3300049570 | Bacteria | 31333 |
| 382 | Ga0501034_0012865 | 3300049571 | Bacteria | 8630 |
| 383 | Ga0501034_0029481 | 3300049571 | Bacteria | 5577 |
| 384 | Ga0501034_0426976 | 3300049571 | Bacteria | 1246 |
| 385 | Ga0501034_0481900 | 3300049571 | Bacteria | 1156 |
| 386 | Ga0501036_0000679 | 3300049572 | Bacteria | 25041 |
| 387 | Ga0501036_0063645 | 3300049572 | Bacteria | 3122 |
| 388 | Ga0501036_0174970 | 3300049572 | Bacteria | 1807 |
| 389 | Ga0501036_0234609 | 3300049572 | Bacteria | 1539 |
| 390 | Ga0501037_0000326 | 3300049573 | Bacteria | 40338 |
| 391 | Ga0501038_0001850 | 3300049574 | Bacteria | 19540 |
| 392 | Ga0501039_0020122 | 3300049575 | Bacteria | 5117 |
| 393 | Ga0501039_0203353 | 3300049575 | Bacteria | 1557 |
| 394 | Ga0501040_0020869 | 3300049576 | Bacteria | 4367 |
| 395 | Ga0501040_0088163 | 3300049576 | Bacteria | 2155 |
| 396 | Ga0501040_0239332 | 3300049576 | Bacteria | 1293 |
| 397 | Ga0501040_0299221 | 3300049576 | Bacteria | 1150 |
| 398 | Ga0501040_0605918 | 3300049576 | Bacteria | 791 |
| 399 | Ga0501041_0070246 | 3300049577 | Bacteria | 2149 |
| 400 | Ga0501041_0099449 | 3300049577 | Bacteria | 1799 |
| 401 | Ga0501042_0065658 | 3300049578 | Bacteria | 2593 |
| 402 | Ga0501042_0118094 | 3300049578 | Bacteria | 1909 |
| 403 | Ga0501042_0197395 | 3300049578 | Bacteria | 1451 |
| 404 | Ga0501043_0000379 | 3300049579 | Bacteria | 40436 |
| 405 | Ga0501046_0000468 | 3300049580 | Bacteria | 40416 |
| 406 | Ga0501046_0131769 | 3300049580 | Bacteria | 1896 |
| 407 | Ga0501047_0000551 | 3300049581 | Bacteria | 40427 |
| 408 | Ga0501047_0027048 | 3300049581 | Bacteria | 5525 |
| 409 | Ga0501048_0000177 | 3300049582 | Bacteria | 40346 |
| 410 | Ga0501068_0028488 | 3300049584 | Bacteria | 3303 |
| 411 | Ga0501068_0070961 | 3300049584 | Bacteria | 2126 |
| 412 | Ga0501069_0000896 | 3300049585 | Bacteria | 14204 |
| 413 | Ga0501070_0000225 | 3300049586 | Bacteria | 53824 |
| 414 | Ga0501071_0059202 | 3300049587 | Bacteria | 2771 |
| 415 | Ga0501071_0088582 | 3300049587 | Bacteria | 2271 |
| 416 | Ga0501072_0012611 | 3300049588 | Bacteria | 6461 |
| 417 | Ga0501072_0279338 | 3300049588 | Bacteria | 1328 |
| 418 | Ga0501072_0337290 | 3300049588 | Bacteria | 1197 |
| 419 | Ga0501073_0009192 | 3300049589 | Bacteria | 7290 |
| 420 | Ga0501073_0150376 | 3300049589 | Bacteria | 1614 |
| 421 | Ga0501074_0006267 | 3300049590 | Bacteria | 8589 |
| 422 | Ga0501074_0312129 | 3300049590 | Bacteria | 1117 |
| 423 | Ga0501075_0040819 | 3300049591 | Bacteria | 3477 |
| 424 | Ga0501076_0158638 | 3300049592 | Bacteria | 1842 |
| 425 | Ga0501076_0174984 | 3300049592 | Bacteria | 1749 |
| 426 | Ga0501079_0000687 | 3300049741 | Bacteria | 22726 |
| 427 | Ga0501079_0361029 | 3300049741 | Unclassified | 1138 |
| 428 | Ga0501080_0429834 | 3300049742 | Bacteria | 1185 |
| 429 | Ga0501083_0000451 | 3300049744 | Bacteria | 26312 |
| 430 | Ga0501083_0002630 | 3300049744 | Bacteria | 12367 |
| 431 | Ga0501083_0104100 | 3300049744 | Bacteria | 1870 |
| 432 | Ga0501035_0000578 | 3300049822 | Bacteria | 40343 |
| 433 | Ga0501035_0117597 | 3300049822 | Bacteria | 2326 |
| 434 | Ga0501035_0289588 | 3300049822 | Bacteria | 1382 |
| 435 | Ga0501044_0000533 | 3300049823 | Bacteria | 46214 |
| 436 | Ga0501044_0399518 | 3300049823 | Bacteria | 1287 |
| 437 | Ga0501045_0237675 | 3300049824 | Bacteria | 1356 |
| 438 | Ga0501045_0756908 | 3300049824 | Bacteria | 716 |
| 439 | nmdc:mga0qj67_1955_c1 | 3300050509 | Bacteria | 14677 |
| 440 | nmdc:mga0a205_317939_c1 | 3300050515 | Bacteria | 1428 |
| 441 | Ga0495601_0048987 | 3300053077 | Bacteria | 2663 |
| 442 | Ga0495595_0006394 | 3300053084 | Bacteria | 4803 |
| 443 | Ga0495619_0011811 | 3300053085 | Bacteria | 5501 |
| 444 | Ga0500641_0253375 | 3300053096 | Bacteria | 737 |
| 445 | Ga0500556_0000811 | 3300053104 | Bacteria | 18160 |
| 446 | Ga0500616_0006674 | 3300053153 | Bacteria | 7500 |
| 447 | Ga0501084_0062265 | 3300054114 | Bacteria | 3123 |
| 448 | Ga0501084_0149162 | 3300054114 | Bacteria | 1970 |
| 449 | Ga0501082_0003589 | 3300060353 | Bacteria | 13554 |
| 450 | Ga0501082_0066301 | 3300060353 | Bacteria | 3109 |
| 451 | Ga0501082_0273051 | 3300060353 | Bacteria | 1471 |
| 452 | Ga0466962_0056361 | 3300061719 | Bacteria | 1877 |
| 453 | Ga0530510_0186668 | 3300061734 | Bacteria | 1538 |
| 454 | Ga0530510_0332108 | 3300061734 | Bacteria | 1140 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049824 | Ga0501045_0756908 | Ga0501045_0756908_34_690 | 199 |
| 2 | 3300053096 | Ga0500641_0253375 | Ga0500641_0253375_15_665 | 200 |
| 3 | 3300048912 | Ga0496109_0002592 | Ga0496109_0002592_5071_5862 | 203 |
| 4 | 3300048926 | Ga0496123_0186401 | Ga0496123_0186401_10_672 | 204 |
| 5 | 3300035170 | Ga0373943_0320462 | Ga0373943_0320462_195_866 | 207 |
| 6 | 3300049576 | Ga0501040_0605918 | Ga0501040_0605918_94_765 | 207 |
| 7 | 3300048924 | Ga0496121_0002788 | Ga0496121_0002788_23620_24399 | 208 |
| 8 | 3300048924 | Ga0496121_0077553 | Ga0496121_0077553_143_922 | 211 |
| 9 | 3300048911 | Ga0496108_0880707 | Ga0496108_0880707_55_741 | 212 |
| 10 | 3300009148 | Ga0105243_10080439 | Ga0105243_100804393 | 216 |
| 11 | 3300044901 | Ga0466960_0111801 | Ga0466960_0111801_247_1053 | 218 |
| 12 | 3300005937 | Ga0081455_10026307 | Ga0081455_100263072 | 219 |
| 13 | 3300048908 | Ga0496105_0695901 | Ga0496105_0695901_52_765 | 221 |
| 14 | 3300005719 | Ga0068861_100210955 | Ga0068861_1002109552 | 224 |
| 15 | 3300025961 | Ga0207712_10294054 | Ga0207712_102940543 | 224 |
| 16 | 3300026118 | Ga0207675_100232204 | Ga0207675_1002322042 | 224 |
| 17 | 3300005436 | Ga0070713_100024779 | Ga0070713_1000247797 | 226 |
| 18 | 3300025928 | Ga0207700_10024215 | Ga0207700_100242155 | 226 |
| 19 | 3300048903 | Ga0496100_0298542 | Ga0496100_0298542_15_746 | 227 |
| 20 | 3300049571 | Ga0501034_0481900 | Ga0501034_0481900_10_750 | 228 |
| 21 | 3300006846 | Ga0075430_100000833 | Ga0075430_10000083319 | 229 |
| 22 | 3300044656 | Ga0466969_0012858 | Ga0466969_0012858_749_1543 | 229 |
| 23 | 3300044684 | Ga0466966_0041956 | Ga0466966_0041956_1617_2411 | 229 |
| 24 | 3300045049 | Ga0466959_0020329 | Ga0466959_0020329_2118_2912 | 229 |
| 25 | 3300045836 | Ga0466958_0214843 | Ga0466958_0214843_35_829 | 229 |
| 26 | 3300050509 | nmdc:mga0qj67_1955_c1 | nmdc:mga0qj67_1955_c1_2378_3157 | 229 |
| 27 | 3300005334 | Ga0068869_100320399 | Ga0068869_1003203992 | 230 |
| 28 | 3300013306 | Ga0163162_10492758 | Ga0163162_104927582 | 230 |
| 29 | 3300025900 | Ga0207710_10196571 | Ga0207710_101965712 | 230 |
| 30 | 3300048905 | Ga0496102_0014451 | Ga0496102_0014451_767_1546 | 230 |
| 31 | 3300048920 | Ga0496117_0002047 | Ga0496117_0002047_462_1241 | 230 |
| 32 | 3300048921 | Ga0496118_0000424 | Ga0496118_0000424_41138_41917 | 230 |
| 33 | 3300048923 | Ga0496120_0005403 | Ga0496120_0005403_2645_3424 | 230 |
| 34 | 3300048929 | Ga0496126_0029114 | Ga0496126_0029114_4316_5095 | 230 |
| 35 | 3300049581 | Ga0501047_0027048 | Ga0501047_0027048_154_933 | 230 |
| 36 | 3300049744 | Ga0501083_0002630 | Ga0501083_0002630_10753_11532 | 230 |
| 37 | 3300049823 | Ga0501044_0399518 | Ga0501044_0399518_63_842 | 230 |
| 38 | 3300049571 | Ga0501034_0029481 | Ga0501034_0029481_490_1293 | 231 |
| 39 | 3300028563 | Ga0265319_1001310 | Ga0265319_100131015 | 233 |
| 40 | 3300031251 | Ga0265327_10023536 | Ga0265327_100235363 | 233 |
| 41 | 3300031711 | Ga0265314_10201366 | Ga0265314_102013662 | 233 |
| 42 | 3300048928 | Ga0496125_0079725 | Ga0496125_0079725_780_1559 | 234 |
| 43 | 3300044901 | Ga0466960_0000426 | Ga0466960_0000426_10973_11776 | 237 |
| 44 | 3300048903 | Ga0496100_0035050 | Ga0496100_0035050_1319_2092 | 239 |
| 45 | 3300048904 | Ga0496101_0002690 | Ga0496101_0002690_3372_4145 | 239 |
| 46 | 3300048914 | Ga0496111_0302117 | Ga0496111_0302117_11_784 | 239 |
| 47 | 3300028800 | Ga0265338_10007450 | Ga0265338_100074508 | 240 |
| 48 | 3300044901 | Ga0466960_0368531 | Ga0466960_0368531_24_800 | 240 |
| 49 | 3300049592 | Ga0501076_0158638 | Ga0501076_0158638_588_1367 | 240 |
| 50 | 3300005548 | Ga0070665_100738086 | Ga0070665_1007380862 | 241 |
| 51 | 3300006175 | Ga0070712_100000021 | Ga0070712_10000002160 | 241 |
| 52 | 3300025915 | Ga0207693_10000001 | Ga0207693_10000001211 | 241 |
| 53 | 3300026142 | Ga0207698_10700455 | Ga0207698_107004551 | 241 |
| 54 | 3300028379 | Ga0268266_10707741 | Ga0268266_107077412 | 241 |
| 55 | 3300048913 | Ga0496110_0462514 | Ga0496110_0462514_231_1010 | 241 |
| 56 | 3300048915 | Ga0496112_0000237 | Ga0496112_0000237_22312_23091 | 241 |
| 57 | 3300005344 | Ga0070661_100506513 | Ga0070661_1005065132 | 242 |
| 58 | 3300005564 | Ga0070664_100148545 | Ga0070664_1001485452 | 242 |
| 59 | 3300005564 | Ga0070664_100489856 | Ga0070664_1004898562 | 242 |
| 60 | 3300009098 | Ga0105245_10131983 | Ga0105245_101319833 | 242 |
| 61 | 3300009176 | Ga0105242_10492301 | Ga0105242_104923012 | 242 |
| 62 | 3300009551 | Ga0105238_10273638 | Ga0105238_102736382 | 242 |
| 63 | 3300009553 | Ga0105249_10402746 | Ga0105249_104027463 | 242 |
| 64 | 3300011119 | Ga0105246_10226338 | Ga0105246_102263383 | 242 |
| 65 | 3300025302 | Ga0207426_1007947 | Ga0207426_10079475 | 242 |
| 66 | 3300025908 | Ga0207643_10213962 | Ga0207643_102139622 | 242 |
| 67 | 3300025909 | Ga0207705_10259908 | Ga0207705_102599082 | 242 |
| 68 | 3300025909 | Ga0207705_10338708 | Ga0207705_103387082 | 242 |
| 69 | 3300025926 | Ga0207659_10136697 | Ga0207659_101366973 | 242 |
| 70 | 3300025927 | Ga0207687_10234246 | Ga0207687_102342462 | 242 |
| 71 | 3300025935 | Ga0207709_10350618 | Ga0207709_103506181 | 242 |
| 72 | 3300026142 | Ga0207698_10274103 | Ga0207698_102741032 | 242 |
| 73 | 3300031824 | Ga0307413_10160794 | Ga0307413_101607943 | 242 |
| 74 | 3300031852 | Ga0307410_10331213 | Ga0307410_103312132 | 242 |
| 75 | 3300032126 | Ga0307415_100273824 | Ga0307415_1002738242 | 242 |
| 76 | 3300041512 | Ga0451853_2753551 | Ga0451853_2753551_515_1297 | 242 |
| 77 | 3300044683 | Ga0466965_0054349 | Ga0466965_0054349_856_1638 | 242 |
| 78 | 3300044694 | Ga0466963_0108474 | Ga0466963_0108474_393_1175 | 242 |
| 79 | 3300044719 | Ga0466971_0006544 | Ga0466971_0006544_3104_3886 | 242 |
| 80 | 3300045836 | Ga0466958_0110420 | Ga0466958_0110420_564_1346 | 242 |
| 81 | 3300045976 | Ga0466967_0018019 | Ga0466967_0018019_4377_5159 | 242 |
| 82 | 3300048924 | Ga0496121_0197868 | Ga0496121_0197868_297_1079 | 242 |
| 83 | 3300049568 | Ga0501031_0034919 | Ga0501031_0034919_2180_2962 | 242 |
| 84 | 3300049571 | Ga0501034_0426976 | Ga0501034_0426976_149_931 | 242 |
| 85 | 3300049572 | Ga0501036_0063645 | Ga0501036_0063645_1698_2480 | 242 |
| 86 | 3300049576 | Ga0501040_0088163 | Ga0501040_0088163_543_1325 | 242 |
| 87 | 3300049587 | Ga0501071_0088582 | Ga0501071_0088582_940_1722 | 242 |
| 88 | 3300049588 | Ga0501072_0012611 | Ga0501072_0012611_2609_3391 | 242 |
| 89 | 3300049591 | Ga0501075_0040819 | Ga0501075_0040819_1796_2578 | 242 |
| 90 | 3300061719 | Ga0466962_0056361 | Ga0466962_0056361_609_1391 | 242 |
| 91 | 3300001991 | JGI24743J22301_10004039 | JGI24743J22301_100040394 | 243 |
| 92 | 3300005327 | Ga0070658_10246340 | Ga0070658_102463402 | 243 |
| 93 | 3300005329 | Ga0070683_100074598 | Ga0070683_1000745982 | 243 |
| 94 | 3300005329 | Ga0070683_100346518 | Ga0070683_1003465181 | 243 |
| 95 | 3300005334 | Ga0068869_100038071 | Ga0068869_1000380713 | 243 |
| 96 | 3300005335 | Ga0070666_10362507 | Ga0070666_103625072 | 243 |
| 97 | 3300005337 | Ga0070682_100056010 | Ga0070682_1000560103 | 243 |
| 98 | 3300005337 | Ga0070682_100065706 | Ga0070682_1000657063 | 243 |
| 99 | 3300005338 | Ga0068868_100050716 | Ga0068868_1000507164 | 243 |
| 100 | 3300005338 | Ga0068868_100082853 | Ga0068868_1000828533 | 243 |
| 101 | 3300005338 | Ga0068868_100349385 | Ga0068868_1003493851 | 243 |
| 102 | 3300005339 | Ga0070660_100023186 | Ga0070660_1000231864 | 243 |
| 103 | 3300005340 | Ga0070689_100018764 | Ga0070689_1000187642 | 243 |
| 104 | 3300005341 | Ga0070691_10117503 | Ga0070691_101175032 | 243 |
| 105 | 3300005343 | Ga0070687_100030116 | Ga0070687_1000301163 | 243 |
| 106 | 3300005344 | Ga0070661_100102786 | Ga0070661_1001027862 | 243 |
| 107 | 3300005347 | Ga0070668_100139111 | Ga0070668_1001391113 | 243 |
| 108 | 3300005354 | Ga0070675_100178778 | Ga0070675_1001787783 | 243 |
| 109 | 3300005364 | Ga0070673_100291304 | Ga0070673_1002913043 | 243 |
| 110 | 3300005365 | Ga0070688_100006905 | Ga0070688_1000069053 | 243 |
| 111 | 3300005366 | Ga0070659_100000002 | Ga0070659_10000000270 | 243 |
| 112 | 3300005367 | Ga0070667_100002431 | Ga0070667_10000243116 | 243 |
| 113 | 3300005367 | Ga0070667_100220598 | Ga0070667_1002205983 | 243 |
| 114 | 3300005406 | Ga0070703_10110714 | Ga0070703_101107142 | 243 |
| 115 | 3300005435 | Ga0070714_100000019 | Ga0070714_100000019173 | 243 |
| 116 | 3300005435 | Ga0070714_100058067 | Ga0070714_1000580673 | 243 |
| 117 | 3300005435 | Ga0070714_100213810 | Ga0070714_1002138102 | 243 |
| 118 | 3300005435 | Ga0070714_100399667 | Ga0070714_1003996672 | 243 |
| 119 | 3300005436 | Ga0070713_100213376 | Ga0070713_1002133762 | 243 |
| 120 | 3300005437 | Ga0070710_10000007 | Ga0070710_10000007165 | 243 |
| 121 | 3300005437 | Ga0070710_10011679 | Ga0070710_100116796 | 243 |
| 122 | 3300005437 | Ga0070710_10326528 | Ga0070710_103265282 | 243 |
| 123 | 3300005438 | Ga0070701_10128817 | Ga0070701_101288172 | 243 |
| 124 | 3300005439 | Ga0070711_100022507 | Ga0070711_1000225076 | 243 |
| 125 | 3300005439 | Ga0070711_100129065 | Ga0070711_1001290654 | 243 |
| 126 | 3300005440 | Ga0070705_100002330 | Ga0070705_1000023302 | 243 |
| 127 | 3300005441 | Ga0070700_100066722 | Ga0070700_1000667221 | 243 |
| 128 | 3300005455 | Ga0070663_100072369 | Ga0070663_1000723693 | 243 |
| 129 | 3300005457 | Ga0070662_100110949 | Ga0070662_1001109492 | 243 |
| 130 | 3300005459 | Ga0068867_100082799 | Ga0068867_1000827993 | 243 |
| 131 | 3300005466 | Ga0070685_10117116 | Ga0070685_101171163 | 243 |
| 132 | 3300005539 | Ga0068853_100684135 | Ga0068853_1006841351 | 243 |
| 133 | 3300005543 | Ga0070672_100043362 | Ga0070672_1000433623 | 243 |
| 134 | 3300005548 | Ga0070665_100001875 | Ga0070665_10000187515 | 243 |
| 135 | 3300005548 | Ga0070665_100025731 | Ga0070665_1000257318 | 243 |
| 136 | 3300005548 | Ga0070665_100139022 | Ga0070665_1001390223 | 243 |
| 137 | 3300005548 | Ga0070665_100606386 | Ga0070665_1006063862 | 243 |
| 138 | 3300005549 | Ga0070704_100128986 | Ga0070704_1001289863 | 243 |
| 139 | 3300005564 | Ga0070664_100435273 | Ga0070664_1004352733 | 243 |
| 140 | 3300005577 | Ga0068857_100203168 | Ga0068857_1002031682 | 243 |
| 141 | 3300005578 | Ga0068854_100020848 | Ga0068854_1000208485 | 243 |
| 142 | 3300005614 | Ga0068856_100398174 | Ga0068856_1003981742 | 243 |
| 143 | 3300005614 | Ga0068856_100567789 | Ga0068856_1005677892 | 243 |
| 144 | 3300005615 | Ga0070702_100027104 | Ga0070702_1000271045 | 243 |
| 145 | 3300005616 | Ga0068852_100107822 | Ga0068852_1001078223 | 243 |
| 146 | 3300005616 | Ga0068852_100215774 | Ga0068852_1002157743 | 243 |
| 147 | 3300005617 | Ga0068859_100099840 | Ga0068859_1000998403 | 243 |
| 148 | 3300005718 | Ga0068866_10033301 | Ga0068866_100333012 | 243 |
| 149 | 3300005719 | Ga0068861_100033238 | Ga0068861_1000332383 | 243 |
| 150 | 3300005719 | Ga0068861_100039727 | Ga0068861_1000397273 | 243 |
| 151 | 3300005719 | Ga0068861_100534842 | Ga0068861_1005348422 | 243 |
| 152 | 3300005842 | Ga0068858_100102020 | Ga0068858_1001020202 | 243 |
| 153 | 3300005937 | Ga0081455_10321265 | Ga0081455_103212652 | 243 |
| 154 | 3300005983 | Ga0081540_1001663 | Ga0081540_100166322 | 243 |
| 155 | 3300005983 | Ga0081540_1032658 | Ga0081540_10326582 | 243 |
| 156 | 3300005983 | Ga0081540_1035945 | Ga0081540_10359453 | 243 |
| 157 | 3300005985 | Ga0081539_10003690 | Ga0081539_100036908 | 243 |
| 158 | 3300005985 | Ga0081539_10007612 | Ga0081539_100076124 | 243 |
| 159 | 3300005985 | Ga0081539_10018156 | Ga0081539_100181564 | 243 |
| 160 | 3300006028 | Ga0070717_10000024 | Ga0070717_10000024106 | 243 |
| 161 | 3300006028 | Ga0070717_10061046 | Ga0070717_100610462 | 243 |
| 162 | 3300006175 | Ga0070712_100188196 | Ga0070712_1001881962 | 243 |
| 163 | 3300006844 | Ga0075428_100611359 | Ga0075428_1006113592 | 243 |
| 164 | 3300006844 | Ga0075428_100679820 | Ga0075428_1006798202 | 243 |
| 165 | 3300006871 | Ga0075434_100545878 | Ga0075434_1005458782 | 243 |
| 166 | 3300006881 | Ga0068865_100137365 | Ga0068865_1001373653 | 243 |
| 167 | 3300006931 | Ga0097620_100099840 | Ga0097620_1000998403 | 243 |
| 168 | 3300009036 | Ga0105244_10100310 | Ga0105244_101003102 | 243 |
| 169 | 3300009093 | Ga0105240_10042190 | Ga0105240_100421903 | 243 |
| 170 | 3300009093 | Ga0105240_10241646 | Ga0105240_102416463 | 243 |
| 171 | 3300009098 | Ga0105245_10006824 | Ga0105245_1000682413 | 243 |
| 172 | 3300009098 | Ga0105245_10084221 | Ga0105245_100842213 | 243 |
| 173 | 3300009098 | Ga0105245_10088301 | Ga0105245_100883014 | 243 |
| 174 | 3300009101 | Ga0105247_10072462 | Ga0105247_100724622 | 243 |
| 175 | 3300009101 | Ga0105247_10110492 | Ga0105247_101104923 | 243 |
| 176 | 3300009148 | Ga0105243_10092154 | Ga0105243_100921542 | 243 |
| 177 | 3300009148 | Ga0105243_10304705 | Ga0105243_103047051 | 243 |
| 178 | 3300009174 | Ga0105241_10338247 | Ga0105241_103382472 | 243 |
| 179 | 3300009176 | Ga0105242_10162262 | Ga0105242_101622623 | 243 |
| 180 | 3300009545 | Ga0105237_10492748 | Ga0105237_104927482 | 243 |
| 181 | 3300009551 | Ga0105238_10100129 | Ga0105238_101001292 | 243 |
| 182 | 3300009551 | Ga0105238_10319885 | Ga0105238_103198851 | 243 |
| 183 | 3300009553 | Ga0105249_10050371 | Ga0105249_100503715 | 243 |
| 184 | 3300009553 | Ga0105249_10340584 | Ga0105249_103405842 | 243 |
| 185 | 3300010375 | Ga0105239_10091093 | Ga0105239_100910933 | 243 |
| 186 | 3300010375 | Ga0105239_10102484 | Ga0105239_101024841 | 243 |
| 187 | 3300010375 | Ga0105239_10955817 | Ga0105239_109558172 | 243 |
| 188 | 3300010375 | Ga0105239_11017418 | Ga0105239_110174182 | 243 |
| 189 | 3300011119 | Ga0105246_10003723 | Ga0105246_1000372310 | 243 |
| 190 | 3300011119 | Ga0105246_10058444 | Ga0105246_100584442 | 243 |
| 191 | 3300013105 | Ga0157369_10391806 | Ga0157369_103918062 | 243 |
| 192 | 3300013297 | Ga0157378_10117761 | Ga0157378_101177614 | 243 |
| 193 | 3300013308 | Ga0157375_10380374 | Ga0157375_103803742 | 243 |
| 194 | 3300014325 | Ga0163163_10486471 | Ga0163163_104864712 | 243 |
| 195 | 3300014326 | Ga0157380_10050202 | Ga0157380_100502023 | 243 |
| 196 | 3300014969 | Ga0157376_10214803 | Ga0157376_102148033 | 243 |
| 197 | 3300014969 | Ga0157376_10244157 | Ga0157376_102441571 | 243 |
| 198 | 3300025898 | Ga0207692_10000001 | Ga0207692_10000001394 | 243 |
| 199 | 3300025898 | Ga0207692_10033546 | Ga0207692_100335462 | 243 |
| 200 | 3300025898 | Ga0207692_10125689 | Ga0207692_101256892 | 243 |
| 201 | 3300025899 | Ga0207642_10233582 | Ga0207642_102335822 | 243 |
| 202 | 3300025900 | Ga0207710_10100783 | Ga0207710_101007832 | 243 |
| 203 | 3300025900 | Ga0207710_10182523 | Ga0207710_101825232 | 243 |
| 204 | 3300025901 | Ga0207688_10010571 | Ga0207688_100105716 | 243 |
| 205 | 3300025901 | Ga0207688_10070741 | Ga0207688_100707412 | 243 |
| 206 | 3300025903 | Ga0207680_10399415 | Ga0207680_103994152 | 243 |
| 207 | 3300025904 | Ga0207647_10022339 | Ga0207647_100223393 | 243 |
| 208 | 3300025906 | Ga0207699_10071102 | Ga0207699_100711022 | 243 |
| 209 | 3300025907 | Ga0207645_10034359 | Ga0207645_100343594 | 243 |
| 210 | 3300025908 | Ga0207643_10017145 | Ga0207643_100171453 | 243 |
| 211 | 3300025909 | Ga0207705_10266465 | Ga0207705_102664652 | 243 |
| 212 | 3300025911 | Ga0207654_10244684 | Ga0207654_102446842 | 243 |
| 213 | 3300025913 | Ga0207695_10161729 | Ga0207695_101617292 | 243 |
| 214 | 3300025915 | Ga0207693_10001833 | Ga0207693_1000183316 | 243 |
| 215 | 3300025916 | Ga0207663_10073927 | Ga0207663_100739273 | 243 |
| 216 | 3300025916 | Ga0207663_10181306 | Ga0207663_101813062 | 243 |
| 217 | 3300025917 | Ga0207660_10182611 | Ga0207660_101826112 | 243 |
| 218 | 3300025918 | Ga0207662_10002962 | Ga0207662_1000296210 | 243 |
| 219 | 3300025918 | Ga0207662_10049250 | Ga0207662_100492502 | 243 |
| 220 | 3300025919 | Ga0207657_10033647 | Ga0207657_100336474 | 243 |
| 221 | 3300025919 | Ga0207657_10045503 | Ga0207657_100455034 | 243 |
| 222 | 3300025927 | Ga0207687_10056074 | Ga0207687_100560743 | 243 |
| 223 | 3300025927 | Ga0207687_10081742 | Ga0207687_100817422 | 243 |
| 224 | 3300025927 | Ga0207687_10178803 | Ga0207687_101788031 | 243 |
| 225 | 3300025928 | Ga0207700_10200298 | Ga0207700_102002983 | 243 |
| 226 | 3300025929 | Ga0207664_10000008 | Ga0207664_10000008161 | 243 |
| 227 | 3300025929 | Ga0207664_10004951 | Ga0207664_1000495111 | 243 |
| 228 | 3300025929 | Ga0207664_10118803 | Ga0207664_101188034 | 243 |
| 229 | 3300025932 | Ga0207690_10000024 | Ga0207690_100000247 | 243 |
| 230 | 3300025933 | Ga0207706_10063389 | Ga0207706_100633892 | 243 |
| 231 | 3300025938 | Ga0207704_10108336 | Ga0207704_101083363 | 243 |
| 232 | 3300025940 | Ga0207691_10051339 | Ga0207691_100513393 | 243 |
| 233 | 3300025942 | Ga0207689_10013144 | Ga0207689_100131444 | 243 |
| 234 | 3300025942 | Ga0207689_10050438 | Ga0207689_100504384 | 243 |
| 235 | 3300025944 | Ga0207661_10195976 | Ga0207661_101959762 | 243 |
| 236 | 3300025944 | Ga0207661_10504883 | Ga0207661_105048832 | 243 |
| 237 | 3300025945 | Ga0207679_10173002 | Ga0207679_101730023 | 243 |
| 238 | 3300025960 | Ga0207651_10217875 | Ga0207651_102178752 | 243 |
| 239 | 3300025961 | Ga0207712_10491507 | Ga0207712_104915072 | 243 |
| 240 | 3300025972 | Ga0207668_10071651 | Ga0207668_100716514 | 243 |
| 241 | 3300025981 | Ga0207640_10105042 | Ga0207640_101050423 | 243 |
| 242 | 3300025981 | Ga0207640_10168458 | Ga0207640_101684583 | 243 |
| 243 | 3300026023 | Ga0207677_10120542 | Ga0207677_101205424 | 243 |
| 244 | 3300026041 | Ga0207639_10038928 | Ga0207639_100389283 | 243 |
| 245 | 3300026067 | Ga0207678_10075553 | Ga0207678_100755533 | 243 |
| 246 | 3300026067 | Ga0207678_10169512 | Ga0207678_101695122 | 243 |
| 247 | 3300026075 | Ga0207708_10023060 | Ga0207708_100230603 | 243 |
| 248 | 3300026075 | Ga0207708_10138666 | Ga0207708_101386663 | 243 |
| 249 | 3300026078 | Ga0207702_10166857 | Ga0207702_101668574 | 243 |
| 250 | 3300026078 | Ga0207702_10695564 | Ga0207702_106955642 | 243 |
| 251 | 3300026089 | Ga0207648_10022753 | Ga0207648_100227536 | 243 |
| 252 | 3300026089 | Ga0207648_10064883 | Ga0207648_100648833 | 243 |
| 253 | 3300026095 | Ga0207676_10033139 | Ga0207676_100331392 | 243 |
| 254 | 3300026095 | Ga0207676_10046517 | Ga0207676_100465173 | 243 |
| 255 | 3300026116 | Ga0207674_10064591 | Ga0207674_100645916 | 243 |
| 256 | 3300026116 | Ga0207674_10072685 | Ga0207674_100726854 | 243 |
| 257 | 3300026118 | Ga0207675_100059210 | Ga0207675_1000592101 | 243 |
| 258 | 3300026118 | Ga0207675_100514911 | Ga0207675_1005149113 | 243 |
| 259 | 3300028379 | Ga0268266_10000369 | Ga0268266_1000036912 | 243 |
| 260 | 3300028379 | Ga0268266_10010641 | Ga0268266_100106414 | 243 |
| 261 | 3300028379 | Ga0268266_10061020 | Ga0268266_100610203 | 243 |
| 262 | 3300028558 | Ga0265326_10000004 | Ga0265326_1000000481 | 243 |
| 263 | 3300028563 | Ga0265319_1001287 | Ga0265319_100128714 | 243 |
| 264 | 3300028577 | Ga0265318_10000571 | Ga0265318_1000057114 | 243 |
| 265 | 3300028577 | Ga0265318_10028919 | Ga0265318_100289194 | 243 |
| 266 | 3300028666 | Ga0265336_10000049 | Ga0265336_1000004955 | 243 |
| 267 | 3300028666 | Ga0265336_10001251 | Ga0265336_100012513 | 243 |
| 268 | 3300028800 | Ga0265338_10000046 | Ga0265338_10000046150 | 243 |
| 269 | 3300028800 | Ga0265338_10002452 | Ga0265338_1000245236 | 243 |
| 270 | 3300029957 | Ga0265324_10004699 | Ga0265324_100046996 | 243 |
| 271 | 3300031240 | Ga0265320_10099651 | Ga0265320_100996512 | 243 |
| 272 | 3300031241 | Ga0265325_10118001 | Ga0265325_101180012 | 243 |
| 273 | 3300031247 | Ga0265340_10000003 | Ga0265340_1000000355 | 243 |
| 274 | 3300031249 | Ga0265339_10017899 | Ga0265339_100178993 | 243 |
| 275 | 3300031251 | Ga0265327_10003738 | Ga0265327_1000373820 | 243 |
| 276 | 3300031251 | Ga0265327_10027460 | Ga0265327_100274602 | 243 |
| 277 | 3300031344 | Ga0265316_10033558 | Ga0265316_100335583 | 243 |
| 278 | 3300031344 | Ga0265316_10406781 | Ga0265316_104067812 | 243 |
| 279 | 3300031548 | Ga0307408_100257825 | Ga0307408_1002578252 | 243 |
| 280 | 3300031995 | Ga0307409_100285715 | Ga0307409_1002857153 | 243 |
| 281 | 3300032002 | Ga0307416_100662657 | Ga0307416_1006626572 | 243 |
| 282 | 3300032126 | Ga0307415_100283234 | Ga0307415_1002832343 | 243 |
| 283 | 3300035117 | Ga0373953_0052814 | Ga0373953_0052814_130_927 | 243 |
| 284 | 3300035410 | Ga0373924_0066876 | Ga0373924_0066876_301_1098 | 243 |
| 285 | 3300037466 | Ga0395898_0110043 | Ga0395898_0110043_1230_2033 | 243 |
| 286 | 3300037466 | Ga0395898_0128049 | Ga0395898_0128049_490_1293 | 243 |
| 287 | 3300037471 | Ga0395905_0516650 | Ga0395905_0516650_90_893 | 243 |
| 288 | 3300044694 | Ga0466963_0012479 | Ga0466963_0012479_3996_4781 | 243 |
| 289 | 3300044694 | Ga0466963_0212363 | Ga0466963_0212363_402_1187 | 243 |
| 290 | 3300044706 | Ga0466964_0132105 | Ga0466964_0132105_251_1039 | 243 |
| 291 | 3300044706 | Ga0466964_0189726 | Ga0466964_0189726_53_832 | 243 |
| 292 | 3300044765 | Ga0466970_0095415 | Ga0466970_0095415_644_1429 | 243 |
| 293 | 3300044901 | Ga0466960_0017495 | Ga0466960_0017495_728_1531 | 243 |
| 294 | 3300045049 | Ga0466959_0021126 | Ga0466959_0021126_400_1200 | 243 |
| 295 | 3300045836 | Ga0466958_0103720 | Ga0466958_0103720_328_1125 | 243 |
| 296 | 3300045976 | Ga0466967_0011863 | Ga0466967_0011863_400_1191 | 243 |
| 297 | 3300045976 | Ga0466967_0100861 | Ga0466967_0100861_1461_2255 | 243 |
| 298 | 3300045976 | Ga0466967_0217143 | Ga0466967_0217143_711_1496 | 243 |
| 299 | 3300045976 | Ga0466967_0217679 | Ga0466967_0217679_311_1096 | 243 |
| 300 | 3300045976 | Ga0466967_0233005 | Ga0466967_0233005_253_1044 | 243 |
| 301 | 3300045976 | Ga0466967_0459684 | Ga0466967_0459684_233_1036 | 243 |
| 302 | 3300045976 | Ga0466967_0469357 | Ga0466967_0469357_250_1035 | 243 |
| 303 | 3300046459 | Ga0495629_0061933 | Ga0495629_0061933_687_1484 | 243 |
| 304 | 3300046463 | Ga0495653_0094924 | Ga0495653_0094924_1214_2011 | 243 |
| 305 | 3300046471 | Ga0495650_0000049 | Ga0495650_0000049_166210_167013 | 243 |
| 306 | 3300046491 | Ga0495584_0079953 | Ga0495584_0079953_68_853 | 243 |
| 307 | 3300046511 | Ga0495608_0006162 | Ga0495608_0006162_1549_2346 | 243 |
| 308 | 3300046514 | Ga0495618_0085118 | Ga0495618_0085118_355_1152 | 243 |
| 309 | 3300046516 | Ga0495628_0261126 | Ga0495628_0261126_86_883 | 243 |
| 310 | 3300046529 | Ga0495652_0032377 | Ga0495652_0032377_756_1553 | 243 |
| 311 | 3300046536 | Ga0495587_0199294 | Ga0495587_0199294_55_852 | 243 |
| 312 | 3300046559 | Ga0495667_0006202 | Ga0495667_0006202_1197_1994 | 243 |
| 313 | 3300046642 | Ga0495634_0048538 | Ga0495634_0048538_1394_2191 | 243 |
| 314 | 3300046663 | Ga0495635_0065760 | Ga0495635_0065760_1101_1898 | 243 |
| 315 | 3300046675 | Ga0495657_0074589 | Ga0495657_0074589_244_1041 | 243 |
| 316 | 3300046678 | Ga0495599_0022077 | Ga0495599_0022077_401_1198 | 243 |
| 317 | 3300046679 | Ga0495623_0022794 | Ga0495623_0022794_424_1221 | 243 |
| 318 | 3300046680 | Ga0495646_0048509 | Ga0495646_0048509_434_1231 | 243 |
| 319 | 3300047317 | Ga0495604_0044828 | Ga0495604_0044828_1729_2526 | 243 |
| 320 | 3300047319 | Ga0495674_0028464 | Ga0495674_0028464_525_1322 | 243 |
| 321 | 3300047322 | Ga0495680_0016204 | Ga0495680_0016204_3882_4679 | 243 |
| 322 | 3300047471 | Ga0495684_0048838 | Ga0495684_0048838_1210_2007 | 243 |
| 323 | 3300048088 | Ga0495602_0009457 | Ga0495602_0009457_422_1219 | 243 |
| 324 | 3300048903 | Ga0496100_0260997 | Ga0496100_0260997_185_979 | 243 |
| 325 | 3300048903 | Ga0496100_0591421 | Ga0496100_0591421_61_840 | 243 |
| 326 | 3300048904 | Ga0496101_0046073 | Ga0496101_0046073_2159_2944 | 243 |
| 327 | 3300048904 | Ga0496101_0171541 | Ga0496101_0171541_521_1306 | 243 |
| 328 | 3300048904 | Ga0496101_0474113 | Ga0496101_0474113_40_843 | 243 |
| 329 | 3300048904 | Ga0496101_0604550 | Ga0496101_0604550_22_816 | 243 |
| 330 | 3300048905 | Ga0496102_0024520 | Ga0496102_0024520_2726_3511 | 243 |
| 331 | 3300048905 | Ga0496102_0058357 | Ga0496102_0058357_2123_2917 | 243 |
| 332 | 3300048906 | Ga0496103_0018988 | Ga0496103_0018988_267_1052 | 243 |
| 333 | 3300048906 | Ga0496103_0158915 | Ga0496103_0158915_228_1013 | 243 |
| 334 | 3300048907 | Ga0496104_0002080 | Ga0496104_0002080_4318_5103 | 243 |
| 335 | 3300048907 | Ga0496104_0003989 | Ga0496104_0003989_8361_9140 | 243 |
| 336 | 3300048907 | Ga0496104_0077073 | Ga0496104_0077073_1006_1803 | 243 |
| 337 | 3300048908 | Ga0496105_0008283 | Ga0496105_0008283_5196_5981 | 243 |
| 338 | 3300048908 | Ga0496105_0145136 | Ga0496105_0145136_760_1539 | 243 |
| 339 | 3300048909 | Ga0496106_0234677 | Ga0496106_0234677_272_1057 | 243 |
| 340 | 3300048910 | Ga0496107_0119334 | Ga0496107_0119334_377_1162 | 243 |
| 341 | 3300048911 | Ga0496108_0009653 | Ga0496108_0009653_6054_6839 | 243 |
| 342 | 3300048911 | Ga0496108_0050475 | Ga0496108_0050475_987_1772 | 243 |
| 343 | 3300048912 | Ga0496109_0050157 | Ga0496109_0050157_850_1635 | 243 |
| 344 | 3300048912 | Ga0496109_0537999 | Ga0496109_0537999_289_1083 | 243 |
| 345 | 3300048913 | Ga0496110_0007072 | Ga0496110_0007072_170_955 | 243 |
| 346 | 3300048913 | Ga0496110_0601876 | Ga0496110_0601876_58_849 | 243 |
| 347 | 3300048914 | Ga0496111_0030928 | Ga0496111_0030928_1377_2162 | 243 |
| 348 | 3300048914 | Ga0496111_0061907 | Ga0496111_0061907_966_1751 | 243 |
| 349 | 3300048915 | Ga0496112_0015954 | Ga0496112_0015954_3275_4072 | 243 |
| 350 | 3300048915 | Ga0496112_0018457 | Ga0496112_0018457_2314_3117 | 243 |
| 351 | 3300048921 | Ga0496118_0159537 | Ga0496118_0159537_45_824 | 243 |
| 352 | 3300048922 | Ga0496119_0036783 | Ga0496119_0036783_150_929 | 243 |
| 353 | 3300048924 | Ga0496121_0088169 | Ga0496121_0088169_1236_2015 | 243 |
| 354 | 3300048927 | Ga0496124_0059369 | Ga0496124_0059369_1890_2690 | 243 |
| 355 | 3300048927 | Ga0496124_0084792 | Ga0496124_0084792_982_1761 | 243 |
| 356 | 3300048928 | Ga0496125_0222388 | Ga0496125_0222388_294_1073 | 243 |
| 357 | 3300048929 | Ga0496126_0076127 | Ga0496126_0076127_1870_2649 | 243 |
| 358 | 3300048929 | Ga0496126_0194394 | Ga0496126_0194394_379_1158 | 243 |
| 359 | 3300048929 | Ga0496126_0194628 | Ga0496126_0194628_439_1218 | 243 |
| 360 | 3300049568 | Ga0501031_0000142 | Ga0501031_0000142_23828_24607 | 243 |
| 361 | 3300049569 | Ga0501032_0000578 | Ga0501032_0000578_15710_16489 | 243 |
| 362 | 3300049570 | Ga0501033_0000688 | Ga0501033_0000688_6711_7490 | 243 |
| 363 | 3300049571 | Ga0501034_0012865 | Ga0501034_0012865_3224_4003 | 243 |
| 364 | 3300049572 | Ga0501036_0000679 | Ga0501036_0000679_23801_24580 | 243 |
| 365 | 3300049573 | Ga0501037_0000326 | Ga0501037_0000326_23811_24590 | 243 |
| 366 | 3300049574 | Ga0501038_0001850 | Ga0501038_0001850_16011_16790 | 243 |
| 367 | 3300049575 | Ga0501039_0020122 | Ga0501039_0020122_674_1453 | 243 |
| 368 | 3300049578 | Ga0501042_0065658 | Ga0501042_0065658_421_1200 | 243 |
| 369 | 3300049579 | Ga0501043_0000379 | Ga0501043_0000379_15723_16502 | 243 |
| 370 | 3300049580 | Ga0501046_0000468 | Ga0501046_0000468_15695_16474 | 243 |
| 371 | 3300049581 | Ga0501047_0000551 | Ga0501047_0000551_15794_16573 | 243 |
| 372 | 3300049582 | Ga0501048_0000177 | Ga0501048_0000177_23851_24630 | 243 |
| 373 | 3300049584 | Ga0501068_0028488 | Ga0501068_0028488_2327_3106 | 243 |
| 374 | 3300049585 | Ga0501069_0000896 | Ga0501069_0000896_9762_10541 | 243 |
| 375 | 3300049586 | Ga0501070_0000225 | Ga0501070_0000225_37301_38080 | 243 |
| 376 | 3300049588 | Ga0501072_0279338 | Ga0501072_0279338_181_960 | 243 |
| 377 | 3300049589 | Ga0501073_0009192 | Ga0501073_0009192_6298_7077 | 243 |
| 378 | 3300049590 | Ga0501074_0006267 | Ga0501074_0006267_6827_7606 | 243 |
| 379 | 3300049741 | Ga0501079_0000687 | Ga0501079_0000687_15683_16462 | 243 |
| 380 | 3300049742 | Ga0501080_0429834 | Ga0501080_0429834_348_1127 | 243 |
| 381 | 3300049744 | Ga0501083_0000451 | Ga0501083_0000451_14242_15021 | 243 |
| 382 | 3300049822 | Ga0501035_0000578 | Ga0501035_0000578_23855_24634 | 243 |
| 383 | 3300049823 | Ga0501044_0000533 | Ga0501044_0000533_15724_16503 | 243 |
| 384 | 3300049824 | Ga0501045_0237675 | Ga0501045_0237675_446_1225 | 243 |
| 385 | 3300050515 | nmdc:mga0a205_317939_c1 | nmdc:mga0a205_317939_c1_492_1277 | 243 |
| 386 | 3300053077 | Ga0495601_0048987 | Ga0495601_0048987_256_1053 | 243 |
| 387 | 3300053084 | Ga0495595_0006394 | Ga0495595_0006394_283_1080 | 243 |
| 388 | 3300053085 | Ga0495619_0011811 | Ga0495619_0011811_1256_2053 | 243 |
| 389 | 3300053104 | Ga0500556_0000811 | Ga0500556_0000811_13269_14066 | 243 |
| 390 | 3300053153 | Ga0500616_0006674 | Ga0500616_0006674_4093_4890 | 243 |
| 391 | 3300054114 | Ga0501084_0062265 | Ga0501084_0062265_331_1110 | 243 |
| 392 | 3300060353 | Ga0501082_0003589 | Ga0501082_0003589_6749_7528 | 243 |
| 393 | 3300001979 | JGI24740J21852_10005493 | JGI24740J21852_100054934 | 244 |
| 394 | 3300003373 | JGI25407J50210_10016653 | JGI25407J50210_100166531 | 244 |
| 395 | 3300005327 | Ga0070658_10376320 | Ga0070658_103763203 | 244 |
| 396 | 3300005339 | Ga0070660_100279119 | Ga0070660_1002791193 | 244 |
| 397 | 3300005344 | Ga0070661_100184467 | Ga0070661_1001844672 | 244 |
| 398 | 3300005356 | Ga0070674_100062356 | Ga0070674_1000623561 | 244 |
| 399 | 3300005366 | Ga0070659_100242630 | Ga0070659_1002426301 | 244 |
| 400 | 3300005455 | Ga0070663_100013344 | Ga0070663_1000133443 | 244 |
| 401 | 3300005458 | Ga0070681_10120990 | Ga0070681_101209901 | 244 |
| 402 | 3300005459 | Ga0068867_100153147 | Ga0068867_1001531472 | 244 |
| 403 | 3300005530 | Ga0070679_100004738 | Ga0070679_1000047383 | 244 |
| 404 | 3300005564 | Ga0070664_100389371 | Ga0070664_1003893712 | 244 |
| 405 | 3300005981 | Ga0081538_10000665 | Ga0081538_1000066534 | 244 |
| 406 | 3300005981 | Ga0081538_10010972 | Ga0081538_100109724 | 244 |
| 407 | 3300025921 | Ga0207652_10000947 | Ga0207652_1000094723 | 244 |
| 408 | 3300025933 | Ga0207706_10263606 | Ga0207706_102636062 | 244 |
| 409 | 3300025933 | Ga0207706_10373635 | Ga0207706_103736352 | 244 |
| 410 | 3300025945 | Ga0207679_10297908 | Ga0207679_102979082 | 244 |
| 411 | 3300025972 | Ga0207668_10334630 | Ga0207668_103346301 | 244 |
| 412 | 3300026067 | Ga0207678_10019644 | Ga0207678_100196442 | 244 |
| 413 | 3300026121 | Ga0207683_10061166 | Ga0207683_100611663 | 244 |
| 414 | 3300028379 | Ga0268266_10520246 | Ga0268266_105202462 | 244 |
| 415 | 3300031824 | Ga0307413_10390180 | Ga0307413_103901801 | 244 |
| 416 | 3300031901 | Ga0307406_10098400 | Ga0307406_100984003 | 244 |
| 417 | 3300032126 | Ga0307415_100211357 | Ga0307415_1002113573 | 244 |
| 418 | 3300035170 | Ga0373943_0110759 | Ga0373943_0110759_613_1401 | 244 |
| 419 | 3300035725 | Ga0373947_0226117 | Ga0373947_0226117_246_1034 | 244 |
| 420 | 3300037312 | Ga0395899_0128678 | Ga0395899_0128678_352_1134 | 244 |
| 421 | 3300037418 | Ga0395900_0202239 | Ga0395900_0202239_1145_1927 | 244 |
| 422 | 3300037418 | Ga0395900_0630508 | Ga0395900_0630508_97_900 | 244 |
| 423 | 3300037466 | Ga0395898_0030279 | Ga0395898_0030279_310_1092 | 244 |
| 424 | 3300037466 | Ga0395898_0095576 | Ga0395898_0095576_1764_2546 | 244 |
| 425 | 3300037471 | Ga0395905_0240427 | Ga0395905_0240427_311_1093 | 244 |
| 426 | 3300038443 | Ga0395901_0011241 | Ga0395901_0011241_2500_3282 | 244 |
| 427 | 3300038443 | Ga0395901_0088071 | Ga0395901_0088071_1720_2502 | 244 |
| 428 | 3300049568 | Ga0501031_0104839 | Ga0501031_0104839_272_1066 | 244 |
| 429 | 3300049572 | Ga0501036_0174970 | Ga0501036_0174970_480_1274 | 244 |
| 430 | 3300049572 | Ga0501036_0234609 | Ga0501036_0234609_700_1494 | 244 |
| 431 | 3300049575 | Ga0501039_0203353 | Ga0501039_0203353_449_1243 | 244 |
| 432 | 3300049576 | Ga0501040_0020869 | Ga0501040_0020869_1139_1933 | 244 |
| 433 | 3300049576 | Ga0501040_0239332 | Ga0501040_0239332_334_1128 | 244 |
| 434 | 3300049576 | Ga0501040_0299221 | Ga0501040_0299221_304_1098 | 244 |
| 435 | 3300049577 | Ga0501041_0070246 | Ga0501041_0070246_492_1286 | 244 |
| 436 | 3300049577 | Ga0501041_0099449 | Ga0501041_0099449_62_856 | 244 |
| 437 | 3300049578 | Ga0501042_0118094 | Ga0501042_0118094_469_1263 | 244 |
| 438 | 3300049578 | Ga0501042_0197395 | Ga0501042_0197395_282_1076 | 244 |
| 439 | 3300049580 | Ga0501046_0131769 | Ga0501046_0131769_295_1089 | 244 |
| 440 | 3300049584 | Ga0501068_0070961 | Ga0501068_0070961_493_1287 | 244 |
| 441 | 3300049587 | Ga0501071_0059202 | Ga0501071_0059202_455_1249 | 244 |
| 442 | 3300049588 | Ga0501072_0337290 | Ga0501072_0337290_333_1127 | 244 |
| 443 | 3300049589 | Ga0501073_0150376 | Ga0501073_0150376_422_1216 | 244 |
| 444 | 3300049590 | Ga0501074_0312129 | Ga0501074_0312129_258_1052 | 244 |
| 445 | 3300049592 | Ga0501076_0174984 | Ga0501076_0174984_50_844 | 244 |
| 446 | 3300049741 | Ga0501079_0361029 | Ga0501079_0361029_37_831 | 244 |
| 447 | 3300049744 | Ga0501083_0104100 | Ga0501083_0104100_702_1496 | 244 |
| 448 | 3300049822 | Ga0501035_0117597 | Ga0501035_0117597_220_1014 | 244 |
| 449 | 3300049822 | Ga0501035_0289588 | Ga0501035_0289588_517_1311 | 244 |
| 450 | 3300054114 | Ga0501084_0149162 | Ga0501084_0149162_217_1011 | 244 |
| 451 | 3300060353 | Ga0501082_0066301 | Ga0501082_0066301_276_1070 | 244 |
| 452 | 3300060353 | Ga0501082_0273051 | Ga0501082_0273051_542_1336 | 244 |
| 453 | 3300061734 | Ga0530510_0186668 | Ga0530510_0186668_408_1202 | 244 |
| 454 | 3300061734 | Ga0530510_0332108 | Ga0530510_0332108_334_1128 | 244 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7e80-assembly1.cif.gz_CE | cryo-em structure of the flagellar rod with hook and export apparatus from salmonella | 0.7376 | 11 | 240 |
| 6r6b-assembly1.cif.gz_F | structure of the core shigella flexneri type iii secretion system export gate complex sctrst (spa24/spa9/spa29). | 0.719 | 13 | 239 |
| 7bin-assembly1.cif.gz_F | salmonella export gate and rod refined in focussed c1 map | 0.7128 | 2 | 240 |
| 7ahi-assembly1.cif.gz_1F | substrate-engaged type 3 secretion system needle complex from salmonella enterica typhimurium - spar state 2 | 0.7007 | 11 | 219 |
| 7e80-assembly1.cif.gz_CE | cryo-em structure of the flagellar rod with hook and export apparatus from salmonella | 0.6996 | 11 | 240 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4m70H00 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; | 0.3766 | 12 | 140 | 1.20.5.4130 |
| 4m70H00 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; | 0.3608 | 12 | 140 | 1.20.5.4130 |
| af_I1KQQ7_1_146_1.20.930.20 | Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Adaptor protein Cbl, N-terminal domain | 0.3276 | 6 | 140 | 1.20.930.20 |
| af_Q9W3W4_54_201_1.20.1260.10 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.3259 | 11 | 151 | 1.20.1260.10 |
| af_M1FN39_66_236_1.20.120.220 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A | 0.3206 | 81 | 240 | 1.20.120.220 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538K290-F1-model_v4 | Flagellar biosynthetic protein FliR | 0.8616 | 70 | 241 |
GO:0005886
GO:0006605 |
| AF-A0A7M2Z0Y3-F1-model_v4 | Flagellar biosynthetic protein FliR | 0.8467 | 11 | 240 |
GO:0005886
GO:0006605 GO:0009425 GO:0044780 |
| AF-A0A524QQ24-F1-model_v4 | Type III secretion protein | 0.8407 | 71 | 241 |
GO:0005886
GO:0006605 |
| AF-D5WPG5-F1-model_v4 | Flagellar biosynthetic protein FliR | 0.8338 | 11 | 243 |
GO:0005886
GO:0006605 |
| AF-A0A0W8J9X5-F1-model_v4 | Flagellar biosynthetic protein FliR | 0.8337 | 11 | 236 |
GO:0005886
GO:0006605 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar