F447317

General Info

Members Datasets Scaffolds Average Seq Length
454 252 454 260

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10376320|Ga0070658_103763203
Length 267
Sequence VNVDQLIAQFGEQQVASFMLVLGRVGPLFLLAPMFSSRMMPARAKGVAAVALAIGIAPVAMRAAGSASGHLPDDVLGFAGLMFKEILVGTAFAFALGAFFAAVSVAGTLLDTFVGFSFGSLVDPVTGNAGGALNQLYALVGVGIFIAIGGDTWVITGLARTYEAVPLLSAPDIGSLVEGMQVAFSGIFGAALEVCAPVLLAVVLTDAAFGVVSKVVPQLNVFAVGFPAKVTVGLVVIGASLPFLAGWLDDELQRSVASALHALKVAG

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
128 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
129 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
130 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
131 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
132 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
133 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
134 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
135 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
136 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
137 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
138 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
141 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
142 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
143 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
148 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
149 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
150 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
157 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
158 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
159 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
160 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
161 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
162 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
163 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
164 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
165 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
166 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
167 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
168 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
169 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
170 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
171 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
172 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
173 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
174 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
175 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
176 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
177 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
178 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
179 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
180 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
181 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
182 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
183 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
184 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
189 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
203 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
204 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
205 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
206 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
207 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
208 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
209 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
210 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
211 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
227 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
228 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
229 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
230 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
231 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
232 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
233 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
234 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
235 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
236 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
237 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
238 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
241 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
242 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
243 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
244 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
245 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
246 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
247 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
248 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
249 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
250 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
251 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
252 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.88
Nodule 0
Rhizoplane 8.15
Rhizosphere 86.78
Stem 0
Stem Tuber 0
Unclassified 4.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10005493 3300001979 Bacteria 5357
2 JGI24743J22301_10004039 3300001991 Bacteria 2362
3 JGI25407J50210_10016653 3300003373 Bacteria 1904
4 Ga0070658_10246340 3300005327 Bacteria 1516
5 Ga0070658_10376320 3300005327 Bacteria 1218
6 Ga0070683_100074598 3300005329 Bacteria 3168
7 Ga0070683_100346518 3300005329 Bacteria 1415
8 Ga0068869_100038071 3300005334 Bacteria 3424
9 Ga0068869_100320399 3300005334 Unclassified 1257
10 Ga0070666_10362507 3300005335 Bacteria 1038
11 Ga0070682_100056010 3300005337 Bacteria 2478
12 Ga0070682_100065706 3300005337 Bacteria 2306
13 Ga0068868_100050716 3300005338 Bacteria 3260
14 Ga0068868_100082853 3300005338 Bacteria 2573
15 Ga0068868_100349385 3300005338 Bacteria 1266
16 Ga0070660_100023186 3300005339 Bacteria 4597
17 Ga0070660_100279119 3300005339 Bacteria 1367
18 Ga0070689_100018764 3300005340 Bacteria 5102
19 Ga0070691_10117503 3300005341 Bacteria 1336
20 Ga0070687_100030116 3300005343 Bacteria 2650
21 Ga0070661_100102786 3300005344 Bacteria 2127
22 Ga0070661_100184467 3300005344 Bacteria 1589
23 Ga0070661_100506513 3300005344 Bacteria 967
24 Ga0070668_100139111 3300005347 Bacteria 1955
25 Ga0070675_100178778 3300005354 Bacteria 1833
26 Ga0070674_100062356 3300005356 Bacteria 2605
27 Ga0070673_100291304 3300005364 Bacteria 1434
28 Ga0070688_100006905 3300005365 Bacteria 6094
29 Ga0070659_100000002 3300005366 Bacteria 369239
30 Ga0070659_100242630 3300005366 Bacteria 1492
31 Ga0070667_100002431 3300005367 Bacteria 16284
32 Ga0070667_100220598 3300005367 Bacteria 1688
33 Ga0070703_10110714 3300005406 Bacteria 982
34 Ga0070714_100000019 3300005435 Bacteria 169455
35 Ga0070714_100058067 3300005435 Bacteria 3313
36 Ga0070714_100213810 3300005435 Bacteria 1769
37 Ga0070714_100399667 3300005435 Bacteria 1298
38 Ga0070713_100024779 3300005436 Bacteria 4681
39 Ga0070713_100213376 3300005436 Bacteria 1748
40 Ga0070710_10000007 3300005437 Bacteria 215320
41 Ga0070710_10011679 3300005437 Bacteria 4345
42 Ga0070710_10326528 3300005437 Bacteria 1009
43 Ga0070701_10128817 3300005438 Bacteria 1435
44 Ga0070711_100022507 3300005439 Bacteria 4086
45 Ga0070711_100129065 3300005439 Bacteria 1880
46 Ga0070705_100002330 3300005440 Bacteria 9581
47 Ga0070700_100066722 3300005441 Bacteria 2285
48 Ga0070663_100013344 3300005455 Bacteria 5235
49 Ga0070663_100072369 3300005455 Bacteria 2511
50 Ga0070662_100110949 3300005457 Bacteria 2089
51 Ga0070681_10120990 3300005458 Bacteria 2553
52 Ga0068867_100082799 3300005459 Bacteria 2421
53 Ga0068867_100153147 3300005459 Bacteria 1813
54 Ga0070685_10117116 3300005466 Bacteria 1649
55 Ga0070679_100004738 3300005530 Bacteria 12543
56 Ga0068853_100684135 3300005539 Bacteria 978
57 Ga0070672_100043362 3300005543 Bacteria 3468
58 Ga0070665_100001875 3300005548 Bacteria 23884
59 Ga0070665_100025731 3300005548 Bacteria 5928
60 Ga0070665_100139022 3300005548 Bacteria 2432
61 Ga0070665_100606386 3300005548 Bacteria 1108
62 Ga0070665_100738086 3300005548 Bacteria 998
63 Ga0070704_100128986 3300005549 Bacteria 1956
64 Ga0070664_100148545 3300005564 Bacteria 2068
65 Ga0070664_100389371 3300005564 Bacteria 1273
66 Ga0070664_100435273 3300005564 Bacteria 1202
67 Ga0070664_100489856 3300005564 Bacteria 1132
68 Ga0068857_100203168 3300005577 Bacteria 1806
69 Ga0068854_100020848 3300005578 Bacteria 4440
70 Ga0068856_100398174 3300005614 Bacteria 1397
71 Ga0068856_100567789 3300005614 Bacteria 1156
72 Ga0070702_100027104 3300005615 Bacteria 3087
73 Ga0068852_100107822 3300005616 Bacteria 2527
74 Ga0068852_100215774 3300005616 Bacteria 1823
75 Ga0068859_100099840 3300005617 Bacteria 2958
76 Ga0068866_10033301 3300005718 Bacteria 2499
77 Ga0068861_100033238 3300005719 Bacteria 3803
78 Ga0068861_100039727 3300005719 Bacteria 3514
79 Ga0068861_100210955 3300005719 Bacteria 1636
80 Ga0068861_100534842 3300005719 Unclassified 1065
81 Ga0068858_100102020 3300005842 Bacteria 2676
82 Ga0081455_10026307 3300005937 Bacteria 5355
83 Ga0081455_10321265 3300005937 Bacteria 1102
84 Ga0081538_10000665 3300005981 Bacteria 37855
85 Ga0081538_10010972 3300005981 Bacteria 7377
86 Ga0081540_1001663 3300005983 Bacteria 18921
87 Ga0081540_1032658 3300005983 Bacteria 2838
88 Ga0081540_1035945 3300005983 Bacteria 2649
89 Ga0081539_10003690 3300005985 Bacteria 18292
90 Ga0081539_10007612 3300005985 Bacteria 9781
91 Ga0081539_10018156 3300005985 Bacteria 4896
92 Ga0070717_10000024 3300006028 Bacteria 158890
93 Ga0070717_10061046 3300006028 Bacteria 3123
94 Ga0070712_100000021 3300006175 Bacteria 83687
95 Ga0070712_100188196 3300006175 Bacteria 1613
96 Ga0075428_100611359 3300006844 Bacteria 1164
97 Ga0075428_100679820 3300006844 Bacteria 1097
98 Ga0075430_100000833 3300006846 Bacteria 24117
99 Ga0075434_100545878 3300006871 Bacteria 1179
100 Ga0068865_100137365 3300006881 Bacteria 1839
101 Ga0097620_100099840 3300006931 Bacteria 2958
102 Ga0105244_10100310 3300009036 Bacteria 1417
103 Ga0105240_10042190 3300009093 Bacteria 5815
104 Ga0105240_10241646 3300009093 Bacteria 2093
105 Ga0105245_10006824 3300009098 Bacteria 10018
106 Ga0105245_10084221 3300009098 Bacteria 2912
107 Ga0105245_10088301 3300009098 Bacteria 2847
108 Ga0105245_10131983 3300009098 Bacteria 2344
109 Ga0105247_10072462 3300009101 Bacteria 2156
110 Ga0105247_10110492 3300009101 Bacteria 1769
111 Ga0105243_10080439 3300009148 Bacteria 2658
112 Ga0105243_10092154 3300009148 Bacteria 2497
113 Ga0105243_10304705 3300009148 Bacteria 1445
114 Ga0105241_10338247 3300009174 Bacteria 1303
115 Ga0105242_10162262 3300009176 Bacteria 1957
116 Ga0105242_10492301 3300009176 Bacteria 1164
117 Ga0105237_10492748 3300009545 Bacteria 1232
118 Ga0105238_10100129 3300009551 Bacteria 2881
119 Ga0105238_10273638 3300009551 Bacteria 1669
120 Ga0105238_10319885 3300009551 Bacteria 1537
121 Ga0105249_10050371 3300009553 Bacteria 3796
122 Ga0105249_10340584 3300009553 Bacteria 1516
123 Ga0105249_10402746 3300009553 Bacteria 1399
124 Ga0105239_10091093 3300010375 Bacteria 3365
125 Ga0105239_10102484 3300010375 Bacteria 3167
126 Ga0105239_10955817 3300010375 Bacteria 984
127 Ga0105239_11017418 3300010375 Bacteria 953
128 Ga0105246_10003723 3300011119 Bacteria 9231
129 Ga0105246_10058444 3300011119 Bacteria 2672
130 Ga0105246_10226338 3300011119 Bacteria 1469
131 Ga0157369_10391806 3300013105 Bacteria 1441
132 Ga0157378_10117761 3300013297 Bacteria 2444
133 Ga0163162_10492758 3300013306 Bacteria 1356
134 Ga0157375_10380374 3300013308 Bacteria 1578
135 Ga0163163_10486471 3300014325 Bacteria 1295
136 Ga0157380_10050202 3300014326 Bacteria 3294
137 Ga0157376_10214803 3300014969 Bacteria 1778
138 Ga0157376_10244157 3300014969 Bacteria 1674
139 Ga0207426_1007947 3300025302 Bacteria 4369
140 Ga0207692_10000001 3300025898 Bacteria 558345
141 Ga0207692_10033546 3300025898 Bacteria 2478
142 Ga0207692_10125689 3300025898 Bacteria 1442
143 Ga0207642_10233582 3300025899 Bacteria 1034
144 Ga0207710_10100783 3300025900 Bacteria 1362
145 Ga0207710_10182523 3300025900 Bacteria 1030
146 Ga0207710_10196571 3300025900 Bacteria 995
147 Ga0207688_10010571 3300025901 Bacteria 5019
148 Ga0207688_10070741 3300025901 Bacteria 1979
149 Ga0207680_10399415 3300025903 Bacteria 971
150 Ga0207647_10022339 3300025904 Bacteria 4203
151 Ga0207699_10071102 3300025906 Bacteria 2127
152 Ga0207645_10034359 3300025907 Bacteria 3258
153 Ga0207643_10017145 3300025908 Bacteria 3956
154 Ga0207643_10213962 3300025908 Bacteria 1177
155 Ga0207705_10259908 3300025909 Bacteria 1325
156 Ga0207705_10266465 3300025909 Bacteria 1309
157 Ga0207705_10338708 3300025909 Bacteria 1157
158 Ga0207654_10244684 3300025911 Bacteria 1200
159 Ga0207695_10161729 3300025913 Bacteria 2170
160 Ga0207693_10000001 3300025915 Bacteria 469535
161 Ga0207693_10001833 3300025915 Bacteria 18624
162 Ga0207663_10073927 3300025916 Bacteria 2207
163 Ga0207663_10181306 3300025916 Bacteria 1504
164 Ga0207660_10182611 3300025917 Bacteria 1630
165 Ga0207662_10002962 3300025918 Bacteria 8640
166 Ga0207662_10049250 3300025918 Bacteria 2499
167 Ga0207657_10033647 3300025919 Bacteria 4617
168 Ga0207657_10045503 3300025919 Bacteria 3851
169 Ga0207652_10000947 3300025921 Bacteria 27268
170 Ga0207659_10136697 3300025926 Bacteria 1898
171 Ga0207687_10056074 3300025927 Bacteria 2763
172 Ga0207687_10081742 3300025927 Bacteria 2336
173 Ga0207687_10178803 3300025927 Bacteria 1642
174 Ga0207687_10234246 3300025927 Bacteria 1452
175 Ga0207700_10024215 3300025928 Bacteria 4197
176 Ga0207700_10200298 3300025928 Bacteria 1682
177 Ga0207664_10000008 3300025929 Bacteria 309301
178 Ga0207664_10004951 3300025929 Bacteria 9063
179 Ga0207664_10118803 3300025929 Bacteria 2209
180 Ga0207690_10000024 3300025932 Bacteria 194416
181 Ga0207706_10063389 3300025933 Bacteria 3254
182 Ga0207706_10263606 3300025933 Bacteria 1504
183 Ga0207706_10373635 3300025933 Bacteria 1238
184 Ga0207709_10350618 3300025935 Bacteria 1114
185 Ga0207704_10108336 3300025938 Bacteria 1871
186 Ga0207691_10051339 3300025940 Bacteria 3771
187 Ga0207689_10013144 3300025942 Bacteria 7065
188 Ga0207689_10050438 3300025942 Bacteria 3432
189 Ga0207661_10195976 3300025944 Bacteria 1773
190 Ga0207661_10504883 3300025944 Bacteria 1105
191 Ga0207679_10173002 3300025945 Bacteria 1780
192 Ga0207679_10297908 3300025945 Bacteria 1389
193 Ga0207651_10217875 3300025960 Bacteria 1541
194 Ga0207712_10294054 3300025961 Bacteria 1330
195 Ga0207712_10491507 3300025961 Bacteria 1048
196 Ga0207668_10071651 3300025972 Bacteria 2476
197 Ga0207668_10334630 3300025972 Bacteria 1261
198 Ga0207640_10105042 3300025981 Bacteria 1989
199 Ga0207640_10168458 3300025981 Bacteria 1629
200 Ga0207677_10120542 3300026023 Bacteria 1972
201 Ga0207639_10038928 3300026041 Bacteria 3540
202 Ga0207678_10019644 3300026067 Bacteria 5941
203 Ga0207678_10075553 3300026067 Bacteria 2886
204 Ga0207678_10169512 3300026067 Bacteria 1864
205 Ga0207708_10023060 3300026075 Bacteria 4702
206 Ga0207708_10138666 3300026075 Bacteria 1906
207 Ga0207702_10166857 3300026078 Bacteria 2015
208 Ga0207702_10695564 3300026078 Bacteria 1002
209 Ga0207648_10022753 3300026089 Bacteria 5624
210 Ga0207648_10064883 3300026089 Bacteria 3183
211 Ga0207676_10033139 3300026095 Bacteria 3901
212 Ga0207676_10046517 3300026095 Bacteria 3358
213 Ga0207674_10064591 3300026116 Bacteria 3692
214 Ga0207674_10072685 3300026116 Bacteria 3454
215 Ga0207675_100059210 3300026118 Bacteria 3574
216 Ga0207675_100232204 3300026118 Bacteria 1780
217 Ga0207675_100514911 3300026118 Bacteria 1192
218 Ga0207683_10061166 3300026121 Bacteria 3314
219 Ga0207698_10274103 3300026142 Bacteria 1557
220 Ga0207698_10700455 3300026142 Bacteria 1008
221 Ga0268266_10000369 3300028379 Bacteria 69354
222 Ga0268266_10010641 3300028379 Bacteria 8015
223 Ga0268266_10061020 3300028379 Bacteria 3251
224 Ga0268266_10520246 3300028379 Bacteria 1138
225 Ga0268266_10707741 3300028379 Bacteria 971
226 Ga0265326_10000004 3300028558 Bacteria 283947
227 Ga0265319_1001287 3300028563 Bacteria 15198
228 Ga0265319_1001310 3300028563 Bacteria 15057
229 Ga0265318_10000571 3300028577 Bacteria 25972
230 Ga0265318_10028919 3300028577 Bacteria 2164
231 Ga0265336_10000049 3300028666 Bacteria 120719
232 Ga0265336_10001251 3300028666 Bacteria 12040
233 Ga0265338_10000046 3300028800 Bacteria 223068
234 Ga0265338_10002452 3300028800 Bacteria 27769
235 Ga0265338_10007450 3300028800 Bacteria 13582
236 Ga0265324_10004699 3300029957 Bacteria 6065
237 Ga0265320_10099651 3300031240 Bacteria 1338
238 Ga0265325_10118001 3300031241 Bacteria 1282
239 Ga0265340_10000003 3300031247 Bacteria 320583
240 Ga0265339_10017899 3300031249 Bacteria 4188
241 Ga0265327_10003738 3300031251 Bacteria 14151
242 Ga0265327_10023536 3300031251 Bacteria 3647
243 Ga0265327_10027460 3300031251 Bacteria 3275
244 Ga0265316_10033558 3300031344 Bacteria 4178
245 Ga0265316_10406781 3300031344 Bacteria 979
246 Ga0307408_100257825 3300031548 Bacteria 1442
247 Ga0265314_10201366 3300031711 Bacteria 1177
248 Ga0307413_10160794 3300031824 Bacteria 1578
249 Ga0307413_10390180 3300031824 Bacteria 1088
250 Ga0307410_10331213 3300031852 Bacteria 1211
251 Ga0307406_10098400 3300031901 Bacteria 1986
252 Ga0307409_100285715 3300031995 Bacteria 1527
253 Ga0307416_100662657 3300032002 Unclassified 1129
254 Ga0307415_100211357 3300032126 Bacteria 1548
255 Ga0307415_100273824 3300032126 Bacteria 1384
256 Ga0307415_100283234 3300032126 Bacteria 1364
257 Ga0373953_0052814 3300035117 Bacteria 1646
258 Ga0373943_0110759 3300035170 Bacteria 1448
259 Ga0373943_0320462 3300035170 Bacteria 884
260 Ga0373924_0066876 3300035410 Bacteria 1511
261 Ga0373947_0226117 3300035725 Bacteria 1231
262 Ga0395899_0128678 3300037312 Bacteria 1810
263 Ga0395900_0202239 3300037418 Bacteria 2009
264 Ga0395900_0630508 3300037418 Bacteria 1010
265 Ga0395898_0030279 3300037466 Bacteria 5417
266 Ga0395898_0095576 3300037466 Bacteria 2855
267 Ga0395898_0110043 3300037466 Bacteria 2641
268 Ga0395898_0128049 3300037466 Bacteria 2432
269 Ga0395905_0240427 3300037471 Bacteria 1692
270 Ga0395905_0516650 3300037471 Bacteria 1095
271 Ga0395901_0011241 3300038443 Bacteria 9068
272 Ga0395901_0088071 3300038443 Bacteria 3247
273 Ga0451853_2753551 3300041512 Bacteria 2649
274 Ga0466969_0012858 3300044656 Bacteria 4411
275 Ga0466965_0054349 3300044683 Bacteria 1991
276 Ga0466966_0041956 3300044684 Bacteria 2939
277 Ga0466963_0012479 3300044694 Bacteria 5203
278 Ga0466963_0108474 3300044694 Bacteria 1904
279 Ga0466963_0212363 3300044694 Bacteria 1354
280 Ga0466964_0132105 3300044706 Bacteria 1138
281 Ga0466964_0189726 3300044706 Bacteria 980
282 Ga0466971_0006544 3300044719 Bacteria 5064
283 Ga0466970_0095415 3300044765 Bacteria 1617
284 Ga0466960_0000426 3300044901 Bacteria 14428
285 Ga0466960_0017495 3300044901 Bacteria 3126
286 Ga0466960_0111801 3300044901 Bacteria 1420
287 Ga0466960_0368531 3300044901 Unclassified 822
288 Ga0466959_0020329 3300045049 Bacteria 4891
289 Ga0466959_0021126 3300045049 Bacteria 4799
290 Ga0466958_0103720 3300045836 Bacteria 1771
291 Ga0466958_0110420 3300045836 Bacteria 1716
292 Ga0466958_0214843 3300045836 Bacteria 1226
293 Ga0466967_0011863 3300045976 Bacteria 6630
294 Ga0466967_0018019 3300045976 Bacteria 5630
295 Ga0466967_0100861 3300045976 Bacteria 2638
296 Ga0466967_0217143 3300045976 Bacteria 1815
297 Ga0466967_0217679 3300045976 Bacteria 1813
298 Ga0466967_0233005 3300045976 Bacteria 1754
299 Ga0466967_0459684 3300045976 Bacteria 1245
300 Ga0466967_0469357 3300045976 Bacteria 1232
301 Ga0495629_0061933 3300046459 Bacteria 2615
302 Ga0495653_0094924 3300046463 Bacteria 2172
303 Ga0495650_0000049 3300046471 Bacteria 325092
304 Ga0495584_0079953 3300046491 Bacteria 1645
305 Ga0495608_0006162 3300046511 Bacteria 8515
306 Ga0495618_0085118 3300046514 Bacteria 2020
307 Ga0495628_0261126 3300046516 Bacteria 1291
308 Ga0495652_0032377 3300046529 Bacteria 4573
309 Ga0495587_0199294 3300046536 Bacteria 1132
310 Ga0495667_0006202 3300046559 Bacteria 8099
311 Ga0495634_0048538 3300046642 Bacteria 2858
312 Ga0495635_0065760 3300046663 Bacteria 2487
313 Ga0495657_0074589 3300046675 Bacteria 2207
314 Ga0495599_0022077 3300046678 Bacteria 3973
315 Ga0495623_0022794 3300046679 Bacteria 4043
316 Ga0495646_0048509 3300046680 Bacteria 2579
317 Ga0495604_0044828 3300047317 Bacteria 3453
318 Ga0495674_0028464 3300047319 Bacteria 5094
319 Ga0495680_0016204 3300047322 Bacteria 6408
320 Ga0495684_0048838 3300047471 Bacteria 3235
321 Ga0495602_0009457 3300048088 Bacteria 10136
322 Ga0496100_0035050 3300048903 Bacteria 3154
323 Ga0496100_0260997 3300048903 Bacteria 1285
324 Ga0496100_0298542 3300048903 Bacteria 1205
325 Ga0496100_0591421 3300048903 Bacteria 861
326 Ga0496101_0002690 3300048904 Bacteria 10906
327 Ga0496101_0046073 3300048904 Bacteria 3126
328 Ga0496101_0171541 3300048904 Bacteria 1667
329 Ga0496101_0474113 3300048904 Bacteria 988
330 Ga0496101_0604550 3300048904 Bacteria 867
331 Ga0496102_0014451 3300048905 Bacteria 6860
332 Ga0496102_0024520 3300048905 Bacteria 5364
333 Ga0496102_0058357 3300048905 Bacteria 3526
334 Ga0496103_0018988 3300048906 Bacteria 4127
335 Ga0496103_0158915 3300048906 Bacteria 1449
336 Ga0496104_0002080 3300048907 Bacteria 17353
337 Ga0496104_0003989 3300048907 Bacteria 12780
338 Ga0496104_0077073 3300048907 Bacteria 3176
339 Ga0496105_0008283 3300048908 Bacteria 8082
340 Ga0496105_0145136 3300048908 Bacteria 1952
341 Ga0496105_0695901 3300048908 Bacteria 781
342 Ga0496106_0234677 3300048909 Bacteria 1465
343 Ga0496107_0119334 3300048910 Bacteria 1942
344 Ga0496108_0009653 3300048911 Bacteria 7822
345 Ga0496108_0050475 3300048911 Bacteria 3482
346 Ga0496108_0880707 3300048911 Bacteria 769
347 Ga0496109_0002592 3300048912 Bacteria 15138
348 Ga0496109_0050157 3300048912 Bacteria 3801
349 Ga0496109_0537999 3300048912 Bacteria 1102
350 Ga0496110_0007072 3300048913 Bacteria 8927
351 Ga0496110_0462514 3300048913 Bacteria 1156
352 Ga0496110_0601876 3300048913 Bacteria 997
353 Ga0496111_0030928 3300048914 Bacteria 3810
354 Ga0496111_0061907 3300048914 Bacteria 2713
355 Ga0496111_0302117 3300048914 Bacteria 1186
356 Ga0496112_0000237 3300048915 Bacteria 35381
357 Ga0496112_0015954 3300048915 Bacteria 7022
358 Ga0496112_0018457 3300048915 Bacteria 6568
359 Ga0496117_0002047 3300048920 Bacteria 26701
360 Ga0496118_0000424 3300048921 Bacteria 70137
361 Ga0496118_0159537 3300048921 Bacteria 1397
362 Ga0496119_0036783 3300048922 Bacteria 3189
363 Ga0496120_0005403 3300048923 Bacteria 10201
364 Ga0496121_0002788 3300048924 Bacteria 25903
365 Ga0496121_0077553 3300048924 Bacteria 2645
366 Ga0496121_0088169 3300048924 Bacteria 2433
367 Ga0496121_0197868 3300048924 Bacteria 1435
368 Ga0496123_0186401 3300048926 Unclassified 1078
369 Ga0496124_0059369 3300048927 Bacteria 3214
370 Ga0496124_0084792 3300048927 Bacteria 2597
371 Ga0496125_0079725 3300048928 Bacteria 2510
372 Ga0496125_0222388 3300048928 Bacteria 1215
373 Ga0496126_0029114 3300048929 Bacteria 5250
374 Ga0496126_0076127 3300048929 Bacteria 2977
375 Ga0496126_0194394 3300048929 Bacteria 1716
376 Ga0496126_0194628 3300048929 Bacteria 1715
377 Ga0501031_0000142 3300049568 Bacteria 40303
378 Ga0501031_0034919 3300049568 Bacteria 3281
379 Ga0501031_0104839 3300049568 Bacteria 1845
380 Ga0501032_0000578 3300049569 Bacteria 29631
381 Ga0501033_0000688 3300049570 Bacteria 31333
382 Ga0501034_0012865 3300049571 Bacteria 8630
383 Ga0501034_0029481 3300049571 Bacteria 5577
384 Ga0501034_0426976 3300049571 Bacteria 1246
385 Ga0501034_0481900 3300049571 Bacteria 1156
386 Ga0501036_0000679 3300049572 Bacteria 25041
387 Ga0501036_0063645 3300049572 Bacteria 3122
388 Ga0501036_0174970 3300049572 Bacteria 1807
389 Ga0501036_0234609 3300049572 Bacteria 1539
390 Ga0501037_0000326 3300049573 Bacteria 40338
391 Ga0501038_0001850 3300049574 Bacteria 19540
392 Ga0501039_0020122 3300049575 Bacteria 5117
393 Ga0501039_0203353 3300049575 Bacteria 1557
394 Ga0501040_0020869 3300049576 Bacteria 4367
395 Ga0501040_0088163 3300049576 Bacteria 2155
396 Ga0501040_0239332 3300049576 Bacteria 1293
397 Ga0501040_0299221 3300049576 Bacteria 1150
398 Ga0501040_0605918 3300049576 Bacteria 791
399 Ga0501041_0070246 3300049577 Bacteria 2149
400 Ga0501041_0099449 3300049577 Bacteria 1799
401 Ga0501042_0065658 3300049578 Bacteria 2593
402 Ga0501042_0118094 3300049578 Bacteria 1909
403 Ga0501042_0197395 3300049578 Bacteria 1451
404 Ga0501043_0000379 3300049579 Bacteria 40436
405 Ga0501046_0000468 3300049580 Bacteria 40416
406 Ga0501046_0131769 3300049580 Bacteria 1896
407 Ga0501047_0000551 3300049581 Bacteria 40427
408 Ga0501047_0027048 3300049581 Bacteria 5525
409 Ga0501048_0000177 3300049582 Bacteria 40346
410 Ga0501068_0028488 3300049584 Bacteria 3303
411 Ga0501068_0070961 3300049584 Bacteria 2126
412 Ga0501069_0000896 3300049585 Bacteria 14204
413 Ga0501070_0000225 3300049586 Bacteria 53824
414 Ga0501071_0059202 3300049587 Bacteria 2771
415 Ga0501071_0088582 3300049587 Bacteria 2271
416 Ga0501072_0012611 3300049588 Bacteria 6461
417 Ga0501072_0279338 3300049588 Bacteria 1328
418 Ga0501072_0337290 3300049588 Bacteria 1197
419 Ga0501073_0009192 3300049589 Bacteria 7290
420 Ga0501073_0150376 3300049589 Bacteria 1614
421 Ga0501074_0006267 3300049590 Bacteria 8589
422 Ga0501074_0312129 3300049590 Bacteria 1117
423 Ga0501075_0040819 3300049591 Bacteria 3477
424 Ga0501076_0158638 3300049592 Bacteria 1842
425 Ga0501076_0174984 3300049592 Bacteria 1749
426 Ga0501079_0000687 3300049741 Bacteria 22726
427 Ga0501079_0361029 3300049741 Unclassified 1138
428 Ga0501080_0429834 3300049742 Bacteria 1185
429 Ga0501083_0000451 3300049744 Bacteria 26312
430 Ga0501083_0002630 3300049744 Bacteria 12367
431 Ga0501083_0104100 3300049744 Bacteria 1870
432 Ga0501035_0000578 3300049822 Bacteria 40343
433 Ga0501035_0117597 3300049822 Bacteria 2326
434 Ga0501035_0289588 3300049822 Bacteria 1382
435 Ga0501044_0000533 3300049823 Bacteria 46214
436 Ga0501044_0399518 3300049823 Bacteria 1287
437 Ga0501045_0237675 3300049824 Bacteria 1356
438 Ga0501045_0756908 3300049824 Bacteria 716
439 nmdc:mga0qj67_1955_c1 3300050509 Bacteria 14677
440 nmdc:mga0a205_317939_c1 3300050515 Bacteria 1428
441 Ga0495601_0048987 3300053077 Bacteria 2663
442 Ga0495595_0006394 3300053084 Bacteria 4803
443 Ga0495619_0011811 3300053085 Bacteria 5501
444 Ga0500641_0253375 3300053096 Bacteria 737
445 Ga0500556_0000811 3300053104 Bacteria 18160
446 Ga0500616_0006674 3300053153 Bacteria 7500
447 Ga0501084_0062265 3300054114 Bacteria 3123
448 Ga0501084_0149162 3300054114 Bacteria 1970
449 Ga0501082_0003589 3300060353 Bacteria 13554
450 Ga0501082_0066301 3300060353 Bacteria 3109
451 Ga0501082_0273051 3300060353 Bacteria 1471
452 Ga0466962_0056361 3300061719 Bacteria 1877
453 Ga0530510_0186668 3300061734 Bacteria 1538
454 Ga0530510_0332108 3300061734 Bacteria 1140

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049824 Ga0501045_0756908 Ga0501045_0756908_34_690 199
2 3300053096 Ga0500641_0253375 Ga0500641_0253375_15_665 200
3 3300048912 Ga0496109_0002592 Ga0496109_0002592_5071_5862 203
4 3300048926 Ga0496123_0186401 Ga0496123_0186401_10_672 204
5 3300035170 Ga0373943_0320462 Ga0373943_0320462_195_866 207
6 3300049576 Ga0501040_0605918 Ga0501040_0605918_94_765 207
7 3300048924 Ga0496121_0002788 Ga0496121_0002788_23620_24399 208
8 3300048924 Ga0496121_0077553 Ga0496121_0077553_143_922 211
9 3300048911 Ga0496108_0880707 Ga0496108_0880707_55_741 212
10 3300009148 Ga0105243_10080439 Ga0105243_100804393 216
11 3300044901 Ga0466960_0111801 Ga0466960_0111801_247_1053 218
12 3300005937 Ga0081455_10026307 Ga0081455_100263072 219
13 3300048908 Ga0496105_0695901 Ga0496105_0695901_52_765 221
14 3300005719 Ga0068861_100210955 Ga0068861_1002109552 224
15 3300025961 Ga0207712_10294054 Ga0207712_102940543 224
16 3300026118 Ga0207675_100232204 Ga0207675_1002322042 224
17 3300005436 Ga0070713_100024779 Ga0070713_1000247797 226
18 3300025928 Ga0207700_10024215 Ga0207700_100242155 226
19 3300048903 Ga0496100_0298542 Ga0496100_0298542_15_746 227
20 3300049571 Ga0501034_0481900 Ga0501034_0481900_10_750 228
21 3300006846 Ga0075430_100000833 Ga0075430_10000083319 229
22 3300044656 Ga0466969_0012858 Ga0466969_0012858_749_1543 229
23 3300044684 Ga0466966_0041956 Ga0466966_0041956_1617_2411 229
24 3300045049 Ga0466959_0020329 Ga0466959_0020329_2118_2912 229
25 3300045836 Ga0466958_0214843 Ga0466958_0214843_35_829 229
26 3300050509 nmdc:mga0qj67_1955_c1 nmdc:mga0qj67_1955_c1_2378_3157 229
27 3300005334 Ga0068869_100320399 Ga0068869_1003203992 230
28 3300013306 Ga0163162_10492758 Ga0163162_104927582 230
29 3300025900 Ga0207710_10196571 Ga0207710_101965712 230
30 3300048905 Ga0496102_0014451 Ga0496102_0014451_767_1546 230
31 3300048920 Ga0496117_0002047 Ga0496117_0002047_462_1241 230
32 3300048921 Ga0496118_0000424 Ga0496118_0000424_41138_41917 230
33 3300048923 Ga0496120_0005403 Ga0496120_0005403_2645_3424 230
34 3300048929 Ga0496126_0029114 Ga0496126_0029114_4316_5095 230
35 3300049581 Ga0501047_0027048 Ga0501047_0027048_154_933 230
36 3300049744 Ga0501083_0002630 Ga0501083_0002630_10753_11532 230
37 3300049823 Ga0501044_0399518 Ga0501044_0399518_63_842 230
38 3300049571 Ga0501034_0029481 Ga0501034_0029481_490_1293 231
39 3300028563 Ga0265319_1001310 Ga0265319_100131015 233
40 3300031251 Ga0265327_10023536 Ga0265327_100235363 233
41 3300031711 Ga0265314_10201366 Ga0265314_102013662 233
42 3300048928 Ga0496125_0079725 Ga0496125_0079725_780_1559 234
43 3300044901 Ga0466960_0000426 Ga0466960_0000426_10973_11776 237
44 3300048903 Ga0496100_0035050 Ga0496100_0035050_1319_2092 239
45 3300048904 Ga0496101_0002690 Ga0496101_0002690_3372_4145 239
46 3300048914 Ga0496111_0302117 Ga0496111_0302117_11_784 239
47 3300028800 Ga0265338_10007450 Ga0265338_100074508 240
48 3300044901 Ga0466960_0368531 Ga0466960_0368531_24_800 240
49 3300049592 Ga0501076_0158638 Ga0501076_0158638_588_1367 240
50 3300005548 Ga0070665_100738086 Ga0070665_1007380862 241
51 3300006175 Ga0070712_100000021 Ga0070712_10000002160 241
52 3300025915 Ga0207693_10000001 Ga0207693_10000001211 241
53 3300026142 Ga0207698_10700455 Ga0207698_107004551 241
54 3300028379 Ga0268266_10707741 Ga0268266_107077412 241
55 3300048913 Ga0496110_0462514 Ga0496110_0462514_231_1010 241
56 3300048915 Ga0496112_0000237 Ga0496112_0000237_22312_23091 241
57 3300005344 Ga0070661_100506513 Ga0070661_1005065132 242
58 3300005564 Ga0070664_100148545 Ga0070664_1001485452 242
59 3300005564 Ga0070664_100489856 Ga0070664_1004898562 242
60 3300009098 Ga0105245_10131983 Ga0105245_101319833 242
61 3300009176 Ga0105242_10492301 Ga0105242_104923012 242
62 3300009551 Ga0105238_10273638 Ga0105238_102736382 242
63 3300009553 Ga0105249_10402746 Ga0105249_104027463 242
64 3300011119 Ga0105246_10226338 Ga0105246_102263383 242
65 3300025302 Ga0207426_1007947 Ga0207426_10079475 242
66 3300025908 Ga0207643_10213962 Ga0207643_102139622 242
67 3300025909 Ga0207705_10259908 Ga0207705_102599082 242
68 3300025909 Ga0207705_10338708 Ga0207705_103387082 242
69 3300025926 Ga0207659_10136697 Ga0207659_101366973 242
70 3300025927 Ga0207687_10234246 Ga0207687_102342462 242
71 3300025935 Ga0207709_10350618 Ga0207709_103506181 242
72 3300026142 Ga0207698_10274103 Ga0207698_102741032 242
73 3300031824 Ga0307413_10160794 Ga0307413_101607943 242
74 3300031852 Ga0307410_10331213 Ga0307410_103312132 242
75 3300032126 Ga0307415_100273824 Ga0307415_1002738242 242
76 3300041512 Ga0451853_2753551 Ga0451853_2753551_515_1297 242
77 3300044683 Ga0466965_0054349 Ga0466965_0054349_856_1638 242
78 3300044694 Ga0466963_0108474 Ga0466963_0108474_393_1175 242
79 3300044719 Ga0466971_0006544 Ga0466971_0006544_3104_3886 242
80 3300045836 Ga0466958_0110420 Ga0466958_0110420_564_1346 242
81 3300045976 Ga0466967_0018019 Ga0466967_0018019_4377_5159 242
82 3300048924 Ga0496121_0197868 Ga0496121_0197868_297_1079 242
83 3300049568 Ga0501031_0034919 Ga0501031_0034919_2180_2962 242
84 3300049571 Ga0501034_0426976 Ga0501034_0426976_149_931 242
85 3300049572 Ga0501036_0063645 Ga0501036_0063645_1698_2480 242
86 3300049576 Ga0501040_0088163 Ga0501040_0088163_543_1325 242
87 3300049587 Ga0501071_0088582 Ga0501071_0088582_940_1722 242
88 3300049588 Ga0501072_0012611 Ga0501072_0012611_2609_3391 242
89 3300049591 Ga0501075_0040819 Ga0501075_0040819_1796_2578 242
90 3300061719 Ga0466962_0056361 Ga0466962_0056361_609_1391 242
91 3300001991 JGI24743J22301_10004039 JGI24743J22301_100040394 243
92 3300005327 Ga0070658_10246340 Ga0070658_102463402 243
93 3300005329 Ga0070683_100074598 Ga0070683_1000745982 243
94 3300005329 Ga0070683_100346518 Ga0070683_1003465181 243
95 3300005334 Ga0068869_100038071 Ga0068869_1000380713 243
96 3300005335 Ga0070666_10362507 Ga0070666_103625072 243
97 3300005337 Ga0070682_100056010 Ga0070682_1000560103 243
98 3300005337 Ga0070682_100065706 Ga0070682_1000657063 243
99 3300005338 Ga0068868_100050716 Ga0068868_1000507164 243
100 3300005338 Ga0068868_100082853 Ga0068868_1000828533 243
101 3300005338 Ga0068868_100349385 Ga0068868_1003493851 243
102 3300005339 Ga0070660_100023186 Ga0070660_1000231864 243
103 3300005340 Ga0070689_100018764 Ga0070689_1000187642 243
104 3300005341 Ga0070691_10117503 Ga0070691_101175032 243
105 3300005343 Ga0070687_100030116 Ga0070687_1000301163 243
106 3300005344 Ga0070661_100102786 Ga0070661_1001027862 243
107 3300005347 Ga0070668_100139111 Ga0070668_1001391113 243
108 3300005354 Ga0070675_100178778 Ga0070675_1001787783 243
109 3300005364 Ga0070673_100291304 Ga0070673_1002913043 243
110 3300005365 Ga0070688_100006905 Ga0070688_1000069053 243
111 3300005366 Ga0070659_100000002 Ga0070659_10000000270 243
112 3300005367 Ga0070667_100002431 Ga0070667_10000243116 243
113 3300005367 Ga0070667_100220598 Ga0070667_1002205983 243
114 3300005406 Ga0070703_10110714 Ga0070703_101107142 243
115 3300005435 Ga0070714_100000019 Ga0070714_100000019173 243
116 3300005435 Ga0070714_100058067 Ga0070714_1000580673 243
117 3300005435 Ga0070714_100213810 Ga0070714_1002138102 243
118 3300005435 Ga0070714_100399667 Ga0070714_1003996672 243
119 3300005436 Ga0070713_100213376 Ga0070713_1002133762 243
120 3300005437 Ga0070710_10000007 Ga0070710_10000007165 243
121 3300005437 Ga0070710_10011679 Ga0070710_100116796 243
122 3300005437 Ga0070710_10326528 Ga0070710_103265282 243
123 3300005438 Ga0070701_10128817 Ga0070701_101288172 243
124 3300005439 Ga0070711_100022507 Ga0070711_1000225076 243
125 3300005439 Ga0070711_100129065 Ga0070711_1001290654 243
126 3300005440 Ga0070705_100002330 Ga0070705_1000023302 243
127 3300005441 Ga0070700_100066722 Ga0070700_1000667221 243
128 3300005455 Ga0070663_100072369 Ga0070663_1000723693 243
129 3300005457 Ga0070662_100110949 Ga0070662_1001109492 243
130 3300005459 Ga0068867_100082799 Ga0068867_1000827993 243
131 3300005466 Ga0070685_10117116 Ga0070685_101171163 243
132 3300005539 Ga0068853_100684135 Ga0068853_1006841351 243
133 3300005543 Ga0070672_100043362 Ga0070672_1000433623 243
134 3300005548 Ga0070665_100001875 Ga0070665_10000187515 243
135 3300005548 Ga0070665_100025731 Ga0070665_1000257318 243
136 3300005548 Ga0070665_100139022 Ga0070665_1001390223 243
137 3300005548 Ga0070665_100606386 Ga0070665_1006063862 243
138 3300005549 Ga0070704_100128986 Ga0070704_1001289863 243
139 3300005564 Ga0070664_100435273 Ga0070664_1004352733 243
140 3300005577 Ga0068857_100203168 Ga0068857_1002031682 243
141 3300005578 Ga0068854_100020848 Ga0068854_1000208485 243
142 3300005614 Ga0068856_100398174 Ga0068856_1003981742 243
143 3300005614 Ga0068856_100567789 Ga0068856_1005677892 243
144 3300005615 Ga0070702_100027104 Ga0070702_1000271045 243
145 3300005616 Ga0068852_100107822 Ga0068852_1001078223 243
146 3300005616 Ga0068852_100215774 Ga0068852_1002157743 243
147 3300005617 Ga0068859_100099840 Ga0068859_1000998403 243
148 3300005718 Ga0068866_10033301 Ga0068866_100333012 243
149 3300005719 Ga0068861_100033238 Ga0068861_1000332383 243
150 3300005719 Ga0068861_100039727 Ga0068861_1000397273 243
151 3300005719 Ga0068861_100534842 Ga0068861_1005348422 243
152 3300005842 Ga0068858_100102020 Ga0068858_1001020202 243
153 3300005937 Ga0081455_10321265 Ga0081455_103212652 243
154 3300005983 Ga0081540_1001663 Ga0081540_100166322 243
155 3300005983 Ga0081540_1032658 Ga0081540_10326582 243
156 3300005983 Ga0081540_1035945 Ga0081540_10359453 243
157 3300005985 Ga0081539_10003690 Ga0081539_100036908 243
158 3300005985 Ga0081539_10007612 Ga0081539_100076124 243
159 3300005985 Ga0081539_10018156 Ga0081539_100181564 243
160 3300006028 Ga0070717_10000024 Ga0070717_10000024106 243
161 3300006028 Ga0070717_10061046 Ga0070717_100610462 243
162 3300006175 Ga0070712_100188196 Ga0070712_1001881962 243
163 3300006844 Ga0075428_100611359 Ga0075428_1006113592 243
164 3300006844 Ga0075428_100679820 Ga0075428_1006798202 243
165 3300006871 Ga0075434_100545878 Ga0075434_1005458782 243
166 3300006881 Ga0068865_100137365 Ga0068865_1001373653 243
167 3300006931 Ga0097620_100099840 Ga0097620_1000998403 243
168 3300009036 Ga0105244_10100310 Ga0105244_101003102 243
169 3300009093 Ga0105240_10042190 Ga0105240_100421903 243
170 3300009093 Ga0105240_10241646 Ga0105240_102416463 243
171 3300009098 Ga0105245_10006824 Ga0105245_1000682413 243
172 3300009098 Ga0105245_10084221 Ga0105245_100842213 243
173 3300009098 Ga0105245_10088301 Ga0105245_100883014 243
174 3300009101 Ga0105247_10072462 Ga0105247_100724622 243
175 3300009101 Ga0105247_10110492 Ga0105247_101104923 243
176 3300009148 Ga0105243_10092154 Ga0105243_100921542 243
177 3300009148 Ga0105243_10304705 Ga0105243_103047051 243
178 3300009174 Ga0105241_10338247 Ga0105241_103382472 243
179 3300009176 Ga0105242_10162262 Ga0105242_101622623 243
180 3300009545 Ga0105237_10492748 Ga0105237_104927482 243
181 3300009551 Ga0105238_10100129 Ga0105238_101001292 243
182 3300009551 Ga0105238_10319885 Ga0105238_103198851 243
183 3300009553 Ga0105249_10050371 Ga0105249_100503715 243
184 3300009553 Ga0105249_10340584 Ga0105249_103405842 243
185 3300010375 Ga0105239_10091093 Ga0105239_100910933 243
186 3300010375 Ga0105239_10102484 Ga0105239_101024841 243
187 3300010375 Ga0105239_10955817 Ga0105239_109558172 243
188 3300010375 Ga0105239_11017418 Ga0105239_110174182 243
189 3300011119 Ga0105246_10003723 Ga0105246_1000372310 243
190 3300011119 Ga0105246_10058444 Ga0105246_100584442 243
191 3300013105 Ga0157369_10391806 Ga0157369_103918062 243
192 3300013297 Ga0157378_10117761 Ga0157378_101177614 243
193 3300013308 Ga0157375_10380374 Ga0157375_103803742 243
194 3300014325 Ga0163163_10486471 Ga0163163_104864712 243
195 3300014326 Ga0157380_10050202 Ga0157380_100502023 243
196 3300014969 Ga0157376_10214803 Ga0157376_102148033 243
197 3300014969 Ga0157376_10244157 Ga0157376_102441571 243
198 3300025898 Ga0207692_10000001 Ga0207692_10000001394 243
199 3300025898 Ga0207692_10033546 Ga0207692_100335462 243
200 3300025898 Ga0207692_10125689 Ga0207692_101256892 243
201 3300025899 Ga0207642_10233582 Ga0207642_102335822 243
202 3300025900 Ga0207710_10100783 Ga0207710_101007832 243
203 3300025900 Ga0207710_10182523 Ga0207710_101825232 243
204 3300025901 Ga0207688_10010571 Ga0207688_100105716 243
205 3300025901 Ga0207688_10070741 Ga0207688_100707412 243
206 3300025903 Ga0207680_10399415 Ga0207680_103994152 243
207 3300025904 Ga0207647_10022339 Ga0207647_100223393 243
208 3300025906 Ga0207699_10071102 Ga0207699_100711022 243
209 3300025907 Ga0207645_10034359 Ga0207645_100343594 243
210 3300025908 Ga0207643_10017145 Ga0207643_100171453 243
211 3300025909 Ga0207705_10266465 Ga0207705_102664652 243
212 3300025911 Ga0207654_10244684 Ga0207654_102446842 243
213 3300025913 Ga0207695_10161729 Ga0207695_101617292 243
214 3300025915 Ga0207693_10001833 Ga0207693_1000183316 243
215 3300025916 Ga0207663_10073927 Ga0207663_100739273 243
216 3300025916 Ga0207663_10181306 Ga0207663_101813062 243
217 3300025917 Ga0207660_10182611 Ga0207660_101826112 243
218 3300025918 Ga0207662_10002962 Ga0207662_1000296210 243
219 3300025918 Ga0207662_10049250 Ga0207662_100492502 243
220 3300025919 Ga0207657_10033647 Ga0207657_100336474 243
221 3300025919 Ga0207657_10045503 Ga0207657_100455034 243
222 3300025927 Ga0207687_10056074 Ga0207687_100560743 243
223 3300025927 Ga0207687_10081742 Ga0207687_100817422 243
224 3300025927 Ga0207687_10178803 Ga0207687_101788031 243
225 3300025928 Ga0207700_10200298 Ga0207700_102002983 243
226 3300025929 Ga0207664_10000008 Ga0207664_10000008161 243
227 3300025929 Ga0207664_10004951 Ga0207664_1000495111 243
228 3300025929 Ga0207664_10118803 Ga0207664_101188034 243
229 3300025932 Ga0207690_10000024 Ga0207690_100000247 243
230 3300025933 Ga0207706_10063389 Ga0207706_100633892 243
231 3300025938 Ga0207704_10108336 Ga0207704_101083363 243
232 3300025940 Ga0207691_10051339 Ga0207691_100513393 243
233 3300025942 Ga0207689_10013144 Ga0207689_100131444 243
234 3300025942 Ga0207689_10050438 Ga0207689_100504384 243
235 3300025944 Ga0207661_10195976 Ga0207661_101959762 243
236 3300025944 Ga0207661_10504883 Ga0207661_105048832 243
237 3300025945 Ga0207679_10173002 Ga0207679_101730023 243
238 3300025960 Ga0207651_10217875 Ga0207651_102178752 243
239 3300025961 Ga0207712_10491507 Ga0207712_104915072 243
240 3300025972 Ga0207668_10071651 Ga0207668_100716514 243
241 3300025981 Ga0207640_10105042 Ga0207640_101050423 243
242 3300025981 Ga0207640_10168458 Ga0207640_101684583 243
243 3300026023 Ga0207677_10120542 Ga0207677_101205424 243
244 3300026041 Ga0207639_10038928 Ga0207639_100389283 243
245 3300026067 Ga0207678_10075553 Ga0207678_100755533 243
246 3300026067 Ga0207678_10169512 Ga0207678_101695122 243
247 3300026075 Ga0207708_10023060 Ga0207708_100230603 243
248 3300026075 Ga0207708_10138666 Ga0207708_101386663 243
249 3300026078 Ga0207702_10166857 Ga0207702_101668574 243
250 3300026078 Ga0207702_10695564 Ga0207702_106955642 243
251 3300026089 Ga0207648_10022753 Ga0207648_100227536 243
252 3300026089 Ga0207648_10064883 Ga0207648_100648833 243
253 3300026095 Ga0207676_10033139 Ga0207676_100331392 243
254 3300026095 Ga0207676_10046517 Ga0207676_100465173 243
255 3300026116 Ga0207674_10064591 Ga0207674_100645916 243
256 3300026116 Ga0207674_10072685 Ga0207674_100726854 243
257 3300026118 Ga0207675_100059210 Ga0207675_1000592101 243
258 3300026118 Ga0207675_100514911 Ga0207675_1005149113 243
259 3300028379 Ga0268266_10000369 Ga0268266_1000036912 243
260 3300028379 Ga0268266_10010641 Ga0268266_100106414 243
261 3300028379 Ga0268266_10061020 Ga0268266_100610203 243
262 3300028558 Ga0265326_10000004 Ga0265326_1000000481 243
263 3300028563 Ga0265319_1001287 Ga0265319_100128714 243
264 3300028577 Ga0265318_10000571 Ga0265318_1000057114 243
265 3300028577 Ga0265318_10028919 Ga0265318_100289194 243
266 3300028666 Ga0265336_10000049 Ga0265336_1000004955 243
267 3300028666 Ga0265336_10001251 Ga0265336_100012513 243
268 3300028800 Ga0265338_10000046 Ga0265338_10000046150 243
269 3300028800 Ga0265338_10002452 Ga0265338_1000245236 243
270 3300029957 Ga0265324_10004699 Ga0265324_100046996 243
271 3300031240 Ga0265320_10099651 Ga0265320_100996512 243
272 3300031241 Ga0265325_10118001 Ga0265325_101180012 243
273 3300031247 Ga0265340_10000003 Ga0265340_1000000355 243
274 3300031249 Ga0265339_10017899 Ga0265339_100178993 243
275 3300031251 Ga0265327_10003738 Ga0265327_1000373820 243
276 3300031251 Ga0265327_10027460 Ga0265327_100274602 243
277 3300031344 Ga0265316_10033558 Ga0265316_100335583 243
278 3300031344 Ga0265316_10406781 Ga0265316_104067812 243
279 3300031548 Ga0307408_100257825 Ga0307408_1002578252 243
280 3300031995 Ga0307409_100285715 Ga0307409_1002857153 243
281 3300032002 Ga0307416_100662657 Ga0307416_1006626572 243
282 3300032126 Ga0307415_100283234 Ga0307415_1002832343 243
283 3300035117 Ga0373953_0052814 Ga0373953_0052814_130_927 243
284 3300035410 Ga0373924_0066876 Ga0373924_0066876_301_1098 243
285 3300037466 Ga0395898_0110043 Ga0395898_0110043_1230_2033 243
286 3300037466 Ga0395898_0128049 Ga0395898_0128049_490_1293 243
287 3300037471 Ga0395905_0516650 Ga0395905_0516650_90_893 243
288 3300044694 Ga0466963_0012479 Ga0466963_0012479_3996_4781 243
289 3300044694 Ga0466963_0212363 Ga0466963_0212363_402_1187 243
290 3300044706 Ga0466964_0132105 Ga0466964_0132105_251_1039 243
291 3300044706 Ga0466964_0189726 Ga0466964_0189726_53_832 243
292 3300044765 Ga0466970_0095415 Ga0466970_0095415_644_1429 243
293 3300044901 Ga0466960_0017495 Ga0466960_0017495_728_1531 243
294 3300045049 Ga0466959_0021126 Ga0466959_0021126_400_1200 243
295 3300045836 Ga0466958_0103720 Ga0466958_0103720_328_1125 243
296 3300045976 Ga0466967_0011863 Ga0466967_0011863_400_1191 243
297 3300045976 Ga0466967_0100861 Ga0466967_0100861_1461_2255 243
298 3300045976 Ga0466967_0217143 Ga0466967_0217143_711_1496 243
299 3300045976 Ga0466967_0217679 Ga0466967_0217679_311_1096 243
300 3300045976 Ga0466967_0233005 Ga0466967_0233005_253_1044 243
301 3300045976 Ga0466967_0459684 Ga0466967_0459684_233_1036 243
302 3300045976 Ga0466967_0469357 Ga0466967_0469357_250_1035 243
303 3300046459 Ga0495629_0061933 Ga0495629_0061933_687_1484 243
304 3300046463 Ga0495653_0094924 Ga0495653_0094924_1214_2011 243
305 3300046471 Ga0495650_0000049 Ga0495650_0000049_166210_167013 243
306 3300046491 Ga0495584_0079953 Ga0495584_0079953_68_853 243
307 3300046511 Ga0495608_0006162 Ga0495608_0006162_1549_2346 243
308 3300046514 Ga0495618_0085118 Ga0495618_0085118_355_1152 243
309 3300046516 Ga0495628_0261126 Ga0495628_0261126_86_883 243
310 3300046529 Ga0495652_0032377 Ga0495652_0032377_756_1553 243
311 3300046536 Ga0495587_0199294 Ga0495587_0199294_55_852 243
312 3300046559 Ga0495667_0006202 Ga0495667_0006202_1197_1994 243
313 3300046642 Ga0495634_0048538 Ga0495634_0048538_1394_2191 243
314 3300046663 Ga0495635_0065760 Ga0495635_0065760_1101_1898 243
315 3300046675 Ga0495657_0074589 Ga0495657_0074589_244_1041 243
316 3300046678 Ga0495599_0022077 Ga0495599_0022077_401_1198 243
317 3300046679 Ga0495623_0022794 Ga0495623_0022794_424_1221 243
318 3300046680 Ga0495646_0048509 Ga0495646_0048509_434_1231 243
319 3300047317 Ga0495604_0044828 Ga0495604_0044828_1729_2526 243
320 3300047319 Ga0495674_0028464 Ga0495674_0028464_525_1322 243
321 3300047322 Ga0495680_0016204 Ga0495680_0016204_3882_4679 243
322 3300047471 Ga0495684_0048838 Ga0495684_0048838_1210_2007 243
323 3300048088 Ga0495602_0009457 Ga0495602_0009457_422_1219 243
324 3300048903 Ga0496100_0260997 Ga0496100_0260997_185_979 243
325 3300048903 Ga0496100_0591421 Ga0496100_0591421_61_840 243
326 3300048904 Ga0496101_0046073 Ga0496101_0046073_2159_2944 243
327 3300048904 Ga0496101_0171541 Ga0496101_0171541_521_1306 243
328 3300048904 Ga0496101_0474113 Ga0496101_0474113_40_843 243
329 3300048904 Ga0496101_0604550 Ga0496101_0604550_22_816 243
330 3300048905 Ga0496102_0024520 Ga0496102_0024520_2726_3511 243
331 3300048905 Ga0496102_0058357 Ga0496102_0058357_2123_2917 243
332 3300048906 Ga0496103_0018988 Ga0496103_0018988_267_1052 243
333 3300048906 Ga0496103_0158915 Ga0496103_0158915_228_1013 243
334 3300048907 Ga0496104_0002080 Ga0496104_0002080_4318_5103 243
335 3300048907 Ga0496104_0003989 Ga0496104_0003989_8361_9140 243
336 3300048907 Ga0496104_0077073 Ga0496104_0077073_1006_1803 243
337 3300048908 Ga0496105_0008283 Ga0496105_0008283_5196_5981 243
338 3300048908 Ga0496105_0145136 Ga0496105_0145136_760_1539 243
339 3300048909 Ga0496106_0234677 Ga0496106_0234677_272_1057 243
340 3300048910 Ga0496107_0119334 Ga0496107_0119334_377_1162 243
341 3300048911 Ga0496108_0009653 Ga0496108_0009653_6054_6839 243
342 3300048911 Ga0496108_0050475 Ga0496108_0050475_987_1772 243
343 3300048912 Ga0496109_0050157 Ga0496109_0050157_850_1635 243
344 3300048912 Ga0496109_0537999 Ga0496109_0537999_289_1083 243
345 3300048913 Ga0496110_0007072 Ga0496110_0007072_170_955 243
346 3300048913 Ga0496110_0601876 Ga0496110_0601876_58_849 243
347 3300048914 Ga0496111_0030928 Ga0496111_0030928_1377_2162 243
348 3300048914 Ga0496111_0061907 Ga0496111_0061907_966_1751 243
349 3300048915 Ga0496112_0015954 Ga0496112_0015954_3275_4072 243
350 3300048915 Ga0496112_0018457 Ga0496112_0018457_2314_3117 243
351 3300048921 Ga0496118_0159537 Ga0496118_0159537_45_824 243
352 3300048922 Ga0496119_0036783 Ga0496119_0036783_150_929 243
353 3300048924 Ga0496121_0088169 Ga0496121_0088169_1236_2015 243
354 3300048927 Ga0496124_0059369 Ga0496124_0059369_1890_2690 243
355 3300048927 Ga0496124_0084792 Ga0496124_0084792_982_1761 243
356 3300048928 Ga0496125_0222388 Ga0496125_0222388_294_1073 243
357 3300048929 Ga0496126_0076127 Ga0496126_0076127_1870_2649 243
358 3300048929 Ga0496126_0194394 Ga0496126_0194394_379_1158 243
359 3300048929 Ga0496126_0194628 Ga0496126_0194628_439_1218 243
360 3300049568 Ga0501031_0000142 Ga0501031_0000142_23828_24607 243
361 3300049569 Ga0501032_0000578 Ga0501032_0000578_15710_16489 243
362 3300049570 Ga0501033_0000688 Ga0501033_0000688_6711_7490 243
363 3300049571 Ga0501034_0012865 Ga0501034_0012865_3224_4003 243
364 3300049572 Ga0501036_0000679 Ga0501036_0000679_23801_24580 243
365 3300049573 Ga0501037_0000326 Ga0501037_0000326_23811_24590 243
366 3300049574 Ga0501038_0001850 Ga0501038_0001850_16011_16790 243
367 3300049575 Ga0501039_0020122 Ga0501039_0020122_674_1453 243
368 3300049578 Ga0501042_0065658 Ga0501042_0065658_421_1200 243
369 3300049579 Ga0501043_0000379 Ga0501043_0000379_15723_16502 243
370 3300049580 Ga0501046_0000468 Ga0501046_0000468_15695_16474 243
371 3300049581 Ga0501047_0000551 Ga0501047_0000551_15794_16573 243
372 3300049582 Ga0501048_0000177 Ga0501048_0000177_23851_24630 243
373 3300049584 Ga0501068_0028488 Ga0501068_0028488_2327_3106 243
374 3300049585 Ga0501069_0000896 Ga0501069_0000896_9762_10541 243
375 3300049586 Ga0501070_0000225 Ga0501070_0000225_37301_38080 243
376 3300049588 Ga0501072_0279338 Ga0501072_0279338_181_960 243
377 3300049589 Ga0501073_0009192 Ga0501073_0009192_6298_7077 243
378 3300049590 Ga0501074_0006267 Ga0501074_0006267_6827_7606 243
379 3300049741 Ga0501079_0000687 Ga0501079_0000687_15683_16462 243
380 3300049742 Ga0501080_0429834 Ga0501080_0429834_348_1127 243
381 3300049744 Ga0501083_0000451 Ga0501083_0000451_14242_15021 243
382 3300049822 Ga0501035_0000578 Ga0501035_0000578_23855_24634 243
383 3300049823 Ga0501044_0000533 Ga0501044_0000533_15724_16503 243
384 3300049824 Ga0501045_0237675 Ga0501045_0237675_446_1225 243
385 3300050515 nmdc:mga0a205_317939_c1 nmdc:mga0a205_317939_c1_492_1277 243
386 3300053077 Ga0495601_0048987 Ga0495601_0048987_256_1053 243
387 3300053084 Ga0495595_0006394 Ga0495595_0006394_283_1080 243
388 3300053085 Ga0495619_0011811 Ga0495619_0011811_1256_2053 243
389 3300053104 Ga0500556_0000811 Ga0500556_0000811_13269_14066 243
390 3300053153 Ga0500616_0006674 Ga0500616_0006674_4093_4890 243
391 3300054114 Ga0501084_0062265 Ga0501084_0062265_331_1110 243
392 3300060353 Ga0501082_0003589 Ga0501082_0003589_6749_7528 243
393 3300001979 JGI24740J21852_10005493 JGI24740J21852_100054934 244
394 3300003373 JGI25407J50210_10016653 JGI25407J50210_100166531 244
395 3300005327 Ga0070658_10376320 Ga0070658_103763203 244
396 3300005339 Ga0070660_100279119 Ga0070660_1002791193 244
397 3300005344 Ga0070661_100184467 Ga0070661_1001844672 244
398 3300005356 Ga0070674_100062356 Ga0070674_1000623561 244
399 3300005366 Ga0070659_100242630 Ga0070659_1002426301 244
400 3300005455 Ga0070663_100013344 Ga0070663_1000133443 244
401 3300005458 Ga0070681_10120990 Ga0070681_101209901 244
402 3300005459 Ga0068867_100153147 Ga0068867_1001531472 244
403 3300005530 Ga0070679_100004738 Ga0070679_1000047383 244
404 3300005564 Ga0070664_100389371 Ga0070664_1003893712 244
405 3300005981 Ga0081538_10000665 Ga0081538_1000066534 244
406 3300005981 Ga0081538_10010972 Ga0081538_100109724 244
407 3300025921 Ga0207652_10000947 Ga0207652_1000094723 244
408 3300025933 Ga0207706_10263606 Ga0207706_102636062 244
409 3300025933 Ga0207706_10373635 Ga0207706_103736352 244
410 3300025945 Ga0207679_10297908 Ga0207679_102979082 244
411 3300025972 Ga0207668_10334630 Ga0207668_103346301 244
412 3300026067 Ga0207678_10019644 Ga0207678_100196442 244
413 3300026121 Ga0207683_10061166 Ga0207683_100611663 244
414 3300028379 Ga0268266_10520246 Ga0268266_105202462 244
415 3300031824 Ga0307413_10390180 Ga0307413_103901801 244
416 3300031901 Ga0307406_10098400 Ga0307406_100984003 244
417 3300032126 Ga0307415_100211357 Ga0307415_1002113573 244
418 3300035170 Ga0373943_0110759 Ga0373943_0110759_613_1401 244
419 3300035725 Ga0373947_0226117 Ga0373947_0226117_246_1034 244
420 3300037312 Ga0395899_0128678 Ga0395899_0128678_352_1134 244
421 3300037418 Ga0395900_0202239 Ga0395900_0202239_1145_1927 244
422 3300037418 Ga0395900_0630508 Ga0395900_0630508_97_900 244
423 3300037466 Ga0395898_0030279 Ga0395898_0030279_310_1092 244
424 3300037466 Ga0395898_0095576 Ga0395898_0095576_1764_2546 244
425 3300037471 Ga0395905_0240427 Ga0395905_0240427_311_1093 244
426 3300038443 Ga0395901_0011241 Ga0395901_0011241_2500_3282 244
427 3300038443 Ga0395901_0088071 Ga0395901_0088071_1720_2502 244
428 3300049568 Ga0501031_0104839 Ga0501031_0104839_272_1066 244
429 3300049572 Ga0501036_0174970 Ga0501036_0174970_480_1274 244
430 3300049572 Ga0501036_0234609 Ga0501036_0234609_700_1494 244
431 3300049575 Ga0501039_0203353 Ga0501039_0203353_449_1243 244
432 3300049576 Ga0501040_0020869 Ga0501040_0020869_1139_1933 244
433 3300049576 Ga0501040_0239332 Ga0501040_0239332_334_1128 244
434 3300049576 Ga0501040_0299221 Ga0501040_0299221_304_1098 244
435 3300049577 Ga0501041_0070246 Ga0501041_0070246_492_1286 244
436 3300049577 Ga0501041_0099449 Ga0501041_0099449_62_856 244
437 3300049578 Ga0501042_0118094 Ga0501042_0118094_469_1263 244
438 3300049578 Ga0501042_0197395 Ga0501042_0197395_282_1076 244
439 3300049580 Ga0501046_0131769 Ga0501046_0131769_295_1089 244
440 3300049584 Ga0501068_0070961 Ga0501068_0070961_493_1287 244
441 3300049587 Ga0501071_0059202 Ga0501071_0059202_455_1249 244
442 3300049588 Ga0501072_0337290 Ga0501072_0337290_333_1127 244
443 3300049589 Ga0501073_0150376 Ga0501073_0150376_422_1216 244
444 3300049590 Ga0501074_0312129 Ga0501074_0312129_258_1052 244
445 3300049592 Ga0501076_0174984 Ga0501076_0174984_50_844 244
446 3300049741 Ga0501079_0361029 Ga0501079_0361029_37_831 244
447 3300049744 Ga0501083_0104100 Ga0501083_0104100_702_1496 244
448 3300049822 Ga0501035_0117597 Ga0501035_0117597_220_1014 244
449 3300049822 Ga0501035_0289588 Ga0501035_0289588_517_1311 244
450 3300054114 Ga0501084_0149162 Ga0501084_0149162_217_1011 244
451 3300060353 Ga0501082_0066301 Ga0501082_0066301_276_1070 244
452 3300060353 Ga0501082_0273051 Ga0501082_0273051_542_1336 244
453 3300061734 Ga0530510_0186668 Ga0530510_0186668_408_1202 244
454 3300061734 Ga0530510_0332108 Ga0530510_0332108_334_1128 244

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01311

Bac_export_1

Bacterial export proteins, family 1

15

255

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7e80-assembly1.cif.gz_CE cryo-em structure of the flagellar rod with hook and export apparatus from salmonella 0.7376 11 240
6r6b-assembly1.cif.gz_F structure of the core shigella flexneri type iii secretion system export gate complex sctrst (spa24/spa9/spa29). 0.719 13 239
7bin-assembly1.cif.gz_F salmonella export gate and rod refined in focussed c1 map 0.7128 2 240
7ahi-assembly1.cif.gz_1F substrate-engaged type 3 secretion system needle complex from salmonella enterica typhimurium - spar state 2 0.7007 11 219
7e80-assembly1.cif.gz_CE cryo-em structure of the flagellar rod with hook and export apparatus from salmonella 0.6996 11 240
ID Description Score Start End Superfamily
4m70H00 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.3766 12 140 1.20.5.4130
4m70H00 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.3608 12 140 1.20.5.4130
af_I1KQQ7_1_146_1.20.930.20 Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Adaptor protein Cbl, N-terminal domain 0.3276 6 140 1.20.930.20
af_Q9W3W4_54_201_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.3259 11 151 1.20.1260.10
af_M1FN39_66_236_1.20.120.220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A 0.3206 81 240 1.20.120.220
ID Description Score Start End GO Terms
AF-A0A538K290-F1-model_v4 Flagellar biosynthetic protein FliR 0.8616 70 241 GO:0005886
GO:0006605
AF-A0A7M2Z0Y3-F1-model_v4 Flagellar biosynthetic protein FliR 0.8467 11 240 GO:0005886
GO:0006605
GO:0009425
GO:0044780
AF-A0A524QQ24-F1-model_v4 Type III secretion protein 0.8407 71 241 GO:0005886
GO:0006605
AF-D5WPG5-F1-model_v4 Flagellar biosynthetic protein FliR 0.8338 11 243 GO:0005886
GO:0006605
AF-A0A0W8J9X5-F1-model_v4 Flagellar biosynthetic protein FliR 0.8337 11 236 GO:0005886
GO:0006605

Feature Viewer

pLDDT pTM Quality
76.87 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map