F447311

General Info

Members Datasets Scaffolds Average Seq Length
454 289 909 143

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10033419|rootH1_100334194
Length 160
Sequence VKHSKRSVEHTTTRTRRGGRGPARRIGRSLAFVLPVVMVLSGTLAVTRVNWTGNPSDSVLTASDVSAPRTGHGAARAPQDVLRDQLLTELQQKDPGIALTHLQQEVNGKPTLAKHCASIARALGRAAVRVYGPSRAQSFSRPVCDTSFASGVLAAHAHTG

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
17 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
18 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
19 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
20 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
21 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
22 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
25 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
26 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
29 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
33 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
34 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
35 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
36 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
42 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
43 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
45 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
46 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
47 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
48 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
49 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
50 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
51 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
52 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
53 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
54 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
55 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
56 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
57 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
58 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
59 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
60 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
61 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
62 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
63 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
64 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
65 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
66 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
67 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
68 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
69 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
70 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
71 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
72 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
73 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
74 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
75 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
76 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
77 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
78 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
79 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
80 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
81 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
82 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
83 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
84 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
85 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
86 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
87 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
88 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
89 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
90 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
91 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
92 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
93 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
94 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
95 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
99 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
100 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
101 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
102 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
103 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
104 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
105 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
106 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
107 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
108 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
109 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
110 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
111 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
112 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
113 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
114 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
115 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
116 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
117 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
118 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
119 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
120 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
121 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
122 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
123 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
124 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
125 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
126 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
127 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
128 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
129 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
130 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
131 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
132 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
133 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
134 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
135 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
136 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
137 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
140 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
154 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
155 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
156 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
157 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
158 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
159 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
160 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
161 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
162 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
163 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
164 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
165 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
166 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
170 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
171 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
172 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
173 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
174 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
175 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
176 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
177 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
178 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
179 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
180 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
181 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
182 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
183 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
184 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
185 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
186 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
187 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
188 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
189 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
190 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
191 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
192 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
193 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
194 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
195 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
196 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
197 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
198 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
199 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
200 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
201 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
202 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
203 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
204 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
205 2643221578 Streptomyces sp. Root63 Isolate Unclassified
206 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
207 2643221647 Streptomyces sp. Root369 Isolate Unclassified
208 2643221670 Streptomyces sp. Root431 Isolate Unclassified
209 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
210 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
211 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
212 2643221714 Streptomyces sp. Root264 Isolate Unclassified
213 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
214 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
215 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
216 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
217 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
218 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
219 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
220 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
221 2808606448 Streptomyces sp. 193411 Isolate Unclassified
222 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
223 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
224 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
225 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
226 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
227 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
228 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
229 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
230 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
231 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
232 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
233 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
234 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
235 2867369537 Streptomyces sp. Z26 Isolate Unclassified
236 2867428634 Streptomyces sp. RP5T Isolate Unclassified
237 2867475112 Streptomyces sp. TM32 Isolate Unclassified
238 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
239 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
240 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
241 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
242 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
243 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
244 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
245 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
246 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
247 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
248 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
249 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
250 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
251 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
252 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
253 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
254 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
255 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
256 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
257 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
258 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
259 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
260 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
261 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
262 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
263 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
264 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
265 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
266 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
267 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
268 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
269 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
270 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
271 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
272 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
273 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
274 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
275 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
276 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
277 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
278 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
279 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
280 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
281 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
282 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
283 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
284 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
285 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
286 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
287 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
288 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
289 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.74
Metatranscriptomes 0
Isolates 20.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.37
Nodule 0.44
Rhizoplane 1.1
Rhizosphere 72.03
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10033419 3300003323 Bacteria 4379
2 JGI24735J21928_10138243 3300002067 Bacteria 703
3 JGI24738J21930_10125552 3300002075 Bacteria 559
4 rootH1_10007984 3300003316 Bacteria 2918
5 rootH1_10025629 3300003316 Bacteria 1934
6 rootH2_10019907 3300003320 Bacteria 7002
7 rootL2_10063370 3300003322 Bacteria 2029
8 rootH1_10000847 3300003316 Bacteria 5739
9 rootH1_10000847 3300003323 Bacteria 5674
10 rootH1_10145542 3300003323 Bacteria 1240
11 JGI25160J50197_1027411 3300003354 Bacteria 1551
12 Ga0058692_1026979 3300003856 Bacteria 1123
13 Ga0070675_101245791 3300005354 Bacteria 685
14 Ga0070700_101510600 3300005441 Bacteria 571
15 Ga0070678_101386260 3300005456 Bacteria 656
16 Ga0068853_100029147 3300005539 Bacteria 4651
17 Ga0070665_100065129 3300005548 Bacteria 3656
18 Ga0070665_100595278 3300005548 Bacteria 1119
19 Ga0068855_100268677 3300005563 Bacteria 1897
20 Ga0081455_10168513 3300005937 Bacteria 1671
21 Ga0075365_10205652 3300006038 Bacteria 1380
22 Ga0075368_10007733 3300006042 Bacteria 3804
23 Ga0075363_100011735 3300006048 Bacteria 4204
24 Ga0070715_10086121 3300006163 Bacteria 1436
25 Ga0075370_10069500 3300006353 Bacteria 2013
26 Ga0105244_10085270 3300009036 Bacteria 1559
27 Ga0105244_10251142 3300009036 Bacteria 824
28 Ga0105244_10468247 3300009036 Bacteria 580
29 Ga0105250_10108570 3300009092 Bacteria 1135
30 Ga0105245_10113266 3300009098 Bacteria 2525
31 Ga0105245_10631312 3300009098 Bacteria 1100
32 Ga0105243_10090347 3300009148 Bacteria 2520
33 Ga0105243_10261278 3300009148 Bacteria 1550
34 Ga0105242_11167209 3300009176 Bacteria 788
35 Ga0105248_11882154 3300009177 Bacteria 679
36 Ga0105238_10175754 3300009551 Bacteria 2118
37 Ga0105246_10377385 3300011119 Bacteria 1170
38 Ga0105246_10758260 3300011119 Bacteria 857
39 Ga0157371_10878260 3300013102 Bacteria 679
40 Ga0157369_10053224 3300013105 Bacteria 4376
41 Ga0157372_10178111 3300013307 Bacteria 2461
42 Ga0157376_10701215 3300014969 Bacteria 1017
43 Ga0183367_1005 3300015688 Bacteria 652063
44 Ga0209758_1004925 3300025297 Bacteria 10733
45 Ga0207426_1001851 3300025302 Bacteria 15532
46 Ga0207426_1019949 3300025302 Bacteria 2337
47 Ga0207426_1088055 3300025302 Bacteria 827
48 Ga0207426_1105212 3300025302 Bacteria 721
49 Ga0207646_11033728 3300025922 Bacteria 725
50 Ga0207687_10579575 3300025927 Bacteria 944
51 Ga0207709_10379264 3300025935 Bacteria 1076
52 Ga0207667_11208235 3300025949 Bacteria 735
53 Ga0207683_11105670 3300026121 Bacteria 735
54 Ga0209371_1017108 3300027312 Bacteria 1889
55 Ga0209813_10014313 3300027866 Bacteria 2134
56 Ga0268266_10047957 3300028379 Bacteria 3661
57 Ga0268266_10344096 3300028379 Bacteria 1400
58 Ga0307517_10029007 3300028786 Bacteria 6559
59 Ga0307517_10031996 3300028786 Bacteria 6100
60 Ga0307515_10003702 3300028794 Bacteria 32085
61 Ga0307515_10046083 3300028794 Bacteria 6677
62 Ga0307515_10227374 3300028794 Bacteria 1667
63 Ga0268256_1011694 3300030500 Bacteria 2759
64 Ga0307511_10001286 3300030521 Bacteria 26612
65 Ga0307511_10034993 3300030521 Bacteria 4395
66 Ga0307511_10088233 3300030521 Bacteria 2123
67 Ga0307512_10001726 3300030522 Bacteria 29809
68 Ga0307512_10198508 3300030522 Bacteria 1091
69 Ga0307512_10288126 3300030522 Bacteria 777
70 Ga0307513_10020586 3300031456 Bacteria 7820
71 Ga0307513_10065301 3300031456 Bacteria 3829
72 Ga0307513_10091881 3300031456 Bacteria 3091
73 Ga0307509_10003362 3300031507 Bacteria 24382
74 Ga0307509_10141936 3300031507 Bacteria 2335
75 Ga0307508_10009614 3300031616 Bacteria 8885
76 Ga0307508_10013071 3300031616 Bacteria 7591
77 Ga0307508_10048029 3300031616 Bacteria 3803
78 Ga0307508_10152786 3300031616 Bacteria 1912
79 Ga0307514_10007082 3300031649 Bacteria 9683
80 Ga0307514_10114405 3300031649 Bacteria 1902
81 Ga0307514_10211188 3300031649 Bacteria 1205
82 Ga0307514_10366260 3300031649 Bacteria 758
83 Ga0307516_10008705 3300031730 Bacteria 11412
84 Ga0307516_10021397 3300031730 Bacteria 6655
85 Ga0307516_10361358 3300031730 Bacteria 1116
86 Ga0307413_10781580 3300031824 Bacteria 801
87 Ga0307518_10042674 3300031838 Bacteria 3301
88 Ga0307518_10166030 3300031838 Bacteria 1510
89 Ga0307410_10359889 3300031852 Bacteria 1165
90 Ga0307416_101489874 3300032002 Bacteria 782
91 Ga0307416_102387044 3300032002 Bacteria 628
92 Ga0307415_101024294 3300032126 Bacteria 769
93 Ga0307507_10047557 3300033179 Bacteria 4187
94 Ga0307510_10087205 3300033180 Bacteria 2989
95 Ga0307510_10139922 3300033180 Bacteria 2066
96 Ga0307510_10203899 3300033180 Bacteria 1508
97 Ga0395899_0695620 3300037312 Bacteria 638
98 Ga0395900_0200899 3300037418 Bacteria 2017
99 Ga0395900_0337938 3300037418 Bacteria 1482
100 Ga0395898_0006338 3300037466 Bacteria 12645
101 Ga0395898_0014755 3300037466 Bacteria 8021
102 Ga0395898_0077754 3300037466 Bacteria 3203
103 Ga0395905_0169941 3300037471 Bacteria 2048
104 Ga0395901_0209754 3300038443 Bacteria 2039
105 Ga0395901_0889663 3300038443 Bacteria 873
106 Ga0439436_0000221 3300041404 Bacteria 13685
107 Ga0439436_0007067 3300041404 Bacteria 3454
108 Ga0439436_0054241 3300041404 Bacteria 1128
109 Ga0439439_0016037 3300041406 Bacteria 1832
110 Ga0451837_1576509 3300041494 Bacteria 1472
111 Ga0451849_1466464 3300041505 Bacteria 1578
112 Ga0451853_0616464 3300041512 Bacteria 1378
113 Ga0451853_1286081 3300041512 Bacteria 1515
114 Ga0451853_2221147 3300041512 Bacteria 2570
115 Ga0439433_0000914 3300041999 Bacteria 5888
116 Ga0439433_0009462 3300041999 Bacteria 2123
117 Ga0439448_0088276 3300042005 Bacteria 1046
118 Ga0439432_033909 3300042006 Bacteria 1641
119 Ga0439449_0036507 3300042007 Bacteria 1828
120 Ga0439449_0055996 3300042007 Bacteria 1456
121 Ga0439457_001048 3300042014 Bacteria 8357
122 Ga0439457_001710 3300042014 Bacteria 6506
123 Ga0439462_0007094 3300042015 Bacteria 2801
124 Ga0439462_0024263 3300042015 Bacteria 1592
125 Ga0450897_007343 3300042128 Bacteria 1004
126 Ga0450894_009675 3300042131 Bacteria 1249
127 Ga0450895_004539 3300042132 Bacteria 1097
128 Ga0450896_000554 3300042133 Bacteria 3976
129 Ga0450898_003442 3300042134 Bacteria 2276
130 Ga0450899_000806 3300042135 Bacteria 3576
131 Ga0450906_002191 3300042145 Bacteria 4267
132 Ga0450908_004983 3300042184 Bacteria 2550
133 Ga0450918_099804 3300042531 Bacteria 567
134 Ga0466969_0149707 3300044656 Bacteria 1075
135 Ga0466972_0017222 3300044658 Bacteria 3615
136 Ga0466972_0023180 3300044658 Bacteria 3088
137 Ga0466972_0134032 3300044658 Bacteria 1166
138 Ga0466965_0001233 3300044683 Bacteria 10123
139 Ga0466966_0002684 3300044684 Bacteria 11653
140 Ga0466961_0000772 3300044693 Bacteria 20081
141 Ga0466961_0671033 3300044693 Bacteria 622
142 Ga0466964_0001683 3300044706 Bacteria 7639
143 Ga0466971_0000130 3300044719 Bacteria 27549
144 Ga0466970_0000179 3300044765 Bacteria 30305
145 Ga0466970_0070999 3300044765 Bacteria 1872
146 Ga0466970_0276231 3300044765 Bacteria 944
147 Ga0466957_0002644 3300044842 Bacteria 9673
148 Ga0466959_0001093 3300045049 Bacteria 16250
149 Ga0466958_0000745 3300045836 Bacteria 14269
150 Ga0466967_0003603 3300045976 Bacteria 10166
151 Ga0466967_0049907 3300045976 Bacteria 3662
152 Ga0495627_024667 3300046453 Bacteria 1958
153 Ga0495627_050637 3300046453 Bacteria 1251
154 Ga0495603_0001554 3300046455 Bacteria 13423
155 Ga0495603_0001594 3300046455 Bacteria 13301
156 Ga0495603_0036674 3300046455 Bacteria 2943
157 Ga0495603_0054394 3300046455 Bacteria 2373
158 Ga0495603_0553352 3300046455 Bacteria 659
159 Ga0495629_0004390 3300046459 Bacteria 10566
160 Ga0495629_0017146 3300046459 Bacteria 5195
161 Ga0495629_0023884 3300046459 Bacteria 4354
162 Ga0495582_0192916 3300046473 Bacteria 1163
163 Ga0495585_0034360 3300046492 Bacteria 2866
164 Ga0495585_0126473 3300046492 Bacteria 1348
165 Ga0495594_0005253 3300046499 Bacteria 6657
166 Ga0495594_0108772 3300046499 Bacteria 1562
167 Ga0495594_0189810 3300046499 Bacteria 1170
168 Ga0495594_0503759 3300046499 Bacteria 687
169 Ga0495610_0112489 3300046512 Bacteria 1204
170 Ga0495631_0119929 3300046518 Bacteria 1131
171 Ga0495643_0004824 3300046522 Bacteria 9292
172 Ga0495643_0134854 3300046522 Bacteria 1236
173 Ga0495648_0366909 3300046524 Bacteria 653
174 Ga0495666_0106365 3300046526 Bacteria 1320
175 Ga0495642_0032175 3300046528 Bacteria 2104
176 Ga0495597_0029735 3300046542 Bacteria 2493
177 Ga0495622_0002963 3300046557 Bacteria 8080
178 Ga0495622_0088200 3300046557 Bacteria 1426
179 Ga0495622_0284377 3300046557 Bacteria 723
180 Ga0495633_0034315 3300046558 Bacteria 2441
181 Ga0495668_0297675 3300046616 Bacteria 884
182 Ga0495611_0023926 3300046648 Bacteria 2654
183 Ga0495611_0170570 3300046648 Bacteria 1017
184 Ga0495611_0202138 3300046648 Bacteria 926
185 Ga0495625_0001776 3300046660 Bacteria 24861
186 Ga0495635_0033434 3300046663 Bacteria 3567
187 Ga0495659_0121099 3300046664 Bacteria 1030
188 Ga0495661_0379937 3300046665 Bacteria 690
189 Ga0495588_0004439 3300046674 Bacteria 6200
190 Ga0495588_0005806 3300046674 Bacteria 5521
191 Ga0495588_0056426 3300046674 Bacteria 2027
192 Ga0495588_0091827 3300046674 Bacteria 1591
193 Ga0495588_0405292 3300046674 Bacteria 716
194 Ga0495658_0068980 3300046683 Bacteria 2048
195 Ga0495613_0006519 3300046689 Bacteria 8723
196 Ga0495613_0065997 3300046689 Bacteria 2644
197 Ga0495613_0158157 3300046689 Bacteria 1613
198 Ga0495670_0015157 3300046691 Bacteria 3792
199 Ga0495670_0544679 3300046691 Bacteria 631
200 Ga0495671_0006228 3300046692 Bacteria 6916
201 Ga0495649_0155249 3300046694 Bacteria 1201
202 Ga0495589_0036290 3300046794 Bacteria 2471
203 Ga0495589_0048949 3300046794 Bacteria 2091
204 Ga0495589_0197606 3300046794 Bacteria 950
205 Ga0495581_0289855 3300047315 Bacteria 957
206 Ga0495604_0053796 3300047317 Bacteria 3109
207 Ga0495636_0023369 3300047318 Bacteria 2502
208 Ga0495636_0048586 3300047318 Bacteria 1773
209 Ga0495636_0102322 3300047318 Bacteria 1254
210 Ga0495636_0117897 3300047318 Bacteria 1172
211 Ga0495636_0191092 3300047318 Bacteria 932
212 Ga0495636_0370787 3300047318 Bacteria 678
213 Ga0495676_0000150 3300047321 Bacteria 53407
214 Ga0495676_0001728 3300047321 Bacteria 19083
215 Ga0495683_0023833 3300047323 Bacteria 3144
216 Ga0495683_0091943 3300047323 Bacteria 1469
217 Ga0495687_003240 3300047443 Bacteria 12019
218 Ga0495687_063197 3300047443 Bacteria 1516
219 Ga0495687_075881 3300047443 Bacteria 1332
220 Ga0495687_259329 3300047443 Bacteria 514
221 Ga0495675_0580922 3300047444 Bacteria 637
222 Ga0495685_001042 3300047447 Bacteria 8449
223 Ga0495685_014351 3300047447 Bacteria 2691
224 Ga0495685_038943 3300047447 Bacteria 1627
225 Ga0495685_067303 3300047447 Bacteria 1203
226 Ga0495685_121934 3300047447 Bacteria 855
227 Ga0495681_0003971 3300047470 Bacteria 10188
228 Ga0495681_0050926 3300047470 Bacteria 1949
229 Ga0495686_0013903 3300047472 Bacteria 5570
230 Ga0495686_0029526 3300047472 Bacteria 3566
231 Ga0495614_0006485 3300048089 Bacteria 5250
232 Ga0495614_0015000 3300048089 Bacteria 3382
233 Ga0496110_1261780 3300048913 Bacteria 648
234 Ga0496110_1488155 3300048913 Bacteria 587
235 Ga0496112_1287585 3300048915 Bacteria 647
236 Ga0496113_0114841 3300048916 Bacteria 2100
237 Ga0501031_0037173 3300049568 Bacteria 3176
238 Ga0501031_0042914 3300049568 Bacteria 2952
239 Ga0501031_0082348 3300049568 Bacteria 2098
240 Ga0501031_0152677 3300049568 Bacteria 1509
241 Ga0501031_0880110 3300049568 Bacteria 573
242 Ga0501032_0017916 3300049569 Bacteria 4969
243 Ga0501032_0049170 3300049569 Bacteria 2845
244 Ga0501032_0156218 3300049569 Bacteria 1498
245 Ga0501032_0204731 3300049569 Bacteria 1287
246 Ga0501032_0348485 3300049569 Bacteria 954
247 Ga0501033_0008527 3300049570 Bacteria 7930
248 Ga0501033_0024039 3300049570 Bacteria 4597
249 Ga0501033_0045101 3300049570 Bacteria 3281
250 Ga0501033_0045675 3300049570 Bacteria 3258
251 Ga0501033_0109867 3300049570 Bacteria 2007
252 Ga0501033_0135631 3300049570 Bacteria 1781
253 Ga0501034_0019534 3300049571 Bacteria 6930
254 Ga0501034_0029546 3300049571 Bacteria 5572
255 Ga0501034_0068577 3300049571 Bacteria 3556
256 Ga0501034_0106570 3300049571 Bacteria 2795
257 Ga0501034_0135723 3300049571 Bacteria 2441
258 Ga0501034_0254703 3300049571 Bacteria 1699
259 Ga0501034_0842967 3300049571 Bacteria 807
260 Ga0501034_1525877 3300049571 Bacteria 542
261 Ga0501036_0029890 3300049572 Bacteria 4604
262 Ga0501036_0031589 3300049572 Bacteria 4474
263 Ga0501036_0071205 3300049572 Bacteria 2940
264 Ga0501036_0138944 3300049572 Bacteria 2050
265 Ga0501036_0187155 3300049572 Bacteria 1742
266 Ga0501036_0271931 3300049572 Bacteria 1418
267 Ga0501037_0030007 3300049573 Bacteria 4017
268 Ga0501037_0051022 3300049573 Bacteria 3025
269 Ga0501037_0125857 3300049573 Bacteria 1840
270 Ga0501037_0209838 3300049573 Bacteria 1374
271 Ga0501037_1030636 3300049573 Bacteria 535
272 Ga0501037_1124882 3300049573 Bacteria 508
273 Ga0501038_0005032 3300049574 Bacteria 12278
274 Ga0501038_0078843 3300049574 Bacteria 2778
275 Ga0501038_0196926 3300049574 Bacteria 1619
276 Ga0501038_0197669 3300049574 Bacteria 1615
277 Ga0501039_0018941 3300049575 Bacteria 5283
278 Ga0501039_0067134 3300049575 Bacteria 2785
279 Ga0501039_0717385 3300049575 Bacteria 781
280 Ga0501039_1020981 3300049575 Bacteria 642
281 Ga0501041_0023658 3300049577 Bacteria 3683
282 Ga0501043_0011681 3300049579 Bacteria 6875
283 Ga0501043_0034264 3300049579 Bacteria 3993
284 Ga0501043_0127917 3300049579 Bacteria 1991
285 Ga0501043_0155507 3300049579 Bacteria 1788
286 Ga0501043_0322037 3300049579 Bacteria 1178
287 Ga0501043_0789678 3300049579 Bacteria 687
288 Ga0501046_0031747 3300049580 Bacteria 4279
289 Ga0501047_0018031 3300049581 Bacteria 6765
290 Ga0501047_0053638 3300049581 Bacteria 3899
291 Ga0501047_0113937 3300049581 Bacteria 2586
292 Ga0501048_0049858 3300049582 Bacteria 2982
293 Ga0501067_0010244 3300049583 Bacteria 5186
294 Ga0501068_0042273 3300049584 Bacteria 2740
295 Ga0501068_0144319 3300049584 Bacteria 1494
296 Ga0501068_0569790 3300049584 Bacteria 737
297 Ga0501069_0061457 3300049585 Bacteria 2097
298 Ga0501069_0306565 3300049585 Bacteria 932
299 Ga0501069_0657542 3300049585 Bacteria 631
300 Ga0501070_0003691 3300049586 Bacteria 13235
301 Ga0501070_0115907 3300049586 Bacteria 2212
302 Ga0501070_0115973 3300049586 Bacteria 2212
303 Ga0501070_0502960 3300049586 Bacteria 974
304 Ga0501070_0798300 3300049586 Bacteria 741
305 Ga0501071_0000622 3300049587 Bacteria 18372
306 Ga0501072_0041419 3300049588 Bacteria 3617
307 Ga0501072_0489148 3300049588 Bacteria 973
308 Ga0501073_0212720 3300049589 Bacteria 1336
309 Ga0501073_0376156 3300049589 Bacteria 981
310 Ga0501074_0053809 3300049590 Bacteria 2903
311 Ga0501076_0020673 3300049592 Bacteria 5041
312 Ga0501077_0098911 3300049593 Bacteria 1849
313 Ga0501223_106608 3300049663 Bacteria 582
314 Ga0501079_0009562 3300049741 Bacteria 7350
315 Ga0501081_0498054 3300049743 Bacteria 908
316 Ga0501083_0016264 3300049744 Bacteria 5209
317 Ga0501035_0035912 3300049822 Bacteria 4495
318 Ga0501035_0077840 3300049822 Bacteria 2930
319 Ga0501035_0085585 3300049822 Bacteria 2778
320 Ga0501035_0093652 3300049822 Bacteria 2643
321 Ga0501035_0119089 3300049822 Bacteria 2309
322 Ga0501035_0252947 3300049822 Bacteria 1495
323 Ga0501035_0291350 3300049822 Bacteria 1377
324 Ga0501044_0052626 3300049823 Bacteria 4194
325 Ga0501044_0109002 3300049823 Bacteria 2778
326 Ga0501044_0146099 3300049823 Bacteria 2350
327 Ga0501044_0176038 3300049823 Bacteria 2108
328 Ga0501044_0321536 3300049823 Bacteria 1471
329 Ga0501044_0330018 3300049823 Bacteria 1448
330 Ga0501044_1178117 3300049823 Bacteria 634
331 Ga0501045_0383829 3300049824 Bacteria 1046
332 Ga0501045_0719950 3300049824 Bacteria 736
333 Ga0501045_1395161 3300049824 Bacteria 509
334 nmdc:mga03n38_120700_c1 3300050490 Bacteria 1288
335 nmdc:mga07m45_65445_c1 3300050496 Bacteria 2064
336 Ga0500578_0108021 3300053086 Bacteria 1756
337 Ga0500643_052129 3300053087 Bacteria 1167
338 Ga0500644_0501046 3300053088 Bacteria 534
339 Ga0500583_0117303 3300053092 Bacteria 1315
340 Ga0500566_0169430 3300053094 Bacteria 1130
341 Ga0500640_240288 3300053095 Bacteria 592
342 Ga0500641_0114861 3300053096 Bacteria 1160
343 Ga0500654_032805 3300053099 Bacteria 3092
344 Ga0500660_039978 3300053100 Bacteria 2392
345 Ga0500553_134290 3300053101 Bacteria 990
346 Ga0500628_002845 3300053129 Bacteria 2841
347 Ga0500652_003223 3300053131 Bacteria 4932
348 Ga0500658_0011460 3300053134 Bacteria 3266
349 Ga0500561_0002457 3300053137 Bacteria 3125
350 Ga0500573_0111293 3300053140 Bacteria 1532
351 Ga0500577_0132177 3300053142 Bacteria 1047
352 Ga0500579_167543 3300053143 Bacteria 905
353 Ga0500588_0042681 3300053146 Bacteria 1375
354 Ga0500600_0010197 3300053149 Bacteria 5683
355 Ga0500600_0111673 3300053149 Bacteria 1424
356 Ga0500633_0004173 3300053160 Bacteria 3277
357 Ga0500634_0075262 3300053161 Bacteria 1756
358 Ga0500636_0123376 3300053177 Bacteria 1451
359 Ga0500656_000128 3300053732 Bacteria 4479
360 Ga0500587_001346 3300053739 Bacteria 3456
361 Ga0466962_0001291 3300061719 Bacteria 11564
362 Ga0466962_0025282 3300061719 Bacteria 2851
363 Ga0530510_0075461 3300061734 Bacteria 2449
364 2547408238 2547132111 Bacteria 8013147
365 2554257201 2554235005 Bacteria 6457341
366 2585299260 2582581312 Bacteria 7308206
367 2585308912 2582581313 Bacteria 10042643
368 2585313604 2582581314 Bacteria 11452267
369 2616694945 2616644814 Bacteria 11555299
370 2616904583 2616644941 Bacteria 8510691
371 2643899146 2643221578 Bacteria 9213798
372 2643942401 2643221587 Bacteria 7586415
373 2644262415 2643221647 Bacteria 10741251
374 2644390025 2643221670 Bacteria 6497041
375 2644403329 2643221673 Bacteria 9196637
376 2644429482 2643221677 Bacteria 7584031
377 2644437251 2643221678 Bacteria 9540101
378 2644628989 2643221714 Bacteria 9015452
379 2768643483 2767802112 Bacteria 6465194
380 2784588704 2784132148 Bacteria 8627943
381 2785369633 2784746768 Bacteria 10036182
382 2786670719 2786546132 Bacteria 10419719
383 2793978395 2791355406 Bacteria 11364898
384 2804846779 2802429296 Bacteria 7227771
385 2808842152 2808606359 Bacteria 9866990
386 2808920687 2808606375 Bacteria 9466072
387 2809232314 2808606448 Bacteria 8656184
388 2811849156 2808606982 Bacteria 7791042
389 2812357974 2811994879 Bacteria 9313447
390 2812480424 2811994917 Bacteria 7761064
391 2819695518 2818991463 Bacteria 7948711
392 2852636543 2852635781 Bacteria 8251373
393 2862179365 2862178590 Bacteria 8583590
394 2862285769 2862281513 Bacteria 9621493
395 2862290557 2862290372 Bacteria 7471434
396 2862390291 2862382967 Bacteria 10317375
397 2862511703 2862507626 Bacteria 9425308
398 2862710237 2862705112 Bacteria 6563286
399 2863404471 2863404153 Bacteria 9672205
400 2867348921 2867346516 Bacteria 7608576
401 2867371986 2867369537 Bacteria 6501581
402 2867434960 2867428634 Bacteria 9590268
403 2867478826 2867475112 Bacteria 6909112
404 2873155620 2873151551 Bacteria 8625867
405 2875395575 2875391855 Bacteria 7600475
406 2877680993 2877676314 Bacteria 9512378
407 2912719838 2912715099 Bacteria 9460473
408 2912724235 2912723979 Bacteria 8557534
409 2912760892 2912757875 Bacteria 7940295
410 2918505460 2918501144 Bacteria 8668083
411 2919469421 2919468124 Bacteria 9133025
412 2935393306 2935390628 Bacteria 7043367
413 2946049888 2946045630 Bacteria 8527308
414 2946067869 2946064051 Bacteria 8957905
415 2946076007 2946072368 Bacteria 8999607
416 2947229078 2947224130 Bacteria 9938529
417 2954386103 2954380949 Bacteria 10050426
418 2954677044 2954673503 Bacteria 9685905
419 2954687112 2954682443 Bacteria 9862841
420 2954696743 2954691527 Bacteria 10720516
421 2954705395 2954701450 Bacteria 10834262
422 2954716124 2954711539 Bacteria 10867210
423 2954726067 2954721474 Bacteria 10456478
424 2954735743 2954731030 Bacteria 10243860
425 2954744993 2954740390 Bacteria 10229294
426 2954754598 2954749733 Bacteria 10366972
427 2954763965 2954759201 Bacteria 9358192
428 2966601757 2966598605 Bacteria 7676064
429 2990045336 2990044586 Bacteria 6603797
430 2990063201 2990059506 Bacteria 9321252
431 2990094047 2990088156 Bacteria 6657676
432 2997600310 2997600082 Bacteria 9896405
433 3006396350 3006393351 Bacteria 6615579
434 3006428798 3006425503 Bacteria 6491253
435 3006491033 3006486233 Bacteria 8157040
436 3006500862 3006493962 Bacteria 8825450
437 8008490311 8008485437 Bacteria 7198341
438 8008567128 8008558824 Bacteria 10610750
439 8008578790 8008574985 Bacteria 7815457
440 8023627107 8023623736 Bacteria 8593882
441 8025413718 8025413630 Bacteria 7014048
442 8025482107 8025478263 Bacteria 8209203
443 8025529613 8025524527 Bacteria 7197316
444 8025537909 8025530807 Bacteria 8495698
445 8033687838 8033684223 Bacteria 6906479
446 8047897978 8047893842 Bacteria 11723082
447 8048137332 8048127548 Bacteria 11053136
448 8048360916 8048356638 Bacteria 11044339
449 8048374941 8048369669 Bacteria 11666822
450 8048383265 8048379754 Bacteria 11877923
451 8048413917 8048406513 Bacteria 8936924
452 8054161765 8054160619 Bacteria 7783213
453 8056449075 8056447290 Bacteria 7680491
454 8056671233 8056667051 Bacteria 6953971
455 8056833508 8056829672 Bacteria 9045328
456 rootH1_10033419
457 JGI24735J21928_10138243
458 JGI24738J21930_10125552
459 rootH1_10007984
460 rootH1_10025629
461 rootH2_10019907
462 rootL2_10063370
463 rootH1_10000847
464 rootH1_10145542
465 JGI25160J50197_1027411
466 Ga0058692_1026979
467 Ga0070675_101245791
468 Ga0070700_101510600
469 Ga0070678_101386260
470 Ga0068853_100029147
471 Ga0070665_100065129
472 Ga0070665_100595278
473 Ga0068855_100268677
474 Ga0081455_10168513
475 Ga0075365_10205652
476 Ga0075368_10007733
477 Ga0075363_100011735
478 Ga0070715_10086121
479 Ga0075370_10069500
480 Ga0105244_10085270
481 Ga0105244_10251142
482 Ga0105244_10468247
483 Ga0105250_10108570
484 Ga0105245_10113266
485 Ga0105245_10631312
486 Ga0105243_10090347
487 Ga0105243_10261278
488 Ga0105242_11167209
489 Ga0105248_11882154
490 Ga0105238_10175754
491 Ga0105246_10377385
492 Ga0105246_10758260
493 Ga0157371_10878260
494 Ga0157369_10053224
495 Ga0157372_10178111
496 Ga0157376_10701215
497 Ga0183367_1005
498 Ga0209758_1004925
499 Ga0207426_1001851
500 Ga0207426_1019949
501 Ga0207426_1088055
502 Ga0207426_1105212
503 Ga0207646_11033728
504 Ga0207687_10579575
505 Ga0207709_10379264
506 Ga0207667_11208235
507 Ga0207683_11105670
508 Ga0209371_1017108
509 Ga0209813_10014313
510 Ga0268266_10047957
511 Ga0268266_10344096
512 Ga0307517_10029007
513 Ga0307517_10031996
514 Ga0307515_10003702
515 Ga0307515_10046083
516 Ga0307515_10227374
517 Ga0268256_1011694
518 Ga0307511_10001286
519 Ga0307511_10034993
520 Ga0307511_10088233
521 Ga0307512_10001726
522 Ga0307512_10198508
523 Ga0307512_10288126
524 Ga0307513_10020586
525 Ga0307513_10065301
526 Ga0307513_10091881
527 Ga0307509_10003362
528 Ga0307509_10141936
529 Ga0307508_10009614
530 Ga0307508_10013071
531 Ga0307508_10048029
532 Ga0307508_10152786
533 Ga0307514_10007082
534 Ga0307514_10114405
535 Ga0307514_10211188
536 Ga0307514_10366260
537 Ga0307516_10008705
538 Ga0307516_10021397
539 Ga0307516_10361358
540 Ga0307413_10781580
541 Ga0307518_10042674
542 Ga0307518_10166030
543 Ga0307410_10359889
544 Ga0307416_101489874
545 Ga0307416_102387044
546 Ga0307415_101024294
547 Ga0307507_10047557
548 Ga0307510_10087205
549 Ga0307510_10139922
550 Ga0307510_10203899
551 Ga0395899_0695620
552 Ga0395900_0200899
553 Ga0395900_0337938
554 Ga0395898_0006338
555 Ga0395898_0014755
556 Ga0395898_0077754
557 Ga0395905_0169941
558 Ga0395901_0209754
559 Ga0395901_0889663
560 Ga0439436_0000221
561 Ga0439436_0007067
562 Ga0439436_0054241
563 Ga0439439_0016037
564 Ga0451837_1576509
565 Ga0451849_1466464
566 Ga0451853_0616464
567 Ga0451853_1286081
568 Ga0451853_2221147
569 Ga0439433_0000914
570 Ga0439433_0009462
571 Ga0439448_0088276
572 Ga0439432_033909
573 Ga0439449_0036507
574 Ga0439449_0055996
575 Ga0439457_001048
576 Ga0439457_001710
577 Ga0439462_0007094
578 Ga0439462_0024263
579 Ga0450897_007343
580 Ga0450894_009675
581 Ga0450895_004539
582 Ga0450896_000554
583 Ga0450898_003442
584 Ga0450899_000806
585 Ga0450906_002191
586 Ga0450908_004983
587 Ga0450918_099804
588 Ga0466969_0149707
589 Ga0466972_0017222
590 Ga0466972_0023180
591 Ga0466972_0134032
592 Ga0466965_0001233
593 Ga0466966_0002684
594 Ga0466961_0000772
595 Ga0466961_0671033
596 Ga0466964_0001683
597 Ga0466971_0000130
598 Ga0466970_0000179
599 Ga0466970_0070999
600 Ga0466970_0276231
601 Ga0466957_0002644
602 Ga0466959_0001093
603 Ga0466958_0000745
604 Ga0466967_0003603
605 Ga0466967_0049907
606 Ga0495627_024667
607 Ga0495627_050637
608 Ga0495603_0001554
609 Ga0495603_0001594
610 Ga0495603_0036674
611 Ga0495603_0054394
612 Ga0495603_0553352
613 Ga0495629_0004390
614 Ga0495629_0017146
615 Ga0495629_0023884
616 Ga0495582_0192916
617 Ga0495585_0034360
618 Ga0495585_0126473
619 Ga0495594_0005253
620 Ga0495594_0108772
621 Ga0495594_0189810
622 Ga0495594_0503759
623 Ga0495610_0112489
624 Ga0495631_0119929
625 Ga0495643_0004824
626 Ga0495643_0134854
627 Ga0495648_0366909
628 Ga0495666_0106365
629 Ga0495642_0032175
630 Ga0495597_0029735
631 Ga0495622_0002963
632 Ga0495622_0088200
633 Ga0495622_0284377
634 Ga0495633_0034315
635 Ga0495668_0297675
636 Ga0495611_0023926
637 Ga0495611_0170570
638 Ga0495611_0202138
639 Ga0495625_0001776
640 Ga0495635_0033434
641 Ga0495659_0121099
642 Ga0495661_0379937
643 Ga0495588_0004439
644 Ga0495588_0005806
645 Ga0495588_0056426
646 Ga0495588_0091827
647 Ga0495588_0405292
648 Ga0495658_0068980
649 Ga0495613_0006519
650 Ga0495613_0065997
651 Ga0495613_0158157
652 Ga0495670_0015157
653 Ga0495670_0544679
654 Ga0495671_0006228
655 Ga0495649_0155249
656 Ga0495589_0036290
657 Ga0495589_0048949
658 Ga0495589_0197606
659 Ga0495581_0289855
660 Ga0495604_0053796
661 Ga0495636_0023369
662 Ga0495636_0048586
663 Ga0495636_0102322
664 Ga0495636_0117897
665 Ga0495636_0191092
666 Ga0495636_0370787
667 Ga0495676_0000150
668 Ga0495676_0001728
669 Ga0495683_0023833
670 Ga0495683_0091943
671 Ga0495687_003240
672 Ga0495687_063197
673 Ga0495687_075881
674 Ga0495687_259329
675 Ga0495675_0580922
676 Ga0495685_001042
677 Ga0495685_014351
678 Ga0495685_038943
679 Ga0495685_067303
680 Ga0495685_121934
681 Ga0495681_0003971
682 Ga0495681_0050926
683 Ga0495686_0013903
684 Ga0495686_0029526
685 Ga0495614_0006485
686 Ga0495614_0015000
687 Ga0496110_1261780
688 Ga0496110_1488155
689 Ga0496112_1287585
690 Ga0496113_0114841
691 Ga0501031_0037173
692 Ga0501031_0042914
693 Ga0501031_0082348
694 Ga0501031_0152677
695 Ga0501031_0880110
696 Ga0501032_0017916
697 Ga0501032_0049170
698 Ga0501032_0156218
699 Ga0501032_0204731
700 Ga0501032_0348485
701 Ga0501033_0008527
702 Ga0501033_0024039
703 Ga0501033_0045101
704 Ga0501033_0045675
705 Ga0501033_0109867
706 Ga0501033_0135631
707 Ga0501034_0019534
708 Ga0501034_0029546
709 Ga0501034_0068577
710 Ga0501034_0106570
711 Ga0501034_0135723
712 Ga0501034_0254703
713 Ga0501034_0842967
714 Ga0501034_1525877
715 Ga0501036_0029890
716 Ga0501036_0031589
717 Ga0501036_0071205
718 Ga0501036_0138944
719 Ga0501036_0187155
720 Ga0501036_0271931
721 Ga0501037_0030007
722 Ga0501037_0051022
723 Ga0501037_0125857
724 Ga0501037_0209838
725 Ga0501037_1030636
726 Ga0501037_1124882
727 Ga0501038_0005032
728 Ga0501038_0078843
729 Ga0501038_0196926
730 Ga0501038_0197669
731 Ga0501039_0018941
732 Ga0501039_0067134
733 Ga0501039_0717385
734 Ga0501039_1020981
735 Ga0501041_0023658
736 Ga0501043_0011681
737 Ga0501043_0034264
738 Ga0501043_0127917
739 Ga0501043_0155507
740 Ga0501043_0322037
741 Ga0501043_0789678
742 Ga0501046_0031747
743 Ga0501047_0018031
744 Ga0501047_0053638
745 Ga0501047_0113937
746 Ga0501048_0049858
747 Ga0501067_0010244
748 Ga0501068_0042273
749 Ga0501068_0144319
750 Ga0501068_0569790
751 Ga0501069_0061457
752 Ga0501069_0306565
753 Ga0501069_0657542
754 Ga0501070_0003691
755 Ga0501070_0115907
756 Ga0501070_0115973
757 Ga0501070_0502960
758 Ga0501070_0798300
759 Ga0501071_0000622
760 Ga0501072_0041419
761 Ga0501072_0489148
762 Ga0501073_0212720
763 Ga0501073_0376156
764 Ga0501074_0053809
765 Ga0501076_0020673
766 Ga0501077_0098911
767 Ga0501223_106608
768 Ga0501079_0009562
769 Ga0501081_0498054
770 Ga0501083_0016264
771 Ga0501035_0035912
772 Ga0501035_0077840
773 Ga0501035_0085585
774 Ga0501035_0093652
775 Ga0501035_0119089
776 Ga0501035_0252947
777 Ga0501035_0291350
778 Ga0501044_0052626
779 Ga0501044_0109002
780 Ga0501044_0146099
781 Ga0501044_0176038
782 Ga0501044_0321536
783 Ga0501044_0330018
784 Ga0501044_1178117
785 Ga0501045_0383829
786 Ga0501045_0719950
787 Ga0501045_1395161
788 nmdc:mga03n38_120700_c1
789 nmdc:mga07m45_65445_c1
790 Ga0500578_0108021
791 Ga0500643_052129
792 Ga0500644_0501046
793 Ga0500583_0117303
794 Ga0500566_0169430
795 Ga0500640_240288
796 Ga0500641_0114861
797 Ga0500654_032805
798 Ga0500660_039978
799 Ga0500553_134290
800 Ga0500628_002845
801 Ga0500652_003223
802 Ga0500658_0011460
803 Ga0500561_0002457
804 Ga0500573_0111293
805 Ga0500577_0132177
806 Ga0500579_167543
807 Ga0500588_0042681
808 Ga0500600_0010197
809 Ga0500600_0111673
810 Ga0500633_0004173
811 Ga0500634_0075262
812 Ga0500636_0123376
813 Ga0500656_000128
814 Ga0500587_001346
815 Ga0466962_0001291
816 Ga0466962_0025282
817 Ga0530510_0075461
818 2547408238
819 2554257201
820 2585299260
821 2585308912
822 2585313604
823 2616694945
824 2616904583
825 2643899146
826 2643942401
827 2644262415
828 2644390025
829 2644403329
830 2644429482
831 2644437251
832 2644628989
833 2768643483
834 2784588704
835 2785369633
836 2786670719
837 2793978395
838 2804846779
839 2808842152
840 2808920687
841 2809232314
842 2811849156
843 2812357974
844 2812480424
845 2819695518
846 2852636543
847 2862179365
848 2862285769
849 2862290557
850 2862390291
851 2862511703
852 2862710237
853 2863404471
854 2867348921
855 2867371986
856 2867434960
857 2867478826
858 2873155620
859 2875395575
860 2877680993
861 2912719838
862 2912724235
863 2912760892
864 2918505460
865 2919469421
866 2935393306
867 2946049888
868 2946067869
869 2946076007
870 2947229078
871 2954386103
872 2954677044
873 2954687112
874 2954696743
875 2954705395
876 2954716124
877 2954726067
878 2954735743
879 2954744993
880 2954754598
881 2954763965
882 2966601757
883 2990045336
884 2990063201
885 2990094047
886 2997600310
887 3006396350
888 3006428798
889 3006491033
890 3006500862
891 8008490311
892 8008567128
893 8008578790
894 8023627107
895 8025413718
896 8025482107
897 8025529613
898 8025537909
899 8033687838
900 8047897978
901 8048137332
902 8048360916
903 8048374941
904 8048383265
905 8048413917
906 8054161765
907 8056449075
908 8056671233
909 8056833508

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map