F447310

General Info

Members Datasets Scaffolds Average Seq Length
454 290 407 363

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10045571|rootL2_100455712
Length 422
Sequence MIGIAEAFSPRYSQARQKFLQGCVSAGLTVEPHAHPLKGREGEELSMDVALDGAPDAQNLLVVSSACHGVEGHCGSGVQVFALHDAEWREKAKAQGVAVLYVHALNPHGFSHGRRVTHENVDLNRNFIDFSKPVPVNEAYAKLHELLLPATWPPTPENQAAIDKWIGKHGTTAYQAAVTSGQYQFEDGLFYGGKAPTWSNRTVREVLRRHAGRAKRIAWIDLHTGLGPNGLGERIFAGRDDKTAYARANAWWGTPAAPVTSIYDGSSTSALLRGLMWDSVYEECPQAEYTGIALEYGTLPILEVTGALRADHWLHKHPGAPADLADGIRARMLEAFYTDTDAWRGQIVSQARXGEPQVLTRPSPVSIESSTNFEPTWFLDENDTSKPPNCWRSMLSSPAIRPSRVGLPGALRRPSTSTFAAR

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
3 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
4 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
5 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
6 2643221609 Acidovorax sp. Root217 Isolate Unclassified
7 2643221611 Acidovorax sp. Root219 Isolate Unclassified
8 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
9 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
10 2643221658 Variovorax sp. Root411 Isolate Unclassified
11 2643221672 Variovorax sp. Root434 Isolate Unclassified
12 2643221683 Variovorax sp. Root473 Isolate Unclassified
13 2738541277 Variovorax sp. GV051 Isolate Unclassified
14 2738541307 Variovorax sp. GV008 Isolate Unclassified
15 2738543013 Variovorax sp. BT01 Isolate Unclassified
16 2738543019 Variovorax sp. GV040 Isolate Unclassified
17 2818991446 Variovorax sp. 1180 Isolate Unclassified
18 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
19 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
20 2842677519 Variovorax sp. R-72495 Isolate Unclassified
21 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
22 2842733646 Variovorax sp. R-72446 Isolate Unclassified
23 2842747753 Variovorax sp. R-72060 Isolate Unclassified
24 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
25 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
26 2885198086 Variovorax sp. 679 Isolate Unclassified
27 2885211737 Variovorax sp. 553 Isolate Unclassified
28 2899924645 Variovorax sp. 369 Isolate Unclassified
29 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
30 2904456579 Variovorax sp. 2002 Isolate Unclassified
31 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
32 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
33 2928037797 Variovorax sp. 1126 Isolate Unclassified
34 2928044640 Variovorax sp. 1128 Isolate Unclassified
35 2928051484 Variovorax sp. 1133 Isolate Unclassified
36 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
37 2928070936 Variovorax gossypii 1167 Isolate Unclassified
38 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
39 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
40 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
41 2929520902 Variovorax beijingensis 502 Isolate Unclassified
42 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
43 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
44 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
45 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
46 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
47 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
48 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
49 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
50 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
51 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
52 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
53 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
54 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
55 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
56 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
57 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
58 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
59 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
60 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
61 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
62 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
63 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
64 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
65 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
66 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
67 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
68 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
69 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
70 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
71 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
72 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
73 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
74 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
75 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
76 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
77 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
78 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
79 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
80 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
81 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
82 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
83 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
84 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
85 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
86 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
87 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
88 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
89 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
90 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
91 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
92 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
93 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
94 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
95 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
96 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
97 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
98 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
99 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
100 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
101 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
102 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
103 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
107 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
108 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
112 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
119 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
120 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
133 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
134 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
135 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
136 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
140 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
142 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
145 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
148 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
150 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
153 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
185 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
186 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
187 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
188 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
189 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
190 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
191 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
192 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
193 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
194 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
195 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
196 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
197 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
198 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
199 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
200 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
201 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
202 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
203 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
204 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
205 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
206 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
207 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
208 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
209 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
210 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
211 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
212 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
213 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
214 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
215 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
216 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
217 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
218 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
219 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
220 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
221 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
222 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
223 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
224 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
225 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
226 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
227 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
228 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
229 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
230 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
231 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
232 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
233 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
234 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
235 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
236 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
237 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
238 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
239 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
240 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
241 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
242 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
243 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
244 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
245 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
246 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
247 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
248 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
249 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
250 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
251 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
252 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
253 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
254 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
255 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
256 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
257 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
258 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
259 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
260 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
261 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
262 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
263 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
264 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
265 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
266 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
267 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
268 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
269 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
270 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
271 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
272 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
273 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
274 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
275 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
276 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
277 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
278 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
279 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
280 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
281 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
282 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
283 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
284 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
285 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
286 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
287 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
288 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
289 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
290 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.77
Metatranscriptomes 0.88
Isolates 10.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.96
Nodule 0.66
Rhizoplane 1.1
Rhizosphere 52.42
Stem 0
Stem Tuber 0
Unclassified 15.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10001713 3300003187 Bacteria 14314
2 rootL2_10045571 3300003322 Bacteria 4098
3 JGI25160J50197_1009257 3300003354 Bacteria 3672
4 JGI25160J50197_1018680 3300003354 Bacteria 2151
5 JGI25161J50226_1002128 3300003374 Bacteria 5322
6 JGI25161J50226_1008245 3300003374 Bacteria 1625
7 Ga0006562J51391_1073558 3300003578 Bacteria 3830
8 Ga0006562J51391_1073560 3300003578 Bacteria 3180
9 Ga0006562J51391_1118001 3300003578 Bacteria 3259
10 Ga0006562J51391_1118005 3300003578 Bacteria 1870
11 Ga0055535_1000067 3300003761 Bacteria 115376
12 Ga0055542_1000013 3300003762 Bacteria 387560
13 Ga0055526_1013304 3300003771 Bacteria 3493
14 Ga0055526_1017090 3300003771 Bacteria 2796
15 Ga0055537_1000133 3300003773 Bacteria 56531
16 Ga0055537_1012702 3300003773 Bacteria 1626
17 Ga0055524_1010497 3300003775 Bacteria 3682
18 Ga0055524_1013052 3300003775 Bacteria 3156
19 Ga0055536_1014877 3300003781 Bacteria 2699
20 Ga0055536_1016508 3300003781 Bacteria 2466
21 Ga0055534_1000037 3300003784 Bacteria 107072
22 Ga0055534_1002538 3300003784 Bacteria 6266
23 Ga0055534_1006055 3300003784 Bacteria 3115
24 Ga0055528_1000640 3300003790 Bacteria 25628
25 Ga0055528_1027060 3300003790 Bacteria 1626
26 Ga0055530_10014022 3300003791 Bacteria 2696
27 Ga0055530_10015635 3300003791 Bacteria 2466
28 Ga0055540_1001539 3300003792 Bacteria 13560
29 Ga0055540_1012289 3300003792 Bacteria 2698
30 Ga0055540_1019378 3300003792 Bacteria 1833
31 Ga0055531_10019830 3300003794 Bacteria 2698
32 Ga0055543_1002352 3300004625 Bacteria 6323
33 Ga0065165_1018203 3300005262 Bacteria 2554
34 Ga0065165_1022160 3300005262 Bacteria 2186
35 Ga0065165_1037358 3300005262 Bacteria 1472
36 Ga0065714_10003828 3300005288 Bacteria 6008
37 Ga0070676_10005063 3300005328 Bacteria 6989
38 Ga0070670_100003664 3300005331 Bacteria 12802
39 Ga0070670_100022222 3300005331 Bacteria 5459
40 Ga0068869_100035262 3300005334 Bacteria 3545
41 Ga0070666_10192868 3300005335 Bacteria 1432
42 Ga0068868_100008183 3300005338 Bacteria 7481
43 Ga0070668_100000919 3300005347 Bacteria 20510
44 Ga0070669_100010452 3300005353 Bacteria 6591
45 Ga0070669_100077889 3300005353 Bacteria 2464
46 Ga0070674_100039600 3300005356 Bacteria 3184
47 Ga0070673_100112083 3300005364 Bacteria 2264
48 Ga0070659_100058772 3300005366 Bacteria 3036
49 Ga0070667_100018693 3300005367 Bacteria 5748
50 Ga0070700_100017743 3300005441 Bacteria 4077
51 Ga0070678_100000336 3300005456 Bacteria 21917
52 Ga0070678_100046083 3300005456 Bacteria 3124
53 Ga0068867_100005330 3300005459 Bacteria 9088
54 Ga0068853_100020634 3300005539 Bacteria 5479
55 Ga0068853_100151328 3300005539 Bacteria 2089
56 Ga0070672_100031090 3300005543 Bacteria 4016
57 Ga0070672_100065212 3300005543 Bacteria 2880
58 Ga0070665_100003283 3300005548 Bacteria 17362
59 Ga0070665_100021424 3300005548 Bacteria 6501
60 Ga0070665_100056254 3300005548 Bacteria 3944
61 Ga0068855_100051155 3300005563 Bacteria 4866
62 Ga0070664_100051041 3300005564 Bacteria 3502
63 Ga0068852_100069274 3300005616 Bacteria 3091
64 Ga0068852_100272656 3300005616 Bacteria 1629
65 Ga0068859_100030773 3300005617 Bacteria 5386
66 Ga0068859_100454096 3300005617 Bacteria 1378
67 Ga0068864_100025201 3300005618 Bacteria 5007
68 Ga0068866_10039393 3300005718 Bacteria 2333
69 Ga0068861_100000811 3300005719 Bacteria 18865
70 Ga0068851_10100155 3300005834 Bacteria 1536
71 Ga0068863_100175020 3300005841 Bacteria 2059
72 Ga0068858_100022645 3300005842 Bacteria 5859
73 Ga0068858_100153239 3300005842 Bacteria 2168
74 Ga0068860_100002168 3300005843 Bacteria 20685
75 Ga0068860_100290085 3300005843 Bacteria 1601
76 Ga0068862_100003580 3300005844 Bacteria 13297
77 Ga0068862_100094164 3300005844 Bacteria 2612
78 Ga0068862_100118017 3300005844 Bacteria 2336
79 Ga0068862_100119070 3300005844 Bacteria 2325
80 Ga0075365_10061174 3300006038 Bacteria 2514
81 Ga0075365_10163322 3300006038 Bacteria 1553
82 Ga0075363_100061914 3300006048 Bacteria 2017
83 Ga0075364_10014010 3300006051 Bacteria 4944
84 Ga0075432_10017388 3300006058 Bacteria 2452
85 Ga0075362_10011131 3300006177 Bacteria 3537
86 Ga0075362_10011457 3300006177 Bacteria 3493
87 Ga0075369_10041292 3300006186 Bacteria 1975
88 Ga0075366_10008874 3300006195 Bacteria 5600
89 Ga0075366_10021139 3300006195 Bacteria 3783
90 Ga0075366_10028792 3300006195 Bacteria 3261
91 Ga0075366_10035606 3300006195 Bacteria 2935
92 Ga0097621_100003111 3300006237 Bacteria 11383
93 Ga0097621_100075214 3300006237 Bacteria 2799
94 Ga0097621_100175911 3300006237 Bacteria 1847
95 Ga0075370_10000919 3300006353 Bacteria 12094
96 Ga0075370_10017242 3300006353 Bacteria 3900
97 Ga0068871_100025580 3300006358 Bacteria 4595
98 Ga0068871_100040118 3300006358 Bacteria 3749
99 Ga0068871_100049407 3300006358 Bacteria 3400
100 Ga0075429_100004508 3300006880 Bacteria 11984
101 Ga0068865_100007366 3300006881 Bacteria 6769
102 Ga0068865_100010265 3300006881 Bacteria 5825
103 Ga0097620_100030775 3300006931 Bacteria 5386
104 Ga0097620_100454062 3300006931 Bacteria 1378
105 Ga0099826_10000321 3300006948 Bacteria 21775
106 Ga0105240_10113347 3300009093 Bacteria 3277
107 Ga0105245_10159659 3300009098 Bacteria 2138
108 Ga0105243_10000499 3300009148 Bacteria 40110
109 Ga0105243_10002576 3300009148 Bacteria 15141
110 Ga0105243_10221545 3300009148 Bacteria 1673
111 Ga0105242_10075403 3300009176 Bacteria 2808
112 Ga0105242_10315314 3300009176 Bacteria 1432
113 Ga0105237_10026284 3300009545 Bacteria 5950
114 Ga0105237_10305880 3300009545 Bacteria 1593
115 Ga0105238_10094135 3300009551 Bacteria 2983
116 Ga0105238_10169183 3300009551 Bacteria 2161
117 Ga0105249_10118446 3300009553 Bacteria 2513
118 Ga0105239_10094415 3300010375 Bacteria 3304
119 Ga0157347_1000469 3300012502 Bacteria 2643
120 Ga0157339_1000371 3300012505 Bacteria 2280
121 Ga0157373_10004187 3300013100 Bacteria 10883
122 Ga0157371_10111375 3300013102 Bacteria 1943
123 Ga0157370_10016616 3300013104 Bacteria 7446
124 Ga0157370_10141011 3300013104 Bacteria 2246
125 Ga0157374_10020129 3300013296 Bacteria 5916
126 Ga0157378_10018952 3300013297 Bacteria 6049
127 Ga0163162_10020951 3300013306 Bacteria 6431
128 Ga0163162_10050375 3300013306 Bacteria 4176
129 Ga0157372_10024904 3300013307 Bacteria 6504
130 Ga0157375_10103928 3300013308 Bacteria 2929
131 Ga0157375_10221549 3300013308 Bacteria 2050
132 Ga0157380_10238951 3300014326 Bacteria 1637
133 Ga0182008_10000044 3300014497 Bacteria 115149
134 Ga0182008_10002962 3300014497 Bacteria 10449
135 Ga0182008_10007562 3300014497 Bacteria 5992
136 Ga0182008_10038105 3300014497 Bacteria 2404
137 Ga0157379_10040366 3300014968 Bacteria 4165
138 Ga0157379_10213888 3300014968 Bacteria 1746
139 Ga0157376_10020812 3300014969 Bacteria 5084
140 Ga0157376_10126501 3300014969 Bacteria 2274
141 Ga0157376_10240270 3300014969 Bacteria 1687
142 Ga0182006_1001273 3300015261 Bacteria 15541
143 Ga0182006_1009601 3300015261 Bacteria 4331
144 Ga0182006_1073607 3300015261 Bacteria 1261
145 Ga0182007_10000443 3300015262 Bacteria 25091
146 Ga0182007_10005744 3300015262 Bacteria 5405
147 Ga0183362_10005 3300015683 Bacteria 437616
148 Ga0163161_10000304 3300017792 Bacteria 42860
149 Ga0163161_10001502 3300017792 Bacteria 17252
150 Ga0163161_10041118 3300017792 Bacteria 3321
151 Ga0163161_10057152 3300017792 Bacteria 2835
152 Ga0163161_10092023 3300017792 Bacteria 2245
153 Ga0209672_102789 3300025228 Bacteria 4000
154 Ga0209147_100437 3300025229 Bacteria 26659
155 Ga0209258_100020 3300025242 Bacteria 565241
156 Ga0207425_1000201 3300025245 Bacteria 47830
157 Ga0207425_1006498 3300025245 Bacteria 3191
158 Ga0209148_1000031 3300025254 Bacteria 564601
159 Ga0209129_1000055 3300025258 Bacteria 261708
160 Ga0209129_1006290 3300025258 Bacteria 3898
161 Ga0209129_1006971 3300025258 Bacteria 3487
162 Ga0209129_1017186 3300025258 Bacteria 1427
163 Ga0209565_1000131 3300025263 Bacteria 107341
164 Ga0209565_1000795 3300025263 Bacteria 18204
165 Ga0209673_1000170 3300025273 Bacteria 133933
166 Ga0209673_1001892 3300025273 Bacteria 16807
167 Ga0209130_1000214 3300025284 Bacteria 76202
168 Ga0209130_1003075 3300025284 Bacteria 7466
169 Ga0209675_1000055 3300025291 Bacteria 193129
170 Ga0209675_1000956 3300025291 Bacteria 18314
171 Ga0209675_1008025 3300025291 Bacteria 3944
172 Ga0209675_1014260 3300025291 Bacteria 2429
173 Ga0209675_1014803 3300025291 Bacteria 2353
174 Ga0209676_1000040 3300025292 Bacteria 438184
175 Ga0209676_1000346 3300025292 Bacteria 87684
176 Ga0209676_1000508 3300025292 Bacteria 61404
177 Ga0209676_1026210 3300025292 Bacteria 1855
178 Ga0209025_1000065 3300025294 Bacteria 300915
179 Ga0209025_1000145 3300025294 Bacteria 181436
180 Ga0209025_1000510 3300025294 Bacteria 74231
181 Ga0209025_1009929 3300025294 Bacteria 6540
182 Ga0209025_1025679 3300025294 Bacteria 2987
183 Ga0209025_1040733 3300025294 Bacteria 2003
184 Ga0209564_1000254 3300025295 Bacteria 113032
185 Ga0209564_1000410 3300025295 Bacteria 76208
186 Ga0209564_1029076 3300025295 Bacteria 1748
187 Ga0209564_1035295 3300025295 Bacteria 1450
188 Ga0209758_1000042 3300025297 Bacteria 407145
189 Ga0209758_1008609 3300025297 Bacteria 6560
190 Ga0209758_1019144 3300025297 Bacteria 3317
191 Ga0209050_1000021 3300025298 Bacteria 574406
192 Ga0209050_1001781 3300025298 Bacteria 21203
193 Ga0209050_1008810 3300025298 Bacteria 5296
194 Ga0209256_1000056 3300025299 Bacteria 283044
195 Ga0209256_1000148 3300025299 Bacteria 147639
196 Ga0207426_1000055 3300025302 Bacteria 374450
197 Ga0207426_1000079 3300025302 Bacteria 314709
198 Ga0209051_1000028 3300025303 Bacteria 404269
199 Ga0209051_1000126 3300025303 Bacteria 142582
200 Ga0209051_1000284 3300025303 Bacteria 82589
201 Ga0209051_1000358 3300025303 Bacteria 67255
202 Ga0209051_1010303 3300025303 Bacteria 4740
203 Ga0209051_1010805 3300025303 Bacteria 4568
204 Ga0209257_1000043 3300025304 Bacteria 512127
205 Ga0209257_1000214 3300025304 Bacteria 136547
206 Ga0209257_1001556 3300025304 Bacteria 26602
207 Ga0209257_1010482 3300025304 Bacteria 4680
208 Ga0207656_10012292 3300025321 Bacteria 3253
209 Ga0207655_1003314 3300025728 Bacteria 12068
210 Ga0207642_10022337 3300025899 Bacteria 2507
211 Ga0207680_10132557 3300025903 Bacteria 1644
212 Ga0207645_10000236 3300025907 Bacteria 45713
213 Ga0207695_10115296 3300025913 Bacteria 2661
214 Ga0207694_10009874 3300025924 Bacteria 7204
215 Ga0207650_10068899 3300025925 Bacteria 2657
216 Ga0207690_10162368 3300025932 Bacteria 1667
217 Ga0207706_10021667 3300025933 Bacteria 5768
218 Ga0207709_10000808 3300025935 Bacteria 24310
219 Ga0207709_10003613 3300025935 Bacteria 9142
220 Ga0207709_10134423 3300025935 Bacteria 1690
221 Ga0207669_10034154 3300025937 Bacteria 2879
222 Ga0207704_10008962 3300025938 Bacteria 4809
223 Ga0207704_10016277 3300025938 Bacteria 3818
224 Ga0207691_10000305 3300025940 Bacteria 48776
225 Ga0207691_10018128 3300025940 Bacteria 6668
226 Ga0207691_10028254 3300025940 Bacteria 5253
227 Ga0207711_10148815 3300025941 Bacteria 2112
228 Ga0207679_10038155 3300025945 Bacteria 3421
229 Ga0207668_10093440 3300025972 Bacteria 2216
230 Ga0207668_10117786 3300025972 Bacteria 2005
231 Ga0207677_10163723 3300026023 Bacteria 1731
232 Ga0207639_10204713 3300026041 Bacteria 1695
233 Ga0207708_10047682 3300026075 Bacteria 3261
234 Ga0207641_10020002 3300026088 Bacteria 5496
235 Ga0207648_10000133 3300026089 Bacteria 73580
236 Ga0207648_10001320 3300026089 Bacteria 27583
237 Ga0207674_10177500 3300026116 Bacteria 2082
238 Ga0207675_100000103 3300026118 Bacteria 67419
239 Ga0207675_100166915 3300026118 Bacteria 2103
240 Ga0207683_10002510 3300026121 Bacteria 16013
241 Ga0207683_10008954 3300026121 Bacteria 8525
242 Ga0207683_10164197 3300026121 Bacteria 2009
243 Ga0207683_10329121 3300026121 Bacteria 1400
244 Ga0209282_1001228 3300027666 Bacteria 13872
245 Ga0268266_10008782 3300028379 Bacteria 8957
246 Ga0268266_10011562 3300028379 Bacteria 7663
247 Ga0268266_10127051 3300028379 Bacteria 2276
248 Ga0268265_10029375 3300028380 Bacteria 3945
249 Ga0268265_10046262 3300028380 Bacteria 3252
250 Ga0268265_10173300 3300028380 Bacteria 1846
251 Ga0268265_10240469 3300028380 Unclassified 1597
252 Ga0268264_10016727 3300028381 Bacteria 6004
253 Ga0268264_10160831 3300028381 Bacteria 2023
254 Ga0265334_10012739 3300028573 Bacteria 3531
255 Ga0307517_10005547 3300028786 Bacteria 18960
256 Ga0307515_10000751 3300028794 Bacteria 75067
257 Ga0307515_10007523 3300028794 Bacteria 21519
258 Ga0307515_10037359 3300028794 Bacteria 7812
259 Ga0307512_10006418 3300030522 Bacteria 11917
260 Ga0316177_1015726 3300030731 Bacteria 6132
261 Ga0316180_1005341 3300030736 Bacteria 4190
262 Ga0316182_1173054 3300030745 Bacteria 2169
263 Ga0265330_10000043 3300031235 Bacteria 116829
264 Ga0265332_10000018 3300031238 Bacteria 224913
265 Ga0265325_10003520 3300031241 Bacteria 10188
266 Ga0265340_10004773 3300031247 Bacteria 7538
267 Ga0265327_10002512 3300031251 Bacteria 19153
268 Ga0307513_10000034 3300031456 Bacteria 185012
269 Ga0307513_10029605 3300031456 Bacteria 6237
270 Ga0307513_10040954 3300031456 Bacteria 5117
271 Ga0307513_10045022 3300031456 Bacteria 4826
272 Ga0307513_10075792 3300031456 Bacteria 3491
273 Ga0307509_10000063 3300031507 Bacteria 143708
274 Ga0307509_10031514 3300031507 Bacteria 5853
275 Ga0307408_100012658 3300031548 Bacteria 5594
276 Ga0307408_100043941 3300031548 Bacteria 3181
277 Ga0307408_100235662 3300031548 Bacteria 1501
278 Ga0307508_10000109 3300031616 Bacteria 97316
279 Ga0307508_10025487 3300031616 Bacteria 5360
280 Ga0307514_10000763 3300031649 Bacteria 53536
281 Ga0307514_10028862 3300031649 Bacteria 4470
282 Ga0307514_10057910 3300031649 Bacteria 2967
283 Ga0265314_10000126 3300031711 Bacteria 116852
284 Ga0307405_10034098 3300031731 Bacteria 3025
285 Ga0307405_10119105 3300031731 Bacteria 1803
286 Ga0307405_10209936 3300031731 Bacteria 1421
287 Ga0307406_10003676 3300031901 Bacteria 8351
288 Ga0307406_10227817 3300031901 Bacteria 1390
289 Ga0307412_10005992 3300031911 Bacteria 6849
290 Ga0307412_10076286 3300031911 Bacteria 2302
291 Ga0307416_100228291 3300032002 Bacteria 1792
292 Ga0307414_10151425 3300032004 Bacteria 1830
293 Ga0307411_10067102 3300032005 Bacteria 2412
294 Ga0307510_10000429 3300033180 Bacteria 40378
295 Ga0307510_10004418 3300033180 Bacteria 16555
296 Ga0307510_10057703 3300033180 Bacteria 4026
297 Ga0307510_10196440 3300033180 Bacteria 1558
298 Ga0373931_0037380 3300035691 Bacteria 2535
299 Ga0373935_0240081 3300035692 Bacteria 1265
300 Ga0395905_0015225 3300037471 Bacteria 7313
301 Ga0439436_0006751 3300041404 Bacteria 3526
302 Ga0439436_0006829 3300041404 Bacteria 3507
303 Ga0439438_019317 3300041405 Bacteria 1927
304 Ga0439447_009073 3300041407 Bacteria 3036
305 Ga0439466_0024889 3300041411 Bacteria 2094
306 Ga0439466_0046064 3300041411 Bacteria 1441
307 Ga0439465_0004902 3300041413 Bacteria 4302
308 Ga0439465_0021898 3300041413 Bacteria 2006
309 Ga0451853_3036516 3300041512 Bacteria 1503
310 Ga0439442_002289 3300042002 Bacteria 3761
311 Ga0439442_015877 3300042002 Bacteria 1552
312 Ga0439432_008759 3300042006 Bacteria 3543
313 Ga0439432_030026 3300042006 Bacteria 1764
314 Ga0439449_0006570 3300042007 Bacteria 4443
315 Ga0439452_011201 3300042010 Bacteria 2585
316 Ga0450906_000679 3300042145 Bacteria 7285
317 Ga0450910_004207 3300042147 Bacteria 1938
318 Ga0450908_001090 3300042184 Bacteria 5271
319 Ga0439434_0000981 3300042435 Bacteria 8230
320 Ga0439434_0017455 3300042435 Bacteria 2147
321 Ga0450918_000783 3300042531 Bacteria 6695
322 Ga0453684_0003325 3300044712 Bacteria 36528
323 Ga0495592_0000128 3300046454 Bacteria 67453
324 Ga0495638_0259832 3300046460 Bacteria 953
325 Ga0495583_0025085 3300046506 Bacteria 2985
326 Ga0495616_0001425 3300046513 Bacteria 16636
327 Ga0495620_0031725 3300046515 Bacteria 2417
328 Ga0495620_0100650 3300046515 Bacteria 1152
329 Ga0495631_0000096 3300046518 Bacteria 58530
330 Ga0495637_0010529 3300046520 Bacteria 4469
331 Ga0495648_0054414 3300046524 Bacteria 2418
332 Ga0495663_0025904 3300046525 Bacteria 1713
333 Ga0495654_0009804 3300046530 Bacteria 5235
334 Ga0495654_0041347 3300046530 Bacteria 2293
335 Ga0495621_0008190 3300046539 Bacteria 3125
336 Ga0495656_0000081 3300046615 Bacteria 42254
337 Ga0495668_0048763 3300046616 Bacteria 2349
338 Ga0495625_0000136 3300046660 Bacteria 114576
339 Ga0495588_0133200 3300046674 Bacteria 1311
340 Ga0495646_0120482 3300046680 Bacteria 1485
341 Ga0495658_0028122 3300046683 Bacteria 3032
342 Ga0495670_0057923 3300046691 Bacteria 1945
343 Ga0495671_0007334 3300046692 Bacteria 6295
344 Ga0495676_0070618 3300047321 Bacteria 2688
345 Ga0495593_0021901 3300047673 Bacteria 3565
346 Ga0495615_0001453 3300048090 Bacteria 3536
347 Ga0496105_0093402 3300048908 Bacteria 2484
348 Ga0496106_0036585 3300048909 Bacteria 3672
349 Ga0496116_0062314 3300048919 Bacteria 2408
350 Ga0496117_0010975 3300048920 Bacteria 8163
351 Ga0496117_0039090 3300048920 Bacteria 3506
352 Ga0496117_0094659 3300048920 Bacteria 1911
353 Ga0496118_0023039 3300048921 Bacteria 5423
354 Ga0496118_0035539 3300048921 Bacteria 4043
355 Ga0496121_0166207 3300048924 Bacteria 1607
356 Ga0496122_0000272 3300048925 Bacteria 115666
357 Ga0496122_0064215 3300048925 Bacteria 2673
358 Ga0496123_0000221 3300048926 Bacteria 115688
359 Ga0496123_0056961 3300048926 Bacteria 2549
360 Ga0496123_0057267 3300048926 Bacteria 2538
361 Ga0496124_0022284 3300048927 Bacteria 5811
362 Ga0496125_0014247 3300048928 Bacteria 7749
363 Ga0496125_0018169 3300048928 Bacteria 6683
364 Ga0496125_0064869 3300048928 Bacteria 2898
365 Ga0496125_0072862 3300048928 Bacteria 2674
366 Ga0496126_0058804 3300048929 Bacteria 3464
367 Ga0501238_004272 3300049671 Bacteria 1781
368 Ga0501262_000324 3300049759 Bacteria 5790
369 nmdc:mga03683_37143_c1 3300050489 Bacteria 1984
370 nmdc:mga03n38_55071_c1 3300050490 Bacteria 1790
371 nmdc:mga00v17_35549_c1 3300050491 Bacteria 2966
372 nmdc:mga0yw44_45408_c1 3300050492 Bacteria 2634
373 nmdc:mga0k408_30922_c1 3300050493 Bacteria 3055
374 nmdc:mga0k408_38929_c1 3300050493 Bacteria 2730
375 nmdc:mga0k408_5661_c1 3300050493 Bacteria 6640
376 nmdc:mga0k408_6088_c1 3300050493 Bacteria 6426
377 nmdc:mga0k408_8852_c1 3300050493 Bacteria 5416
378 nmdc:mga07m45_3584_c1 3300050496 Bacteria 6333
379 nmdc:mga07m45_453_c1 3300050496 Bacteria 17172
380 nmdc:mga07m45_816_c1 3300050496 Bacteria 13445
381 nmdc:mga09592_1397_c1 3300050508 Bacteria 19296
382 nmdc:mga0qj67_77271_c1 3300050509 Bacteria 2663
383 Ga0500610_0044491 3300053079 Bacteria 2303
384 Ga0500578_0071960 3300053086 Bacteria 2204
385 Ga0500643_013117 3300053087 Bacteria 2940
386 Ga0500651_0000435 3300053093 Bacteria 22453
387 Ga0500651_0017782 3300053093 Bacteria 4394
388 Ga0500651_0093915 3300053093 Bacteria 1844
389 Ga0500571_000144 3300053110 Bacteria 24451
390 Ga0500593_000531 3300053117 Bacteria 15018
391 Ga0500607_001041 3300053121 Bacteria 26175
392 Ga0500607_026267 3300053121 Bacteria 3239
393 Ga0500608_004107 3300053122 Bacteria 5582
394 Ga0500618_020100 3300053125 Bacteria 1639
395 Ga0500655_000695 3300053133 Bacteria 6686
396 Ga0500559_0000013 3300053136 Bacteria 163436
397 Ga0500559_0009355 3300053136 Bacteria 4246
398 Ga0500559_0012808 3300053136 Bacteria 3559
399 Ga0500564_014792 3300053138 Bacteria 3516
400 Ga0500568_0000552 3300053139 Bacteria 27568
401 Ga0500573_0075259 3300053140 Bacteria 1922
402 Ga0500616_0007237 3300053153 Bacteria 7088
403 Ga0500622_0005534 3300053156 Bacteria 7555
404 Ga0500627_0009744 3300053158 Bacteria 3472
405 Ga0500636_0035198 3300053177 Bacteria 2964
406 Ga0500567_074745 3300053723 Bacteria 1479
407 Ga0500645_005276 3300053730 Bacteria 4787

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046460 Ga0495638_0259832 Ga0495638_0259832_11_916 298
2 3300035692 Ga0373935_0240081 Ga0373935_0240081_223_1209 322
3 3300014969 Ga0157376_10240270 Ga0157376_102402701 335
4 3300028573 Ga0265334_10012739 Ga0265334_100127391 339
5 3300031235 Ga0265330_10000043 Ga0265330_1000004365 339
6 3300031238 Ga0265332_10000018 Ga0265332_10000018176 339
7 3300031241 Ga0265325_10003520 Ga0265325_100035203 339
8 3300031247 Ga0265340_10004773 Ga0265340_100047732 339
9 3300031711 Ga0265314_10000126 Ga0265314_1000012639 339
10 3300005617 Ga0068859_100454096 Ga0068859_1004540961 349
11 3300005842 Ga0068858_100153239 Ga0068858_1001532392 349
12 3300005843 Ga0068860_100290085 Ga0068860_1002900852 349
13 3300006931 Ga0097620_100454062 Ga0097620_1004540621 349
14 3300009098 Ga0105245_10159659 Ga0105245_101596592 349
15 3300014968 Ga0157379_10213888 Ga0157379_102138882 349
16 3300026023 Ga0207677_10163723 Ga0207677_101637232 349
17 3300026088 Ga0207641_10020002 Ga0207641_100200022 349
18 3300028381 Ga0268264_10160831 Ga0268264_101608312 349
19 3300046616 Ga0495668_0048763 Ga0495668_0048763_539_1630 349
20 iso_pu_bacteria 2939631187 2939634154 353
21 3300005844 Ga0068862_100094164 Ga0068862_1000941643 356
22 3300028380 Ga0268265_10240469 Ga0268265_102404692 356
23 iso_pu_bacteria 2643221654 2644303327 356
24 3300005548 Ga0070665_100056254 Ga0070665_1000562544 357
25 3300028379 Ga0268266_10127051 Ga0268266_101270512 357
26 3300037471 Ga0395905_0015225 Ga0395905_0015225_2101_3210 357
27 3300044712 Ga0453684_0003325 Ga0453684_0003325_27973_29058 357
28 iso_pu_bacteria 2738543013 2739251776 357
29 3300005328 Ga0070676_10005063 Ga0070676_100050633 358
30 3300005331 Ga0070670_100003664 Ga0070670_1000036647 358
31 3300005334 Ga0068869_100035262 Ga0068869_1000352623 358
32 3300005338 Ga0068868_100008183 Ga0068868_1000081833 358
33 3300005347 Ga0070668_100000919 Ga0070668_10000091910 358
34 3300005353 Ga0070669_100010452 Ga0070669_1000104525 358
35 3300005356 Ga0070674_100039600 Ga0070674_1000396002 358
36 3300005456 Ga0070678_100000336 Ga0070678_10000033616 358
37 3300005617 Ga0068859_100030773 Ga0068859_1000307733 358
38 3300005618 Ga0068864_100025201 Ga0068864_1000252012 358
39 3300005841 Ga0068863_100175020 Ga0068863_1001750202 358
40 3300005842 Ga0068858_100022645 Ga0068858_1000226452 358
41 3300005844 Ga0068862_100119070 Ga0068862_1001190703 358
42 3300006195 Ga0075366_10028792 Ga0075366_100287923 358
43 3300006237 Ga0097621_100003111 Ga0097621_1000031115 358
44 3300006358 Ga0068871_100040118 Ga0068871_1000401183 358
45 3300006881 Ga0068865_100010265 Ga0068865_1000102653 358
46 3300006931 Ga0097620_100030775 Ga0097620_1000307754 358
47 3300009553 Ga0105249_10118446 Ga0105249_101184462 358
48 3300013296 Ga0157374_10020129 Ga0157374_100201295 358
49 3300013306 Ga0163162_10050375 Ga0163162_100503753 358
50 3300014968 Ga0157379_10040366 Ga0157379_100403662 358
51 3300017792 Ga0163161_10092023 Ga0163161_100920232 358
52 3300025907 Ga0207645_10000236 Ga0207645_100002368 358
53 3300025925 Ga0207650_10068899 Ga0207650_100688993 358
54 3300025938 Ga0207704_10016277 Ga0207704_100162774 358
55 3300025940 Ga0207691_10000305 Ga0207691_1000030513 358
56 3300025941 Ga0207711_10148815 Ga0207711_101488152 358
57 3300026089 Ga0207648_10001320 Ga0207648_1000132012 358
58 3300026121 Ga0207683_10002510 Ga0207683_1000251014 358
59 3300026121 Ga0207683_10164197 Ga0207683_101641972 358
60 3300028380 Ga0268265_10173300 Ga0268265_101733002 358
61 3300028381 Ga0268264_10016727 Ga0268264_100167273 358
62 3300028794 Ga0307515_10037359 Ga0307515_100373592 358
63 3300030522 Ga0307512_10006418 Ga0307512_100064189 358
64 3300031507 Ga0307509_10000063 Ga0307509_10000063124 358
65 3300031507 Ga0307509_10031514 Ga0307509_100315142 358
66 3300031616 Ga0307508_10000109 Ga0307508_1000010943 358
67 3300033180 Ga0307510_10000429 Ga0307510_1000042912 358
68 3300033180 Ga0307510_10004418 Ga0307510_100044184 358
69 3300033180 Ga0307510_10196440 Ga0307510_101964402 358
70 3300035691 Ga0373931_0037380 Ga0373931_0037380_187_1311 358
71 3300046454 Ga0495592_0000128 Ga0495592_0000128_17152_18276 358
72 3300046680 Ga0495646_0120482 Ga0495646_0120482_28_1122 358
73 3300050493 nmdc:mga0k408_38929_c1 nmdc:mga0k408_38929_c1_587_1675 358
74 3300050493 nmdc:mga0k408_5661_c1 nmdc:mga0k408_5661_c1_2678_3760 358
75 3300053086 Ga0500578_0071960 Ga0500578_0071960_223_1317 358
76 3300053136 Ga0500559_0000013 Ga0500559_0000013_88307_89431 358
77 3300053730 Ga0500645_005276 Ga0500645_005276_1782_2876 358
78 iso_pu_bacteria 2842733646 2842733728 358
79 iso_pu_bacteria 2842747753 2842752234 358
80 iso_pu_bacteria 2928115317 2928118388 358
81 3300005331 Ga0070670_100022222 Ga0070670_1000222225 359
82 3300005364 Ga0070673_100112083 Ga0070673_1001120832 359
83 3300005367 Ga0070667_100018693 Ga0070667_1000186934 359
84 3300005441 Ga0070700_100017743 Ga0070700_1000177435 359
85 3300005456 Ga0070678_100046083 Ga0070678_1000460833 359
86 3300005459 Ga0068867_100005330 Ga0068867_1000053303 359
87 3300005539 Ga0068853_100151328 Ga0068853_1001513282 359
88 3300005543 Ga0070672_100031090 Ga0070672_1000310904 359
89 3300005543 Ga0070672_100065212 Ga0070672_1000652123 359
90 3300005548 Ga0070665_100003283 Ga0070665_10000328312 359
91 3300005718 Ga0068866_10039393 Ga0068866_100393932 359
92 3300005719 Ga0068861_100000811 Ga0068861_1000008113 359
93 3300005834 Ga0068851_10100155 Ga0068851_101001551 359
94 3300005843 Ga0068860_100002168 Ga0068860_10000216812 359
95 3300005844 Ga0068862_100003580 Ga0068862_1000035802 359
96 3300006195 Ga0075366_10035606 Ga0075366_100356062 359
97 3300006237 Ga0097621_100175911 Ga0097621_1001759112 359
98 3300006358 Ga0068871_100049407 Ga0068871_1000494072 359
99 3300006880 Ga0075429_100004508 Ga0075429_1000045089 359
100 3300006881 Ga0068865_100007366 Ga0068865_1000073662 359
101 3300009148 Ga0105243_10221545 Ga0105243_102215452 359
102 3300013297 Ga0157378_10018952 Ga0157378_100189524 359
103 3300013306 Ga0163162_10020951 Ga0163162_100209512 359
104 3300013308 Ga0157375_10103928 Ga0157375_101039282 359
105 3300013308 Ga0157375_10221549 Ga0157375_102215492 359
106 3300014969 Ga0157376_10020812 Ga0157376_100208124 359
107 3300017792 Ga0163161_10041118 Ga0163161_100411182 359
108 3300025899 Ga0207642_10022337 Ga0207642_100223372 359
109 3300025935 Ga0207709_10134423 Ga0207709_101344232 359
110 3300025937 Ga0207669_10034154 Ga0207669_100341543 359
111 3300025938 Ga0207704_10008962 Ga0207704_100089622 359
112 3300025940 Ga0207691_10018128 Ga0207691_100181282 359
113 3300025940 Ga0207691_10028254 Ga0207691_100282542 359
114 3300025972 Ga0207668_10093440 Ga0207668_100934402 359
115 3300025972 Ga0207668_10117786 Ga0207668_101177862 359
116 3300026075 Ga0207708_10047682 Ga0207708_100476822 359
117 3300026089 Ga0207648_10000133 Ga0207648_1000013318 359
118 3300026118 Ga0207675_100000103 Ga0207675_1000001032 359
119 3300026118 Ga0207675_100166915 Ga0207675_1001669152 359
120 3300026121 Ga0207683_10008954 Ga0207683_100089544 359
121 3300028379 Ga0268266_10011562 Ga0268266_100115627 359
122 3300028380 Ga0268265_10046262 Ga0268265_100462622 359
123 3300028786 Ga0307517_10005547 Ga0307517_100055472 359
124 3300028794 Ga0307515_10000751 Ga0307515_1000075149 359
125 3300031456 Ga0307513_10029605 Ga0307513_100296052 359
126 3300031456 Ga0307513_10040954 Ga0307513_100409546 359
127 3300031456 Ga0307513_10075792 Ga0307513_100757922 359
128 3300031616 Ga0307508_10025487 Ga0307508_100254872 359
129 3300031649 Ga0307514_10000763 Ga0307514_100007632 359
130 3300031649 Ga0307514_10057910 Ga0307514_100579102 359
131 3300031731 Ga0307405_10209936 Ga0307405_102099362 359
132 3300033180 Ga0307510_10057703 Ga0307510_100577032 359
133 3300041512 Ga0451853_3036516 Ga0451853_3036516_377_1474 359
134 3300046524 Ga0495648_0054414 Ga0495648_0054414_781_1878 359
135 3300050493 nmdc:mga0k408_6088_c1 nmdc:mga0k408_6088_c1_4991_6079 359
136 3300050508 nmdc:mga09592_1397_c1 nmdc:mga09592_1397_c1_1057_2145 359
137 3300050509 nmdc:mga0qj67_77271_c1 nmdc:mga0qj67_77271_c1_1486_2574 359
138 3300053093 Ga0500651_0093915 Ga0500651_0093915_623_1720 359
139 3300053156 Ga0500622_0005534 Ga0500622_0005534_1462_2559 359
140 iso_pu_bacteria 2513020051 2513230151 359
141 iso_pu_bacteria 2599185214 2599622367 359
142 iso_pu_bacteria 2599185226 2599674541 359
143 iso_pu_bacteria 2599185227 2599680226 359
144 iso_pu_bacteria 2599185229 2599692242 359
145 iso_pu_bacteria 2643221609 2644057376 359
146 iso_pu_bacteria 2643221611 2644072526 359
147 iso_pu_bacteria 2643221628 2644160911 359
148 iso_pu_bacteria 2643221658 2644326492 359
149 iso_pu_bacteria 2643221672 2644396833 359
150 iso_pu_bacteria 2643221683 2644469476 359
151 iso_pu_bacteria 2738541277 2738719399 359
152 iso_pu_bacteria 2738541307 2738883252 359
153 iso_pu_bacteria 2738543019 2739282870 359
154 iso_pu_bacteria 2818991446 2819599055 359
155 iso_pu_bacteria 2831265667 2831270844 359
156 iso_pu_bacteria 2838054893 2838058891 359
157 iso_pu_bacteria 2842677519 2842682207 359
158 iso_pu_bacteria 2842718218 2842722227 359
159 iso_pu_bacteria 2881101125 2881103436 359
160 iso_pu_bacteria 2885192300 2885196496 359
161 iso_pu_bacteria 2885198086 2885202336 359
162 iso_pu_bacteria 2885211737 2885215989 359
163 iso_pu_bacteria 2899924645 2899929882 359
164 iso_pu_bacteria 2904449895 2904451685 359
165 iso_pu_bacteria 2904456579 2904461826 359
166 iso_pu_bacteria 2904541872 2904546556 359
167 iso_pu_bacteria 2919462493 2919464548 359
168 iso_pu_bacteria 2928037797 2928042187 359
169 iso_pu_bacteria 2928044640 2928049956 359
170 iso_pu_bacteria 2928051484 2928054521 359
171 iso_pu_bacteria 2928064002 2928070114 359
172 iso_pu_bacteria 2928070936 2928074272 359
173 iso_pu_bacteria 2928084124 2928086497 359
174 iso_pu_bacteria 2929160207 2929166010 359
175 iso_pu_bacteria 2929520902 2929526607 359
176 iso_pu_bacteria 2945909444 2945915576 359
177 iso_pu_bacteria 2945945610 2945950394 359
178 iso_pu_bacteria 2945972063 2945974962 359
179 iso_pu_bacteria 2945984333 2945989015 359
180 iso_pu_bacteria 2954767861 2954770154 359
181 3300003784 Ga0055534_1002538 Ga0055534_10025384 361
182 3300025294 Ga0209025_1040733 Ga0209025_10407332 361
183 3300025295 Ga0209564_1029076 Ga0209564_10290761 361
184 3300025303 Ga0209051_1010303 Ga0209051_10103035 361
185 3300005353 Ga0070669_100077889 Ga0070669_1000778892 362
186 3300014497 Ga0182008_10000044 Ga0182008_1000004414 362
187 3300048920 Ga0496117_0094659 Ga0496117_0094659_403_1497 362
188 3300048925 Ga0496122_0000272 Ga0496122_0000272_105415_106509 362
189 3300048926 Ga0496123_0000221 Ga0496123_0000221_9158_10252 362
190 3300049671 Ga0501238_004272 Ga0501238_004272_114_1211 362
191 3300053125 Ga0500618_020100 Ga0500618_020100_307_1404 362
192 3300053136 Ga0500559_0009355 Ga0500559_0009355_1984_3081 362
193 3300053140 Ga0500573_0075259 Ga0500573_0075259_201_1295 362
194 3300053723 Ga0500567_074745 Ga0500567_074745_94_1191 362
195 3300003187 JGI25151J46595_10001713 JGI25151J46595_1000171311 363
196 3300003322 rootL2_10045571 rootL2_100455712 363
197 3300003354 JGI25160J50197_1009257 JGI25160J50197_10092574 363
198 3300003354 JGI25160J50197_1018680 JGI25160J50197_10186802 363
199 3300003374 JGI25161J50226_1002128 JGI25161J50226_10021283 363
200 3300003374 JGI25161J50226_1008245 JGI25161J50226_10082451 363
201 3300003578 Ga0006562J51391_1073558 Ga0006562J51391_10735582 363
202 3300003578 Ga0006562J51391_1073560 Ga0006562J51391_10735603 363
203 3300003578 Ga0006562J51391_1118001 Ga0006562J51391_11180013 363
204 3300003578 Ga0006562J51391_1118005 Ga0006562J51391_11180052 363
205 3300003761 Ga0055535_1000067 Ga0055535_100006786 363
206 3300003762 Ga0055542_1000013 Ga0055542_1000013110 363
207 3300003771 Ga0055526_1013304 Ga0055526_10133043 363
208 3300003771 Ga0055526_1017090 Ga0055526_10170902 363
209 3300003773 Ga0055537_1000133 Ga0055537_100013335 363
210 3300003773 Ga0055537_1012702 Ga0055537_10127022 363
211 3300003775 Ga0055524_1010497 Ga0055524_10104973 363
212 3300003775 Ga0055524_1013052 Ga0055524_10130523 363
213 3300003781 Ga0055536_1014877 Ga0055536_10148772 363
214 3300003781 Ga0055536_1016508 Ga0055536_10165082 363
215 3300003784 Ga0055534_1000037 Ga0055534_100003751 363
216 3300003784 Ga0055534_1006055 Ga0055534_10060552 363
217 3300003790 Ga0055528_1000640 Ga0055528_10006403 363
218 3300003790 Ga0055528_1027060 Ga0055528_10270602 363
219 3300003791 Ga0055530_10014022 Ga0055530_100140222 363
220 3300003791 Ga0055530_10015635 Ga0055530_100156352 363
221 3300003792 Ga0055540_1001539 Ga0055540_100153911 363
222 3300003792 Ga0055540_1012289 Ga0055540_10122892 363
223 3300003792 Ga0055540_1019378 Ga0055540_10193781 363
224 3300003794 Ga0055531_10019830 Ga0055531_100198302 363
225 3300004625 Ga0055543_1002352 Ga0055543_10023523 363
226 3300005262 Ga0065165_1018203 Ga0065165_10182032 363
227 3300005262 Ga0065165_1022160 Ga0065165_10221602 363
228 3300005262 Ga0065165_1037358 Ga0065165_10373581 363
229 3300005288 Ga0065714_10003828 Ga0065714_100038283 363
230 3300005335 Ga0070666_10192868 Ga0070666_101928682 363
231 3300005366 Ga0070659_100058772 Ga0070659_1000587722 363
232 3300005539 Ga0068853_100020634 Ga0068853_1000206343 363
233 3300005548 Ga0070665_100021424 Ga0070665_1000214245 363
234 3300005563 Ga0068855_100051155 Ga0068855_1000511552 363
235 3300005564 Ga0070664_100051041 Ga0070664_1000510414 363
236 3300005616 Ga0068852_100069274 Ga0068852_1000692742 363
237 3300005616 Ga0068852_100272656 Ga0068852_1002726562 363
238 3300005844 Ga0068862_100118017 Ga0068862_1001180172 363
239 3300006038 Ga0075365_10061174 Ga0075365_100611742 363
240 3300006038 Ga0075365_10163322 Ga0075365_101633222 363
241 3300006048 Ga0075363_100061914 Ga0075363_1000619142 363
242 3300006051 Ga0075364_10014010 Ga0075364_100140103 363
243 3300006058 Ga0075432_10017388 Ga0075432_100173882 363
244 3300006177 Ga0075362_10011131 Ga0075362_100111313 363
245 3300006177 Ga0075362_10011457 Ga0075362_100114573 363
246 3300006186 Ga0075369_10041292 Ga0075369_100412922 363
247 3300006195 Ga0075366_10008874 Ga0075366_100088744 363
248 3300006195 Ga0075366_10021139 Ga0075366_100211393 363
249 3300006237 Ga0097621_100075214 Ga0097621_1000752142 363
250 3300006353 Ga0075370_10000919 Ga0075370_100009199 363
251 3300006353 Ga0075370_10017242 Ga0075370_100172422 363
252 3300006358 Ga0068871_100025580 Ga0068871_1000255802 363
253 3300006948 Ga0099826_10000321 Ga0099826_1000032113 363
254 3300009093 Ga0105240_10113347 Ga0105240_101133474 363
255 3300009148 Ga0105243_10000499 Ga0105243_1000049920 363
256 3300009148 Ga0105243_10002576 Ga0105243_1000257611 363
257 3300009176 Ga0105242_10075403 Ga0105242_100754033 363
258 3300009176 Ga0105242_10315314 Ga0105242_103153142 363
259 3300009545 Ga0105237_10026284 Ga0105237_100262843 363
260 3300009545 Ga0105237_10305880 Ga0105237_103058802 363
261 3300009551 Ga0105238_10094135 Ga0105238_100941352 363
262 3300009551 Ga0105238_10169183 Ga0105238_101691832 363
263 3300010375 Ga0105239_10094415 Ga0105239_100944152 363
264 3300012502 Ga0157347_1000469 Ga0157347_10004692 363
265 3300012505 Ga0157339_1000371 Ga0157339_10003711 363
266 3300013100 Ga0157373_10004187 Ga0157373_100041878 363
267 3300013102 Ga0157371_10111375 Ga0157371_101113752 363
268 3300013104 Ga0157370_10016616 Ga0157370_100166162 363
269 3300013104 Ga0157370_10141011 Ga0157370_101410112 363
270 3300013307 Ga0157372_10024904 Ga0157372_100249043 363
271 3300014326 Ga0157380_10238951 Ga0157380_102389512 363
272 3300014497 Ga0182008_10002962 Ga0182008_100029624 363
273 3300014497 Ga0182008_10007562 Ga0182008_100075624 363
274 3300014497 Ga0182008_10038105 Ga0182008_100381052 363
275 3300014969 Ga0157376_10126501 Ga0157376_101265012 363
276 3300015261 Ga0182006_1001273 Ga0182006_10012739 363
277 3300015261 Ga0182006_1009601 Ga0182006_10096013 363
278 3300015261 Ga0182006_1073607 Ga0182006_10736071 363
279 3300015262 Ga0182007_10000443 Ga0182007_1000044313 363
280 3300015262 Ga0182007_10005744 Ga0182007_100057444 363
281 3300015683 Ga0183362_10005 Ga0183362_1000529 363
282 3300017792 Ga0163161_10000304 Ga0163161_100003043 363
283 3300017792 Ga0163161_10001502 Ga0163161_100015023 363
284 3300017792 Ga0163161_10057152 Ga0163161_100571523 363
285 3300025228 Ga0209672_102789 Ga0209672_1027893 363
286 3300025229 Ga0209147_100437 Ga0209147_10043718 363
287 3300025242 Ga0209258_100020 Ga0209258_100020265 363
288 3300025245 Ga0207425_1000201 Ga0207425_100020141 363
289 3300025245 Ga0207425_1006498 Ga0207425_10064983 363
290 3300025254 Ga0209148_1000031 Ga0209148_1000031265 363
291 3300025258 Ga0209129_1000055 Ga0209129_1000055134 363
292 3300025258 Ga0209129_1006290 Ga0209129_10062903 363
293 3300025258 Ga0209129_1006971 Ga0209129_10069713 363
294 3300025258 Ga0209129_1017186 Ga0209129_10171861 363
295 3300025263 Ga0209565_1000131 Ga0209565_100013147 363
296 3300025263 Ga0209565_1000795 Ga0209565_10007953 363
297 3300025273 Ga0209673_1000170 Ga0209673_100017047 363
298 3300025273 Ga0209673_1001892 Ga0209673_100189211 363
299 3300025284 Ga0209130_1000214 Ga0209130_100021424 363
300 3300025284 Ga0209130_1003075 Ga0209130_10030754 363
301 3300025291 Ga0209675_1000055 Ga0209675_100005547 363
302 3300025291 Ga0209675_1000956 Ga0209675_100095619 363
303 3300025291 Ga0209675_1008025 Ga0209675_10080253 363
304 3300025291 Ga0209675_1014260 Ga0209675_10142602 363
305 3300025291 Ga0209675_1014803 Ga0209675_10148032 363
306 3300025292 Ga0209676_1000040 Ga0209676_1000040166 363
307 3300025292 Ga0209676_1000346 Ga0209676_100034643 363
308 3300025292 Ga0209676_1000508 Ga0209676_100050817 363
309 3300025292 Ga0209676_1026210 Ga0209676_10262102 363
310 3300025294 Ga0209025_1000065 Ga0209025_100006556 363
311 3300025294 Ga0209025_1000145 Ga0209025_1000145148 363
312 3300025294 Ga0209025_1000510 Ga0209025_100051043 363
313 3300025294 Ga0209025_1009929 Ga0209025_10099293 363
314 3300025294 Ga0209025_1025679 Ga0209025_10256792 363
315 3300025295 Ga0209564_1000254 Ga0209564_100025420 363
316 3300025295 Ga0209564_1000410 Ga0209564_100041024 363
317 3300025295 Ga0209564_1035295 Ga0209564_10352952 363
318 3300025297 Ga0209758_1000042 Ga0209758_1000042226 363
319 3300025297 Ga0209758_1008609 Ga0209758_10086093 363
320 3300025297 Ga0209758_1019144 Ga0209758_10191442 363
321 3300025298 Ga0209050_1000021 Ga0209050_1000021227 363
322 3300025298 Ga0209050_1001781 Ga0209050_10017815 363
323 3300025298 Ga0209050_1008810 Ga0209050_10088103 363
324 3300025299 Ga0209256_1000056 Ga0209256_100005646 363
325 3300025299 Ga0209256_1000148 Ga0209256_100014824 363
326 3300025302 Ga0207426_1000055 Ga0207426_1000055105 363
327 3300025302 Ga0207426_1000079 Ga0207426_1000079225 363
328 3300025303 Ga0209051_1000028 Ga0209051_1000028285 363
329 3300025303 Ga0209051_1000126 Ga0209051_100012655 363
330 3300025303 Ga0209051_1000284 Ga0209051_100028440 363
331 3300025303 Ga0209051_1000358 Ga0209051_100035842 363
332 3300025303 Ga0209051_1010805 Ga0209051_10108052 363
333 3300025304 Ga0209257_1000043 Ga0209257_1000043222 363
334 3300025304 Ga0209257_1000214 Ga0209257_100021441 363
335 3300025304 Ga0209257_1001556 Ga0209257_100155626 363
336 3300025304 Ga0209257_1010482 Ga0209257_10104822 363
337 3300025321 Ga0207656_10012292 Ga0207656_100122921 363
338 3300025728 Ga0207655_1003314 Ga0207655_10033143 363
339 3300025903 Ga0207680_10132557 Ga0207680_101325572 363
340 3300025913 Ga0207695_10115296 Ga0207695_101152962 363
341 3300025924 Ga0207694_10009874 Ga0207694_100098746 363
342 3300025932 Ga0207690_10162368 Ga0207690_101623682 363
343 3300025933 Ga0207706_10021667 Ga0207706_100216674 363
344 3300025935 Ga0207709_10000808 Ga0207709_100008083 363
345 3300025935 Ga0207709_10003613 Ga0207709_100036135 363
346 3300025945 Ga0207679_10038155 Ga0207679_100381551 363
347 3300026041 Ga0207639_10204713 Ga0207639_102047131 363
348 3300026116 Ga0207674_10177500 Ga0207674_101775002 363
349 3300026121 Ga0207683_10329121 Ga0207683_103291212 363
350 3300027666 Ga0209282_1001228 Ga0209282_10012289 363
351 3300028379 Ga0268266_10008782 Ga0268266_100087822 363
352 3300028380 Ga0268265_10029375 Ga0268265_100293753 363
353 3300028794 Ga0307515_10007523 Ga0307515_1000752316 363
354 3300030731 Ga0316177_1015726 Ga0316177_10157264 363
355 3300030736 Ga0316180_1005341 Ga0316180_10053413 363
356 3300030745 Ga0316182_1173054 Ga0316182_11730542 363
357 3300031251 Ga0265327_10002512 Ga0265327_1000251217 363
358 3300031456 Ga0307513_10000034 Ga0307513_10000034172 363
359 3300031456 Ga0307513_10045022 Ga0307513_100450225 363
360 3300031548 Ga0307408_100012658 Ga0307408_1000126582 363
361 3300031548 Ga0307408_100043941 Ga0307408_1000439413 363
362 3300031548 Ga0307408_100235662 Ga0307408_1002356622 363
363 3300031649 Ga0307514_10028862 Ga0307514_100288622 363
364 3300031731 Ga0307405_10034098 Ga0307405_100340982 363
365 3300031731 Ga0307405_10119105 Ga0307405_101191052 363
366 3300031901 Ga0307406_10003676 Ga0307406_100036763 363
367 3300031901 Ga0307406_10227817 Ga0307406_102278172 363
368 3300031911 Ga0307412_10005992 Ga0307412_100059925 363
369 3300031911 Ga0307412_10076286 Ga0307412_100762862 363
370 3300032002 Ga0307416_100228291 Ga0307416_1002282912 363
371 3300032004 Ga0307414_10151425 Ga0307414_101514251 363
372 3300032005 Ga0307411_10067102 Ga0307411_100671022 363
373 3300041404 Ga0439436_0006751 Ga0439436_0006751_81_1175 363
374 3300041404 Ga0439436_0006829 Ga0439436_0006829_880_1974 363
375 3300041405 Ga0439438_019317 Ga0439438_019317_258_1382 363
376 3300041407 Ga0439447_009073 Ga0439447_009073_1891_2988 363
377 3300041411 Ga0439466_0024889 Ga0439466_0024889_949_2046 363
378 3300041411 Ga0439466_0046064 Ga0439466_0046064_21_1115 363
379 3300041413 Ga0439465_0004902 Ga0439465_0004902_1248_2342 363
380 3300041413 Ga0439465_0021898 Ga0439465_0021898_574_1668 363
381 3300042002 Ga0439442_002289 Ga0439442_002289_1134_2225 363
382 3300042002 Ga0439442_015877 Ga0439442_015877_334_1428 363
383 3300042006 Ga0439432_008759 Ga0439432_008759_491_1582 363
384 3300042006 Ga0439432_030026 Ga0439432_030026_501_1595 363
385 3300042007 Ga0439449_0006570 Ga0439449_0006570_1785_2879 363
386 3300042010 Ga0439452_011201 Ga0439452_011201_1231_2325 363
387 3300042145 Ga0450906_000679 Ga0450906_000679_4181_5275 363
388 3300042147 Ga0450910_004207 Ga0450910_004207_396_1490 363
389 3300042184 Ga0450908_001090 Ga0450908_001090_2239_3333 363
390 3300042435 Ga0439434_0000981 Ga0439434_0000981_2425_3519 363
391 3300042435 Ga0439434_0017455 Ga0439434_0017455_152_1243 363
392 3300042531 Ga0450918_000783 Ga0450918_000783_1049_2143 363
393 3300046506 Ga0495583_0025085 Ga0495583_0025085_270_1364 363
394 3300046513 Ga0495616_0001425 Ga0495616_0001425_10498_11592 363
395 3300046515 Ga0495620_0031725 Ga0495620_0031725_1168_2262 363
396 3300046515 Ga0495620_0100650 Ga0495620_0100650_22_1116 363
397 3300046518 Ga0495631_0000096 Ga0495631_0000096_43908_45002 363
398 3300046520 Ga0495637_0010529 Ga0495637_0010529_1917_3011 363
399 3300046525 Ga0495663_0025904 Ga0495663_0025904_278_1378 363
400 3300046530 Ga0495654_0009804 Ga0495654_0009804_1947_3041 363
401 3300046530 Ga0495654_0041347 Ga0495654_0041347_269_1363 363
402 3300046539 Ga0495621_0008190 Ga0495621_0008190_837_1937 363
403 3300046615 Ga0495656_0000081 Ga0495656_0000081_23680_24780 363
404 3300046660 Ga0495625_0000136 Ga0495625_0000136_46133_47227 363
405 3300046674 Ga0495588_0133200 Ga0495588_0133200_178_1272 363
406 3300046683 Ga0495658_0028122 Ga0495658_0028122_312_1406 363
407 3300046691 Ga0495670_0057923 Ga0495670_0057923_188_1288 363
408 3300046692 Ga0495671_0007334 Ga0495671_0007334_1876_2970 363
409 3300047321 Ga0495676_0070618 Ga0495676_0070618_825_1919 363
410 3300047673 Ga0495593_0021901 Ga0495593_0021901_1243_2337 363
411 3300048090 Ga0495615_0001453 Ga0495615_0001453_485_1585 363
412 3300048908 Ga0496105_0093402 Ga0496105_0093402_571_1665 363
413 3300048909 Ga0496106_0036585 Ga0496106_0036585_447_1541 363
414 3300048919 Ga0496116_0062314 Ga0496116_0062314_691_1785 363
415 3300048920 Ga0496117_0010975 Ga0496117_0010975_4503_5597 363
416 3300048920 Ga0496117_0039090 Ga0496117_0039090_596_1690 363
417 3300048921 Ga0496118_0023039 Ga0496118_0023039_2208_3302 363
418 3300048921 Ga0496118_0035539 Ga0496118_0035539_818_1912 363
419 3300048924 Ga0496121_0166207 Ga0496121_0166207_204_1298 363
420 3300048925 Ga0496122_0064215 Ga0496122_0064215_187_1281 363
421 3300048926 Ga0496123_0056961 Ga0496123_0056961_987_2114 363
422 3300048926 Ga0496123_0057267 Ga0496123_0057267_1059_2153 363
423 3300048927 Ga0496124_0022284 Ga0496124_0022284_2228_3322 363
424 3300048928 Ga0496125_0014247 Ga0496125_0014247_4233_5327 363
425 3300048928 Ga0496125_0018169 Ga0496125_0018169_3476_4570 363
426 3300048928 Ga0496125_0064869 Ga0496125_0064869_1302_2396 363
427 3300048928 Ga0496125_0072862 Ga0496125_0072862_1031_2125 363
428 3300048929 Ga0496126_0058804 Ga0496126_0058804_1593_2687 363
429 3300049759 Ga0501262_000324 Ga0501262_000324_271_1365 363
430 3300050489 nmdc:mga03683_37143_c1 nmdc:mga03683_37143_c1_155_1255 363
431 3300050490 nmdc:mga03n38_55071_c1 nmdc:mga03n38_55071_c1_603_1727 363
432 3300050491 nmdc:mga00v17_35549_c1 nmdc:mga00v17_35549_c1_1399_2493 363
433 3300050492 nmdc:mga0yw44_45408_c1 nmdc:mga0yw44_45408_c1_1061_2155 363
434 3300050493 nmdc:mga0k408_30922_c1 nmdc:mga0k408_30922_c1_1929_3023 363
435 3300050493 nmdc:mga0k408_8852_c1 nmdc:mga0k408_8852_c1_946_2037 363
436 3300050496 nmdc:mga07m45_3584_c1 nmdc:mga07m45_3584_c1_3380_4474 363
437 3300050496 nmdc:mga07m45_453_c1 nmdc:mga07m45_453_c1_218_1318 363
438 3300050496 nmdc:mga07m45_816_c1 nmdc:mga07m45_816_c1_5214_6305 363
439 3300053079 Ga0500610_0044491 Ga0500610_0044491_599_1693 363
440 3300053087 Ga0500643_013117 Ga0500643_013117_1388_2482 363
441 3300053093 Ga0500651_0000435 Ga0500651_0000435_20826_21920 363
442 3300053093 Ga0500651_0017782 Ga0500651_0017782_2837_3934 363
443 3300053110 Ga0500571_000144 Ga0500571_000144_21235_22329 363
444 3300053117 Ga0500593_000531 Ga0500593_000531_2121_3215 363
445 3300053121 Ga0500607_001041 Ga0500607_001041_11849_12943 363
446 3300053121 Ga0500607_026267 Ga0500607_026267_194_1297 363
447 3300053122 Ga0500608_004107 Ga0500608_004107_2077_3171 363
448 3300053133 Ga0500655_000695 Ga0500655_000695_3660_4754 363
449 3300053136 Ga0500559_0012808 Ga0500559_0012808_934_2028 363
450 3300053138 Ga0500564_014792 Ga0500564_014792_1704_2798 363
451 3300053139 Ga0500568_0000552 Ga0500568_0000552_11086_12180 363
452 3300053153 Ga0500616_0007237 Ga0500616_0007237_4553_5647 363
453 3300053158 Ga0500627_0009744 Ga0500627_0009744_225_1319 363
454 3300053177 Ga0500636_0035198 Ga0500636_0035198_379_1473 363

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10994

DUF2817

Protein of unknown function (DUF2817)

8

350

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3osl-assembly2.cif.gz_C structure of bovine thrombin-activatable fibrinolysis inhibitor in complex with tick carboxypeptidase inhibitor 0.6464 3 362
3osl-assembly2.cif.gz_C structure of bovine thrombin-activatable fibrinolysis inhibitor in complex with tick carboxypeptidase inhibitor 0.6372 3 362
3cdx-assembly1.cif.gz_B crystal structure of succinylglutamatedesuccinylase/aspartoacylase from rhodobacter sphaeroides 0.6327 28 315
1kwm-assembly2.cif.gz_B human procarboxypeptidase b: three-dimensional structure and implications for thrombin-activatable fibrinolysis inhibitor (tafi) 0.6287 11 360
7eqz-assembly1.cif.gz_A crystal structure of carboxypeptidase b complexed with potato carboxypeptidase inhibitor 0.6019 3 334
ID Description Score Start End Superfamily
af_Q4DHE8_197_395_3.40.50.1580 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.8653 159 363 3.40.50.1580
af_A4I5X8_46_304_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.854 7 261 3.40.630.10
af_A4I5X8_46_304_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8389 7 261 3.40.630.10
af_Q4DHE8_197_395_3.40.50.1580 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.8372 159 363 3.40.50.1580
3c6kC01 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Sirohaem synthase, central domain 0.7048 13 50 3.30.160.110
ID Description Score Start End GO Terms
AF-A0A4R1ZBL6-F1-model_v4 deleted 0.996 1 362
AF-A0A4R1ZBL6-F1-model_v4 deleted 0.9905 1 362
AF-A0A3C0KBQ4-F1-model_v4 DUF2817 domain-containing protein 0.989 74 362
AF-A0A4Q5UU83-F1-model_v4 deleted 0.9823 122 362
AF-A0A4Q5VDQ7-F1-model_v4 deleted 0.982 102 362

Feature Viewer

pLDDT pTM Quality
95.3 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map