F447182

General Info

Members Datasets Scaffolds Average Seq Length
453 305 906 322

Family's Representative Sequence

Representative Sequence 3300011119|Ga0105246_10075042|Ga0105246_100750423
Length 337
Sequence MIAAPFHAGERALQALAGSREQMEVAGPRVIRDYMPDQHREFFGLLPFLVVGSLDADMQPWASVLAAPAGFAHSPDATHLRVDALPASGDPLVGQLKQGATLGLLGIQPHTRRRNRMNGTVEALDDAGFMVAVQQSFGNCPRYIQAREPVFVSPRADAAPQAQWLDKLDLAAHRLIGSADTLFIATAYPNEVAAGDEADASSHGVDVSHRGGRPGFVRVDGDDVLTVPDFNGNRFFNTLGNLAAHPRAGLLFVDFDSGDLLHVAVTAEIIWDGPEVAEFEGAERLMRFHVTHALRRPGALPLRWGDAQLSPHLAGTGQWNTGMRPLTDGRYLQPRRR

Samples

Sample ID Description Type Environment
1 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
14 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
15 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
16 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
17 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
18 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
25 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
30 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
31 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
47 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
57 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
58 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
59 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
62 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
63 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
71 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
72 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
73 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
76 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
77 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
83 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
85 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
88 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
107 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
108 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
109 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
110 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
111 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
112 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
113 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
114 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
115 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
118 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
133 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
134 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
135 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
136 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
137 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
138 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
139 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
140 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
141 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
142 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
143 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
144 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
145 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
146 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
147 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
148 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
149 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
150 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
151 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
152 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
153 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
154 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
155 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
156 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
157 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
158 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
159 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
160 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
161 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
162 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
163 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
164 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
165 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
166 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
167 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
168 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
169 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
170 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
173 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
174 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
175 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
176 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
179 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
180 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
181 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
182 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
183 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
184 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
185 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
186 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
187 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
188 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
189 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
190 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
191 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
192 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
193 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
194 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
195 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
196 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
197 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
198 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
199 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
200 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
211 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
212 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
213 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
214 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
215 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
216 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
217 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
218 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
219 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
220 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
221 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
222 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
223 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
224 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
225 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
226 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
227 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
228 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
229 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
230 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
231 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
232 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
233 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
234 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
235 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
236 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
237 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
238 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
239 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
240 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
241 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
242 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
243 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
244 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
245 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
246 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
247 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
248 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
249 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
250 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
251 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
252 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
253 2547132374 Acidovorax radicis N35 Isolate Unclassified
254 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
255 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
256 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
257 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
258 2643221570 Acidovorax sp. Root568 Isolate Unclassified
259 2643221596 Acidovorax sp. Root70 Isolate Unclassified
260 2643221609 Acidovorax sp. Root217 Isolate Unclassified
261 2643221611 Acidovorax sp. Root219 Isolate Unclassified
262 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
263 2643221652 Acidovorax sp. Root402 Isolate Unclassified
264 2643221658 Variovorax sp. Root411 Isolate Unclassified
265 2643221672 Variovorax sp. Root434 Isolate Unclassified
266 2643221683 Variovorax sp. Root473 Isolate Unclassified
267 2643221717 Acidovorax sp. Root267 Isolate Unclassified
268 2738541277 Variovorax sp. GV051 Isolate Unclassified
269 2738541307 Variovorax sp. GV008 Isolate Unclassified
270 2738543012 Acidovorax sp. CF301 Isolate Unclassified
271 2738543019 Variovorax sp. GV040 Isolate Unclassified
272 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
273 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
274 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
275 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
276 2816332133 Acidovorax radicis 2721A Isolate Unclassified
277 2818991446 Variovorax sp. 1180 Isolate Unclassified
278 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
279 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
280 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
281 2842677519 Variovorax sp. R-72495 Isolate Unclassified
282 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
283 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
284 2885198086 Variovorax sp. 679 Isolate Unclassified
285 2885211737 Variovorax sp. 553 Isolate Unclassified
286 2899924645 Variovorax sp. 369 Isolate Unclassified
287 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
288 2904456579 Variovorax sp. 2002 Isolate Unclassified
289 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
290 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
291 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
292 2928037797 Variovorax sp. 1126 Isolate Unclassified
293 2928044640 Variovorax sp. 1128 Isolate Unclassified
294 2928051484 Variovorax sp. 1133 Isolate Unclassified
295 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
296 2928070936 Variovorax gossypii 1167 Isolate Unclassified
297 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
298 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
299 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
300 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
301 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
302 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
303 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
304 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
305 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.64
Metatranscriptomes 0.44
Isolates 11.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 32.89
Nodule 1.1
Rhizoplane 3.09
Rhizosphere 47.24
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105246_10075042 3300011119 Bacteria 2393
2 JGI25155J39150_1000028 3300002704 Bacteria 120158
3 JGI25156J39149_1000013 3300002705 Bacteria 189553
4 JGI25154J39366_1000032 3300002738 Bacteria 189265
5 JGI25157J39369_1000017 3300002741 Bacteria 189553
6 JGI25152J39213_1001106 3300002773 Bacteria 12601
7 JGI25150J39212_1001012 3300002774 Bacteria 8708
8 JGI25159J45721_1001198 3300002987 Bacteria 11051
9 JGI25151J46595_10000883 3300003187 Bacteria 23609
10 JGI25151J46595_10002047 3300003187 Bacteria 12601
11 JGI25151J46595_10002763 3300003187 Bacteria 10200
12 JGI25153J46596_10001835 3300003215 Bacteria 12601
13 rootL2_10134231 3300003322 Bacteria 4193
14 rootL2_10240349 3300003322 Bacteria 2543
15 JGI25160J50197_1001298 3300003354 Bacteria 12618
16 Ga0006562J51391_1045635 3300003578 Bacteria 4470
17 Ga0006562J51391_1064821 3300003578 Bacteria 5600
18 Ga0055538_1000024 3300003751 Bacteria 241526
19 Ga0055539_1000031 3300003752 Bacteria 241526
20 Ga0055533_1000041 3300003756 Bacteria 241526
21 Ga0055525_1000049 3300003759 Bacteria 241526
22 Ga0055535_1000168 3300003761 Bacteria 70666
23 Ga0055542_1000214 3300003762 Bacteria 70682
24 Ga0055526_1002429 3300003771 Bacteria 12622
25 Ga0055526_1005492 3300003771 Bacteria 7269
26 Ga0055526_1006538 3300003771 Bacteria 6300
27 Ga0055537_1000305 3300003773 Bacteria 33931
28 Ga0055537_1001029 3300003773 Bacteria 12601
29 Ga0055524_1001609 3300003775 Bacteria 12622
30 Ga0055524_1002977 3300003775 Bacteria 8425
31 Ga0055536_1001754 3300003781 Bacteria 12787
32 Ga0055536_1005849 3300003781 Bacteria 5908
33 Ga0055536_1017611 3300003781 Bacteria 2329
34 Ga0055534_1000234 3300003784 Bacteria 39867
35 Ga0055534_1000982 3300003784 Bacteria 12601
36 Ga0055534_1011129 3300003784 Bacteria 1845
37 Ga0055528_1001224 3300003790 Bacteria 16413
38 Ga0055528_1001736 3300003790 Bacteria 12601
39 Ga0055530_10001795 3300003791 Bacteria 14893
40 Ga0055530_10005148 3300003791 Bacteria 6376
41 Ga0055540_1001332 3300003792 Bacteria 14893
42 Ga0055540_1001840 3300003792 Bacteria 11959
43 Ga0055540_1002449 3300003792 Bacteria 9791
44 Ga0055540_1004792 3300003792 Bacteria 5950
45 Ga0055531_10002526 3300003794 Bacteria 12171
46 Ga0055531_10002597 3300003794 Bacteria 11963
47 Ga0055531_10007581 3300003794 Bacteria 5883
48 Ga0055541_1000022 3300003841 Bacteria 241526
49 Ga0055543_1001003 3300004625 Bacteria 12660
50 Ga0055543_1005841 3300004625 Bacteria 3077
51 Ga0065165_1003033 3300005262 Bacteria 12639
52 Ga0070673_100041529 3300005364 Bacteria 3539
53 Ga0070667_100020414 3300005367 Bacteria 5500
54 Ga0070667_100348532 3300005367 Bacteria 1340
55 Ga0068853_100438622 3300005539 Bacteria 1227
56 Ga0068855_100288524 3300005563 Bacteria 1820
57 Ga0070664_100008135 3300005564 Bacteria 8478
58 Ga0068851_10021308 3300005834 Bacteria 3146
59 Ga0068860_100041455 3300005843 Bacteria 4397
60 Ga0068862_100014356 3300005844 Bacteria 6571
61 Ga0075365_10015660 3300006038 Bacteria 4592
62 Ga0075363_100014075 3300006048 Bacteria 3897
63 Ga0075362_10026241 3300006177 Bacteria 2486
64 Ga0075362_10035701 3300006177 Bacteria 2172
65 Ga0075366_10005987 3300006195 Bacteria 6623
66 Ga0075366_10010525 3300006195 Bacteria 5194
67 Ga0097621_100197659 3300006237 Bacteria 1744
68 Ga0075370_10005932 3300006353 Bacteria 6111
69 Ga0075370_10007820 3300006353 Bacteria 5467
70 Ga0099826_10002383 3300006948 Bacteria 12094
71 Ga0099826_10089051 3300006948 Bacteria 1894
72 Ga0105244_10002051 3300009036 Bacteria 15521
73 Ga0105240_10066409 3300009093 Bacteria 4475
74 Ga0105240_10294099 3300009093 Bacteria 1860
75 Ga0105243_10002507 3300009148 Bacteria 15321
76 Ga0105243_10005210 3300009148 Bacteria 10169
77 Ga0105243_10015663 3300009148 Bacteria 5732
78 Ga0105237_10020172 3300009545 Bacteria 6880
79 Ga0105237_10293607 3300009545 Bacteria 1628
80 Ga0105238_10064609 3300009551 Bacteria 3659
81 Ga0105238_10151254 3300009551 Bacteria 2296
82 Ga0105246_10006019 3300011119 Bacteria 7408
83 Ga0105246_10074092 3300011119 Bacteria 2405
84 Ga0157373_10013280 3300013100 Bacteria 6044
85 Ga0157373_10074129 3300013100 Bacteria 2401
86 Ga0157371_10016898 3300013102 Bacteria 5433
87 Ga0157370_10005706 3300013104 Bacteria 13913
88 Ga0157370_10125705 3300013104 Bacteria 2393
89 Ga0157369_10086190 3300013105 Bacteria 3354
90 Ga0157369_10619027 3300013105 Bacteria 1117
91 Ga0182008_10052092 3300014497 Bacteria 2029
92 Ga0182006_1000723 3300015261 Bacteria 22740
93 Ga0182006_1010379 3300015261 Bacteria 4143
94 Ga0182007_10002435 3300015262 Bacteria 9271
95 Ga0183362_10005 3300015683 Bacteria 437616
96 Ga0163161_10000142 3300017792 Bacteria 66331
97 Ga0163161_10010518 3300017792 Bacteria 6408
98 Ga0163161_10011859 3300017792 Bacteria 6047
99 Ga0163161_10057044 3300017792 Bacteria 2837
100 Ga0163161_10103619 3300017792 Bacteria 2120
101 Ga0213872_10002070 3300021361 Bacteria 12138
102 Ga0209435_100003 3300025206 Bacteria 669534
103 Ga0209784_100018 3300025224 Bacteria 456816
104 Ga0209566_100016 3300025225 Bacteria 456824
105 Ga0209674_100030 3300025226 Bacteria 456824
106 Ga0209672_100978 3300025228 Bacteria 12631
107 Ga0209147_101185 3300025229 Bacteria 10605
108 Ga0209563_100034 3300025230 Bacteria 456824
109 Ga0209258_100015 3300025242 Bacteria 706310
110 Ga0207425_1000277 3300025245 Bacteria 37728
111 Ga0207425_1001847 3300025245 Bacteria 8178
112 Ga0209646_1000008 3300025246 Bacteria 669534
113 Ga0209026_1000007 3300025250 Bacteria 669534
114 Ga0209677_100019 3300025253 Bacteria 456824
115 Ga0209148_1000183 3300025254 Bacteria 122620
116 Ga0209759_1000026 3300025256 Bacteria 311743
117 Ga0209129_1000049 3300025258 Bacteria 268086
118 Ga0209129_1005183 3300025258 Bacteria 4737
119 Ga0209565_1000108 3300025263 Bacteria 120719
120 Ga0209565_1000356 3300025263 Bacteria 39995
121 Ga0209565_1005774 3300025263 Bacteria 3554
122 Ga0209565_1005781 3300025263 Bacteria 3551
123 Ga0209673_1000386 3300025273 Bacteria 79438
124 Ga0209673_1000842 3300025273 Bacteria 39995
125 Ga0209673_1000949 3300025273 Bacteria 36252
126 Ga0209130_1000200 3300025284 Bacteria 81072
127 Ga0209130_1003564 3300025284 Bacteria 6515
128 Ga0209675_1000163 3300025291 Bacteria 81884
129 Ga0209675_1000477 3300025291 Bacteria 30525
130 Ga0209675_1001619 3300025291 Bacteria 12658
131 Ga0209675_1002584 3300025291 Bacteria 9189
132 Ga0209675_1003725 3300025291 Bacteria 7080
133 Ga0209676_1000137 3300025292 Bacteria 179437
134 Ga0209676_1000385 3300025292 Bacteria 81044
135 Ga0209676_1002400 3300025292 Bacteria 13396
136 Ga0209676_1002529 3300025292 Bacteria 12751
137 Ga0209025_1000290 3300025294 Bacteria 113067
138 Ga0209025_1000360 3300025294 Bacteria 97454
139 Ga0209025_1000704 3300025294 Bacteria 56939
140 Ga0209025_1004562 3300025294 Bacteria 11916
141 Ga0209025_1020049 3300025294 Bacteria 3680
142 Ga0209025_1024245 3300025294 Bacteria 3138
143 Ga0209564_1000232 3300025295 Bacteria 122080
144 Ga0209564_1000303 3300025295 Bacteria 97431
145 Ga0209758_1000135 3300025297 Bacteria 177753
146 Ga0209050_1000015 3300025298 Bacteria 759102
147 Ga0209050_1000681 3300025298 Bacteria 51157
148 Ga0209256_1000129 3300025299 Bacteria 163766
149 Ga0209256_1000224 3300025299 Bacteria 104436
150 Ga0207426_1000171 3300025302 Bacteria 163766
151 Ga0207426_1000185 3300025302 Bacteria 154146
152 Ga0209051_1000010 3300025303 Bacteria 641298
153 Ga0209051_1000137 3300025303 Bacteria 137784
154 Ga0209051_1000571 3300025303 Bacteria 44685
155 Ga0209051_1000773 3300025303 Bacteria 33955
156 Ga0209257_1000026 3300025304 Bacteria 723225
157 Ga0209257_1000205 3300025304 Bacteria 143735
158 Ga0209257_1002491 3300025304 Bacteria 18177
159 Ga0209257_1003111 3300025304 Bacteria 14861
160 Ga0209257_1005335 3300025304 Bacteria 9101
161 Ga0207656_10005978 3300025321 Bacteria 4347
162 Ga0207655_1001171 3300025728 Bacteria 25488
163 Ga0207682_10074196 3300025893 Bacteria 1446
164 Ga0207694_10142155 3300025924 Bacteria 1930
165 Ga0207706_10005891 3300025933 Bacteria 11400
166 Ga0207709_10000848 3300025935 Bacteria 23423
167 Ga0207709_10003179 3300025935 Bacteria 9866
168 Ga0207651_10034907 3300025960 Bacteria 3263
169 Ga0207639_10068507 3300026041 Bacteria 2765
170 Ga0207639_10086392 3300026041 Bacteria 2497
171 Ga0207641_10253571 3300026088 Bacteria 1644
172 Ga0207674_10090088 3300026116 Bacteria 3059
173 Ga0207683_10009320 3300026121 Bacteria 8363
174 Ga0207698_10103391 3300026142 Bacteria 2367
175 Ga0207698_10202450 3300026142 Bacteria 1779
176 Ga0209282_1009423 3300027666 Bacteria 6175
177 Ga0207428_10207990 3300027907 Bacteria 1471
178 Ga0268265_10019802 3300028380 Bacteria 4685
179 Ga0268264_10033979 3300028381 Bacteria 4193
180 Ga0307517_10206649 3300028786 Bacteria 1217
181 Ga0307515_10000063 3300028794 Bacteria 245504
182 Ga0307515_10266022 3300028794 Bacteria 1443
183 Ga0316176_1144178 3300030732 Bacteria 6578
184 Ga0316178_1035090 3300030735 Bacteria 2580
185 Ga0316183_1190921 3300030742 Bacteria 8133
186 Ga0316181_1208437 3300030744 Bacteria 3391
187 Ga0316182_1174220 3300030745 Bacteria 3254
188 Ga0265331_10004362 3300031250 Bacteria 8851
189 Ga0265327_10000043 3300031251 Bacteria 285108
190 Ga0265327_10001162 3300031251 Bacteria 35750
191 Ga0265327_10005400 3300031251 Bacteria 10672
192 Ga0307513_10000034 3300031456 Bacteria 185012
193 Ga0307513_10000057 3300031456 Bacteria 146564
194 Ga0307513_10076428 3300031456 Bacteria 3473
195 Ga0307513_10230966 3300031456 Bacteria 1663
196 Ga0307408_100000117 3300031548 Bacteria 87442
197 Ga0307408_100039808 3300031548 Bacteria 3325
198 Ga0307408_100047646 3300031548 Bacteria 3070
199 Ga0307408_100088659 3300031548 Bacteria 2330
200 Ga0307408_100127557 3300031548 Bacteria 1980
201 Ga0307408_100301493 3300031548 Bacteria 1342
202 Ga0307514_10011129 3300031649 Bacteria 7489
203 Ga0307516_10209906 3300031730 Bacteria 1662
204 Ga0307413_10047546 3300031824 Bacteria 2559
205 Ga0307406_10000220 3300031901 Bacteria 34643
206 Ga0307406_10002963 3300031901 Bacteria 9258
207 Ga0307407_10101390 3300031903 Bacteria 1787
208 Ga0307412_10017867 3300031911 Bacteria 4252
209 Ga0307412_10020728 3300031911 Bacteria 4005
210 Ga0307412_10133219 3300031911 Bacteria 1808
211 Ga0307416_100033501 3300032002 Bacteria 3895
212 Ga0307416_100103163 3300032002 Bacteria 2489
213 Ga0307416_100334696 3300032002 Bacteria 1523
214 Ga0307414_10096900 3300032004 Bacteria 2208
215 Ga0307414_10271850 3300032004 Bacteria 1420
216 Ga0307414_10317515 3300032004 Bacteria 1324
217 Ga0307411_10039884 3300032005 Bacteria 2974
218 Ga0307411_10070251 3300032005 Bacteria 2369
219 Ga0307507_10039549 3300033179 Bacteria 4758
220 Ga0395899_0043386 3300037312 Bacteria 3355
221 Ga0395900_0004434 3300037418 Bacteria 14876
222 Ga0395898_0003017 3300037466 Bacteria 19099
223 Ga0395905_0000683 3300037471 Bacteria 44990
224 Ga0395905_0001140 3300037471 Bacteria 33247
225 Ga0395905_0049873 3300037471 Bacteria 3923
226 Ga0395901_0021681 3300038443 Bacteria 6582
227 Ga0395901_0045373 3300038443 Bacteria 4561
228 Ga0395901_0217332 3300038443 Bacteria 1998
229 Ga0395901_0328281 3300038443 Bacteria 1582
230 Ga0436361_0810743 3300039447 Bacteria 2785
231 Ga0436361_1106011 3300039447 Bacteria 1147
232 Ga0439436_0009264 3300041404 Bacteria 3018
233 Ga0439439_0005885 3300041406 Bacteria 2820
234 Ga0439466_0006553 3300041411 Bacteria 4423
235 Ga0439466_0019706 3300041411 Bacteria 2413
236 Ga0439431_0013822 3300041997 Bacteria 1865
237 Ga0439442_003879 3300042002 Bacteria 2964
238 Ga0439442_018043 3300042002 Bacteria 1458
239 Ga0439432_018785 3300042006 Bacteria 2306
240 Ga0439449_0005670 3300042007 Bacteria 4775
241 Ga0439449_0007344 3300042007 Bacteria 4187
242 Ga0439449_0014774 3300042007 Bacteria 2933
243 Ga0439455_0012138 3300042012 Bacteria 1929
244 Ga0439462_0001863 3300042015 Bacteria 4790
245 Ga0439462_0007639 3300042015 Bacteria 2711
246 Ga0450919_002124 3300042121 Bacteria 2579
247 Ga0450923_002230 3300042125 Bacteria 2743
248 Ga0450923_029854 3300042125 Bacteria 1106
249 Ga0450896_005039 3300042133 Bacteria 1798
250 Ga0450898_010776 3300042134 Bacteria 1487
251 Ga0450898_011593 3300042134 Bacteria 1446
252 Ga0450906_004855 3300042145 Bacteria 2797
253 Ga0439446_0003335 3300042156 Bacteria 3972
254 Ga0450909_003399 3300042185 Bacteria 2269
255 Ga0450909_010997 3300042185 Bacteria 1325
256 Ga0439434_0003285 3300042435 Bacteria 4749
257 Ga0439434_0007956 3300042435 Bacteria 3109
258 Ga0450918_001308 3300042531 Bacteria 5028
259 Ga0466972_0000201 3300044658 Bacteria 43791
260 Ga0466964_0100799 3300044706 Bacteria 1273
261 Ga0495617_021099 3300046452 Bacteria 2201
262 Ga0495627_003349 3300046453 Bacteria 7125
263 Ga0495627_039721 3300046453 Bacteria 1451
264 Ga0495592_0004938 3300046454 Bacteria 9815
265 Ga0495629_0059191 3300046459 Bacteria 2678
266 Ga0495638_0014749 3300046460 Bacteria 5271
267 Ga0495638_0192002 3300046460 Bacteria 1158
268 Ga0495651_0012482 3300046462 Bacteria 6552
269 Ga0495651_0026396 3300046462 Bacteria 4524
270 Ga0495605_0034690 3300046474 Bacteria 2554
271 Ga0495585_0011821 3300046492 Bacteria 5156
272 Ga0495607_0015518 3300046501 Bacteria 4935
273 Ga0495606_0051881 3300046507 Bacteria 2672
274 Ga0495610_0014238 3300046512 Bacteria 4683
275 Ga0495610_0036356 3300046512 Bacteria 2518
276 Ga0495616_0000410 3300046513 Bacteria 33119
277 Ga0495616_0029076 3300046513 Bacteria 2921
278 Ga0495618_0242328 3300046514 Bacteria 1133
279 Ga0495620_0007265 3300046515 Bacteria 6029
280 Ga0495628_0005759 3300046516 Bacteria 10857
281 Ga0495628_0074597 3300046516 Bacteria 2642
282 Ga0495628_0283385 3300046516 Bacteria 1230
283 Ga0495631_0000397 3300046518 Bacteria 30077
284 Ga0495631_0050784 3300046518 Bacteria 1813
285 Ga0495637_0001398 3300046520 Bacteria 14322
286 Ga0495637_0022092 3300046520 Bacteria 2907
287 Ga0495666_0000569 3300046526 Bacteria 16508
288 Ga0495652_0006965 3300046529 Bacteria 10455
289 Ga0495652_0117535 3300046529 Bacteria 2127
290 Ga0495654_0002029 3300046530 Bacteria 13313
291 Ga0495654_0010000 3300046530 Bacteria 5181
292 Ga0495640_0008407 3300046533 Bacteria 8095
293 Ga0495621_0006284 3300046539 Bacteria 3459
294 Ga0495633_0025265 3300046558 Bacteria 2926
295 Ga0495656_0000081 3300046615 Bacteria 42254
296 Ga0495668_0007835 3300046616 Bacteria 6760
297 Ga0495634_0015334 3300046642 Bacteria 5508
298 Ga0495611_0009827 3300046648 Bacteria 4046
299 Ga0495625_0000360 3300046660 Bacteria 69587
300 Ga0495625_0067511 3300046660 Bacteria 2516
301 Ga0495625_0109498 3300046660 Bacteria 1889
302 Ga0495625_0110505 3300046660 Bacteria 1879
303 Ga0495635_0241425 3300046663 Bacteria 1219
304 Ga0495661_0041089 3300046665 Bacteria 2864
305 Ga0495588_0014088 3300046674 Bacteria 3822
306 Ga0495588_0022901 3300046674 Bacteria 3089
307 Ga0495646_0006398 3300046680 Bacteria 7469
308 Ga0495658_0158985 3300046683 Bacteria 1392
309 Ga0495613_0038112 3300046689 Bacteria 3563
310 Ga0495671_0004912 3300046692 Bacteria 7906
311 Ga0495649_0008787 3300046694 Bacteria 6053
312 Ga0495589_0148115 3300046794 Bacteria 1121
313 Ga0495600_0010869 3300046809 Bacteria 5662
314 Ga0495660_0036130 3300046810 Bacteria 2757
315 Ga0495660_0067878 3300046810 Bacteria 1898
316 Ga0495676_0009706 3300047321 Bacteria 8750
317 Ga0495683_0116165 3300047323 Bacteria 1273
318 Ga0495687_011896 3300047443 Bacteria 4647
319 Ga0495675_0063886 3300047444 Bacteria 2329
320 Ga0495685_007928 3300047447 Bacteria 3517
321 Ga0495686_0104890 3300047472 Bacteria 1701
322 Ga0495593_0034822 3300047673 Bacteria 2736
323 Ga0495614_0015680 3300048089 Bacteria 3301
324 Ga0496100_0009216 3300048903 Bacteria 5539
325 Ga0496101_0006322 3300048904 Bacteria 7625
326 Ga0496101_0006791 3300048904 Bacteria 7380
327 Ga0496102_0003436 3300048905 Bacteria 13425
328 Ga0496103_0036712 3300048906 Bacteria 3001
329 Ga0496104_0019966 3300048907 Bacteria 6136
330 Ga0496105_0012404 3300048908 Bacteria 6746
331 Ga0496108_0050095 3300048911 Bacteria 3495
332 Ga0496110_0084170 3300048913 Bacteria 2839
333 Ga0496113_0391825 3300048916 Bacteria 1115
334 Ga0496114_0024614 3300048917 Bacteria 4914
335 Ga0496116_0017452 3300048919 Bacteria 5569
336 Ga0496117_0008245 3300048920 Bacteria 9930
337 Ga0496117_0047180 3300048920 Bacteria 3092
338 Ga0496118_0013017 3300048921 Bacteria 7914
339 Ga0496118_0069849 3300048921 Bacteria 2540
340 Ga0496118_0111981 3300048921 Bacteria 1808
341 Ga0496121_0036091 3300048924 Bacteria 4412
342 Ga0496121_0044091 3300048924 Bacteria 3853
343 Ga0496121_0083710 3300048924 Bacteria 2517
344 Ga0496122_0091751 3300048925 Bacteria 2067
345 Ga0496123_0045881 3300048926 Bacteria 2971
346 Ga0496123_0051045 3300048926 Bacteria 2758
347 Ga0496123_0180203 3300048926 Bacteria 1104
348 Ga0496124_0000108 3300048927 Bacteria 167473
349 Ga0496124_0013231 3300048927 Bacteria 8069
350 Ga0496124_0019354 3300048927 Bacteria 6338
351 Ga0496125_0018285 3300048928 Bacteria 6659
352 Ga0496125_0020840 3300048928 Bacteria 6137
353 Ga0496125_0143347 3300048928 Bacteria 1657
354 Ga0501262_001155 3300049759 Bacteria 2992
355 Ga0501266_000400 3300049763 Bacteria 5761
356 Ga0501280_001237 3300049776 Bacteria 4972
357 nmdc:mga03683_37314_c1 3300050489 Bacteria 1980
358 nmdc:mga03683_4838_c1 3300050489 Bacteria 4495
359 nmdc:mga00v17_117656_c1 3300050491 Bacteria 1690
360 nmdc:mga00v17_32353_c1 3300050491 Bacteria 3091
361 nmdc:mga0yw44_33462_c1 3300050492 Bacteria 3004
362 nmdc:mga0k408_27310_c1 3300050493 Bacteria 3242
363 nmdc:mga07m45_193294_c1 3300050496 Bacteria 1184
364 nmdc:mga07m45_39260_c1 3300050496 Bacteria 2645
365 Ga0500610_0000898 3300053079 Bacteria 9593
366 Ga0500610_0001447 3300053079 Bacteria 8093
367 Ga0500644_0008358 3300053088 Bacteria 2730
368 Ga0500583_0147116 3300053092 Bacteria 1172
369 Ga0500651_0000521 3300053093 Bacteria 19750
370 Ga0500566_0019098 3300053094 Bacteria 4025
371 Ga0500566_0086209 3300053094 Bacteria 1741
372 Ga0500650_0026919 3300053098 Bacteria 2583
373 Ga0500571_000130 3300053110 Bacteria 25101
374 Ga0500593_000313 3300053117 Bacteria 19514
375 Ga0500593_001597 3300053117 Bacteria 8165
376 Ga0500597_045214 3300053120 Bacteria 1862
377 Ga0500607_002324 3300053121 Bacteria 15601
378 Ga0500608_009782 3300053122 Bacteria 4088
379 Ga0500608_114327 3300053122 Bacteria 1233
380 Ga0500626_055091 3300053128 Bacteria 1785
381 Ga0500655_003112 3300053133 Bacteria 3011
382 Ga0500658_0000144 3300053134 Bacteria 33840
383 Ga0500658_0000244 3300053134 Bacteria 25588
384 Ga0500559_0009978 3300053136 Bacteria 4091
385 Ga0500559_0104884 3300053136 Bacteria 1305
386 Ga0500564_037017 3300053138 Bacteria 2250
387 Ga0500568_0002676 3300053139 Bacteria 10330
388 Ga0500574_014919 3300053141 Bacteria 1844
389 Ga0500616_0011920 3300053153 Bacteria 5109
390 Ga0500619_000123 3300053154 Bacteria 20368
391 Ga0500627_0000921 3300053158 Bacteria 7921
392 Ga0500634_0002153 3300053161 Bacteria 8168
393 Ga0500634_0032374 3300053161 Bacteria 2852
394 Ga0500638_023167 3300053162 Bacteria 2948
395 Ga0500645_000506 3300053730 Bacteria 26243
396 Ga0500645_003650 3300053730 Bacteria 6156
397 Ga0500645_010207 3300053730 Bacteria 3118
398 Ga0500596_008815 3300053735 Bacteria 1599
399 Ga0500661_001444 3300055283 Bacteria 4454
400 2513227365 2513020051 Bacteria 6053213
401 2548500345 2547132374 Bacteria 5530232
402 2599627064 2599185214 Bacteria 8209958
403 2599676575 2599185226 Bacteria 8233575
404 2599684843 2599185227 Bacteria 8246414
405 2599696721 2599185229 Bacteria 8216126
406 2643864621 2643221570 Bacteria 5103772
407 2643992765 2643221596 Bacteria 5006805
408 2644058319 2643221609 Bacteria 6756331
409 2644073371 2643221611 Bacteria 6820941
410 2644160038 2643221628 Bacteria 5745828
411 2644296417 2643221652 Bacteria 5140275
412 2644326899 2643221658 Bacteria 6064537
413 2644401060 2643221672 Bacteria 6322190
414 2644466374 2643221683 Bacteria 5749203
415 2644647106 2643221717 Bacteria 5676132
416 2738723490 2738541277 Bacteria 7458140
417 2738882209 2738541307 Bacteria 8606193
418 2739244339 2738543012 Bacteria 7115078
419 2739284221 2738543019 Bacteria 7459457
420 2765571805 2765235838 Bacteria 5445269
421 2808982189 2808606386 Bacteria 4471946
422 2809130011 2808606415 Bacteria 4576710
423 2809148934 2808606419 Bacteria 4576925
424 2816469770 2816332133 Bacteria 7249298
425 2819598138 2818991446 Bacteria 7757362
426 2831269124 2831265667 Bacteria 7184833
427 2838058556 2838054893 Bacteria 7451788
428 2839098474 2839094727 Bacteria 5534556
429 2842682171 2842677519 Bacteria 5615038
430 2852619070 2852618963 Bacteria 4577824
431 2885196482 2885192300 Bacteria 5882526
432 2885200059 2885198086 Bacteria 7212419
433 2885213711 2885211737 Bacteria 7212420
434 2899929559 2899924645 Bacteria 7487985
435 2904456378 2904449895 Bacteria 6927402
436 2904462887 2904456579 Bacteria 6819253
437 2904546585 2904541872 Bacteria 8915136
438 2919465810 2919462493 Bacteria 5817112
439 2919705624 2919704043 Bacteria 5560311
440 2928039996 2928037797 Bacteria 7273642
441 2928047255 2928044640 Bacteria 7271509
442 2928057544 2928051484 Bacteria 7773759
443 2928068072 2928064002 Bacteria 7419480
444 2928072653 2928070936 Bacteria 8062541
445 2928085823 2928084124 Bacteria 7159212
446 2929166039 2929160207 Bacteria 9075316
447 2932423440 2932422444 Bacteria 4678430
448 2945914838 2945909444 Bacteria 7065066
449 2945951097 2945945610 Bacteria 5951079
450 2945974244 2945972063 Bacteria 6086495
451 2945989762 2945984333 Bacteria 7358892
452 2954769503 2954767861 Bacteria 5535784
453 2990715203 2990710928 Bacteria 5002431
454 Ga0105246_10075042
455 JGI25155J39150_1000028
456 JGI25156J39149_1000013
457 JGI25154J39366_1000032
458 JGI25157J39369_1000017
459 JGI25152J39213_1001106
460 JGI25150J39212_1001012
461 JGI25159J45721_1001198
462 JGI25151J46595_10000883
463 JGI25151J46595_10002047
464 JGI25151J46595_10002763
465 JGI25153J46596_10001835
466 rootL2_10134231
467 rootL2_10240349
468 JGI25160J50197_1001298
469 Ga0006562J51391_1045635
470 Ga0006562J51391_1064821
471 Ga0055538_1000024
472 Ga0055539_1000031
473 Ga0055533_1000041
474 Ga0055525_1000049
475 Ga0055535_1000168
476 Ga0055542_1000214
477 Ga0055526_1002429
478 Ga0055526_1005492
479 Ga0055526_1006538
480 Ga0055537_1000305
481 Ga0055537_1001029
482 Ga0055524_1001609
483 Ga0055524_1002977
484 Ga0055536_1001754
485 Ga0055536_1005849
486 Ga0055536_1017611
487 Ga0055534_1000234
488 Ga0055534_1000982
489 Ga0055534_1011129
490 Ga0055528_1001224
491 Ga0055528_1001736
492 Ga0055530_10001795
493 Ga0055530_10005148
494 Ga0055540_1001332
495 Ga0055540_1001840
496 Ga0055540_1002449
497 Ga0055540_1004792
498 Ga0055531_10002526
499 Ga0055531_10002597
500 Ga0055531_10007581
501 Ga0055541_1000022
502 Ga0055543_1001003
503 Ga0055543_1005841
504 Ga0065165_1003033
505 Ga0070673_100041529
506 Ga0070667_100020414
507 Ga0070667_100348532
508 Ga0068853_100438622
509 Ga0068855_100288524
510 Ga0070664_100008135
511 Ga0068851_10021308
512 Ga0068860_100041455
513 Ga0068862_100014356
514 Ga0075365_10015660
515 Ga0075363_100014075
516 Ga0075362_10026241
517 Ga0075362_10035701
518 Ga0075366_10005987
519 Ga0075366_10010525
520 Ga0097621_100197659
521 Ga0075370_10005932
522 Ga0075370_10007820
523 Ga0099826_10002383
524 Ga0099826_10089051
525 Ga0105244_10002051
526 Ga0105240_10066409
527 Ga0105240_10294099
528 Ga0105243_10002507
529 Ga0105243_10005210
530 Ga0105243_10015663
531 Ga0105237_10020172
532 Ga0105237_10293607
533 Ga0105238_10064609
534 Ga0105238_10151254
535 Ga0105246_10006019
536 Ga0105246_10074092
537 Ga0157373_10013280
538 Ga0157373_10074129
539 Ga0157371_10016898
540 Ga0157370_10005706
541 Ga0157370_10125705
542 Ga0157369_10086190
543 Ga0157369_10619027
544 Ga0182008_10052092
545 Ga0182006_1000723
546 Ga0182006_1010379
547 Ga0182007_10002435
548 Ga0183362_10005
549 Ga0163161_10000142
550 Ga0163161_10010518
551 Ga0163161_10011859
552 Ga0163161_10057044
553 Ga0163161_10103619
554 Ga0213872_10002070
555 Ga0209435_100003
556 Ga0209784_100018
557 Ga0209566_100016
558 Ga0209674_100030
559 Ga0209672_100978
560 Ga0209147_101185
561 Ga0209563_100034
562 Ga0209258_100015
563 Ga0207425_1000277
564 Ga0207425_1001847
565 Ga0209646_1000008
566 Ga0209026_1000007
567 Ga0209677_100019
568 Ga0209148_1000183
569 Ga0209759_1000026
570 Ga0209129_1000049
571 Ga0209129_1005183
572 Ga0209565_1000108
573 Ga0209565_1000356
574 Ga0209565_1005774
575 Ga0209565_1005781
576 Ga0209673_1000386
577 Ga0209673_1000842
578 Ga0209673_1000949
579 Ga0209130_1000200
580 Ga0209130_1003564
581 Ga0209675_1000163
582 Ga0209675_1000477
583 Ga0209675_1001619
584 Ga0209675_1002584
585 Ga0209675_1003725
586 Ga0209676_1000137
587 Ga0209676_1000385
588 Ga0209676_1002400
589 Ga0209676_1002529
590 Ga0209025_1000290
591 Ga0209025_1000360
592 Ga0209025_1000704
593 Ga0209025_1004562
594 Ga0209025_1020049
595 Ga0209025_1024245
596 Ga0209564_1000232
597 Ga0209564_1000303
598 Ga0209758_1000135
599 Ga0209050_1000015
600 Ga0209050_1000681
601 Ga0209256_1000129
602 Ga0209256_1000224
603 Ga0207426_1000171
604 Ga0207426_1000185
605 Ga0209051_1000010
606 Ga0209051_1000137
607 Ga0209051_1000571
608 Ga0209051_1000773
609 Ga0209257_1000026
610 Ga0209257_1000205
611 Ga0209257_1002491
612 Ga0209257_1003111
613 Ga0209257_1005335
614 Ga0207656_10005978
615 Ga0207655_1001171
616 Ga0207682_10074196
617 Ga0207694_10142155
618 Ga0207706_10005891
619 Ga0207709_10000848
620 Ga0207709_10003179
621 Ga0207651_10034907
622 Ga0207639_10068507
623 Ga0207639_10086392
624 Ga0207641_10253571
625 Ga0207674_10090088
626 Ga0207683_10009320
627 Ga0207698_10103391
628 Ga0207698_10202450
629 Ga0209282_1009423
630 Ga0207428_10207990
631 Ga0268265_10019802
632 Ga0268264_10033979
633 Ga0307517_10206649
634 Ga0307515_10000063
635 Ga0307515_10266022
636 Ga0316176_1144178
637 Ga0316178_1035090
638 Ga0316183_1190921
639 Ga0316181_1208437
640 Ga0316182_1174220
641 Ga0265331_10004362
642 Ga0265327_10000043
643 Ga0265327_10001162
644 Ga0265327_10005400
645 Ga0307513_10000034
646 Ga0307513_10000057
647 Ga0307513_10076428
648 Ga0307513_10230966
649 Ga0307408_100000117
650 Ga0307408_100039808
651 Ga0307408_100047646
652 Ga0307408_100088659
653 Ga0307408_100127557
654 Ga0307408_100301493
655 Ga0307514_10011129
656 Ga0307516_10209906
657 Ga0307413_10047546
658 Ga0307406_10000220
659 Ga0307406_10002963
660 Ga0307407_10101390
661 Ga0307412_10017867
662 Ga0307412_10020728
663 Ga0307412_10133219
664 Ga0307416_100033501
665 Ga0307416_100103163
666 Ga0307416_100334696
667 Ga0307414_10096900
668 Ga0307414_10271850
669 Ga0307414_10317515
670 Ga0307411_10039884
671 Ga0307411_10070251
672 Ga0307507_10039549
673 Ga0395899_0043386
674 Ga0395900_0004434
675 Ga0395898_0003017
676 Ga0395905_0000683
677 Ga0395905_0001140
678 Ga0395905_0049873
679 Ga0395901_0021681
680 Ga0395901_0045373
681 Ga0395901_0217332
682 Ga0395901_0328281
683 Ga0436361_0810743
684 Ga0436361_1106011
685 Ga0439436_0009264
686 Ga0439439_0005885
687 Ga0439466_0006553
688 Ga0439466_0019706
689 Ga0439431_0013822
690 Ga0439442_003879
691 Ga0439442_018043
692 Ga0439432_018785
693 Ga0439449_0005670
694 Ga0439449_0007344
695 Ga0439449_0014774
696 Ga0439455_0012138
697 Ga0439462_0001863
698 Ga0439462_0007639
699 Ga0450919_002124
700 Ga0450923_002230
701 Ga0450923_029854
702 Ga0450896_005039
703 Ga0450898_010776
704 Ga0450898_011593
705 Ga0450906_004855
706 Ga0439446_0003335
707 Ga0450909_003399
708 Ga0450909_010997
709 Ga0439434_0003285
710 Ga0439434_0007956
711 Ga0450918_001308
712 Ga0466972_0000201
713 Ga0466964_0100799
714 Ga0495617_021099
715 Ga0495627_003349
716 Ga0495627_039721
717 Ga0495592_0004938
718 Ga0495629_0059191
719 Ga0495638_0014749
720 Ga0495638_0192002
721 Ga0495651_0012482
722 Ga0495651_0026396
723 Ga0495605_0034690
724 Ga0495585_0011821
725 Ga0495607_0015518
726 Ga0495606_0051881
727 Ga0495610_0014238
728 Ga0495610_0036356
729 Ga0495616_0000410
730 Ga0495616_0029076
731 Ga0495618_0242328
732 Ga0495620_0007265
733 Ga0495628_0005759
734 Ga0495628_0074597
735 Ga0495628_0283385
736 Ga0495631_0000397
737 Ga0495631_0050784
738 Ga0495637_0001398
739 Ga0495637_0022092
740 Ga0495666_0000569
741 Ga0495652_0006965
742 Ga0495652_0117535
743 Ga0495654_0002029
744 Ga0495654_0010000
745 Ga0495640_0008407
746 Ga0495621_0006284
747 Ga0495633_0025265
748 Ga0495656_0000081
749 Ga0495668_0007835
750 Ga0495634_0015334
751 Ga0495611_0009827
752 Ga0495625_0000360
753 Ga0495625_0067511
754 Ga0495625_0109498
755 Ga0495625_0110505
756 Ga0495635_0241425
757 Ga0495661_0041089
758 Ga0495588_0014088
759 Ga0495588_0022901
760 Ga0495646_0006398
761 Ga0495658_0158985
762 Ga0495613_0038112
763 Ga0495671_0004912
764 Ga0495649_0008787
765 Ga0495589_0148115
766 Ga0495600_0010869
767 Ga0495660_0036130
768 Ga0495660_0067878
769 Ga0495676_0009706
770 Ga0495683_0116165
771 Ga0495687_011896
772 Ga0495675_0063886
773 Ga0495685_007928
774 Ga0495686_0104890
775 Ga0495593_0034822
776 Ga0495614_0015680
777 Ga0496100_0009216
778 Ga0496101_0006322
779 Ga0496101_0006791
780 Ga0496102_0003436
781 Ga0496103_0036712
782 Ga0496104_0019966
783 Ga0496105_0012404
784 Ga0496108_0050095
785 Ga0496110_0084170
786 Ga0496113_0391825
787 Ga0496114_0024614
788 Ga0496116_0017452
789 Ga0496117_0008245
790 Ga0496117_0047180
791 Ga0496118_0013017
792 Ga0496118_0069849
793 Ga0496118_0111981
794 Ga0496121_0036091
795 Ga0496121_0044091
796 Ga0496121_0083710
797 Ga0496122_0091751
798 Ga0496123_0045881
799 Ga0496123_0051045
800 Ga0496123_0180203
801 Ga0496124_0000108
802 Ga0496124_0013231
803 Ga0496124_0019354
804 Ga0496125_0018285
805 Ga0496125_0020840
806 Ga0496125_0143347
807 Ga0501262_001155
808 Ga0501266_000400
809 Ga0501280_001237
810 nmdc:mga03683_37314_c1
811 nmdc:mga03683_4838_c1
812 nmdc:mga00v17_117656_c1
813 nmdc:mga00v17_32353_c1
814 nmdc:mga0yw44_33462_c1
815 nmdc:mga0k408_27310_c1
816 nmdc:mga07m45_193294_c1
817 nmdc:mga07m45_39260_c1
818 Ga0500610_0000898
819 Ga0500610_0001447
820 Ga0500644_0008358
821 Ga0500583_0147116
822 Ga0500651_0000521
823 Ga0500566_0019098
824 Ga0500566_0086209
825 Ga0500650_0026919
826 Ga0500571_000130
827 Ga0500593_000313
828 Ga0500593_001597
829 Ga0500597_045214
830 Ga0500607_002324
831 Ga0500608_009782
832 Ga0500608_114327
833 Ga0500626_055091
834 Ga0500655_003112
835 Ga0500658_0000144
836 Ga0500658_0000244
837 Ga0500559_0009978
838 Ga0500559_0104884
839 Ga0500564_037017
840 Ga0500568_0002676
841 Ga0500574_014919
842 Ga0500616_0011920
843 Ga0500619_000123
844 Ga0500627_0000921
845 Ga0500634_0002153
846 Ga0500634_0032374
847 Ga0500638_023167
848 Ga0500645_000506
849 Ga0500645_003650
850 Ga0500645_010207
851 Ga0500596_008815
852 Ga0500661_001444
853 2513227365
854 2548500345
855 2599627064
856 2599676575
857 2599684843
858 2599696721
859 2643864621
860 2643992765
861 2644058319
862 2644073371
863 2644160038
864 2644296417
865 2644326899
866 2644401060
867 2644466374
868 2644647106
869 2738723490
870 2738882209
871 2739244339
872 2739284221
873 2765571805
874 2808982189
875 2809130011
876 2809148934
877 2816469770
878 2819598138
879 2831269124
880 2838058556
881 2839098474
882 2842682171
883 2852619070
884 2885196482
885 2885200059
886 2885213711
887 2899929559
888 2904456378
889 2904462887
890 2904546585
891 2919465810
892 2919705624
893 2928039996
894 2928047255
895 2928057544
896 2928068072
897 2928072653
898 2928085823
899 2929166039
900 2932423440
901 2945914838
902 2945951097
903 2945974244
904 2945989762
905 2954769503
906 2990715203

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

35

128

0.91

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

168

274

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kpz-assembly1.cif.gz_A 1.70 a resolution crystal structure of group a streptococcus hupz-v5-his6 0.7564 170 292
1dnl-assembly1.cif.gz_A x-ray structure of escherichia coli pyridoxine 5'-phosphate oxidase complexed with fmn at 1.8 angstrom resolution 0.7356 49 124
2htd-assembly1.cif.gz_A crystal structure of a putative pyridoxamine 5'-phosphate oxidase (ldb0262) from lactobacillus delbrueckii subsp. at 1.60 a resolution 0.7247 34 139
1jnw-assembly1.cif.gz_A-2 active site structure of e. coli pyridoxine 5'-phosphate oxidase 0.7224 49 128
4hmx-assembly1.cif.gz_A crystal structure of phzg from burkholderia lata 383 in complex with tetrahydrophenazine-1-carboxylic acid 0.7191 46 123
ID Description Score Start End Superfamily
2htdA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7695 168 292 2.30.110.10
5escD00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.768 170 292 2.30.110.10
af_A0A1D8PRA8_5_228_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7645 182 269 2.30.110.10
1wliA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7455 184 289 2.30.110.10
5escD00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7393 170 292 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A4Z0LZC4-F1-model_v4 Flavin-nucleotide-binding protein 0.9758 6 303
AF-A0A0D6PF63-F1-model_v4 Pyridoxamine 5'-phosphate oxidase 0.969 14 310
AF-B1H9A1-F1-model_v4 deleted 0.9687 3 314
AF-A0A7Y2JXL7-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.968 1 318 GO:0016491
GO:0051537
AF-A0A7T2X0B1-F1-model_v4 merged 0.968 4 310

Map