F447049

General Info

Members Datasets Scaffolds Average Seq Length
452 242 434 213

Family's Representative Sequence

Representative Sequence 3300046507|Ga0495606_0011487|Ga0495606_0011487_889_1656
Length 255
Sequence MVFRRRALKESHGQDDKVEKLKSAKLSWLLFLGSCHSPPYLCPMEILDPNLQAYLDAHCEPEPEALKKINRETYLKVLKPNMLSGHYQGRVLSMLSKMINPERILEIGAFTGYSAICLAEGLIEGGKLDTLEVNAEMEELLLSNFKSAGMSEKIRLHIGDAMPKILEFQNNLFNLVFIDADKKSNLAYFESVIDKVKPAGLIIIDNVLWKGKVYGDHQDADTQMFRKLNDQIAVDSRVEKLILPVRDGILIIRKK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
3 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
4 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
5 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
6 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
7 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
8 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
9 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
10 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
11 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
12 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
13 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
14 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
15 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
16 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
17 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
18 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
19 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
20 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
21 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
22 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
23 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
24 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
25 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
26 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
27 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
28 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
29 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
30 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
31 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
32 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
33 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
34 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
35 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
36 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
37 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
38 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
39 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
40 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
41 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
88 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
91 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
93 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
94 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
95 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
96 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
129 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
132 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
133 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
134 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
135 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
136 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
137 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
148 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
149 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
156 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
157 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
158 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
159 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
160 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
161 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
162 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
163 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
164 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
165 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
166 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
167 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
168 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
169 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
170 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
171 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
172 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
173 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
174 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
175 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
176 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
177 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
178 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
179 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
180 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
181 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
182 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
183 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
184 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
185 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
186 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
187 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
188 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
189 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
190 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
191 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
192 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
193 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
194 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
195 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
196 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
197 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
198 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
199 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
200 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
201 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
202 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
203 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
204 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
205 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
206 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
207 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
208 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
209 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
210 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
211 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
212 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
213 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
214 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
217 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
218 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
219 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
220 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
221 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
222 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
223 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
224 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
225 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
226 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
229 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
230 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
231 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
232 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
233 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
234 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
235 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
236 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
237 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
238 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
239 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
240 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
241 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
242 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.8
Metatranscriptomes 0
Isolates 4.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.41
Nodule 0
Rhizoplane 1.11
Rhizosphere 81.86
Stem 0
Stem Tuber 0
Unclassified 8.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2261022 2162886007 Bacteria 1465
2 SwRhRL2b_contig_677025 2162886007 Bacteria 181955
3 JGI24740J21852_10078012 3300001979 Unclassified 873
4 JGI24739J22299_10049133 3300001989 Bacteria 1369
5 JGI24737J22298_10000017 3300001990 Bacteria 46988
6 JGI24737J22298_10002990 3300001990 Bacteria 5991
7 JGI24737J22298_10017236 3300001990 Unclassified 2329
8 JGI24743J22301_10000856 3300001991 Bacteria 3877
9 JGI24735J21928_10000024 3300002067 Bacteria 95227
10 JGI24735J21928_10026239 3300002067 Unclassified 1752
11 JGI24744J21845_10004162 3300002077 Bacteria 2981
12 JGI25162J39368_1002329 3300002737 Bacteria 7580
13 JGI25157J39369_1010215 3300002741 Bacteria 1241
14 JGI25164J39214_1001393 3300002772 Bacteria 5757
15 JGI25165J46597_1001345 3300003214 Bacteria 13713
16 rootH1_10008730 3300003316 Bacteria 5409
17 rootH1_10008730 3300003323 Bacteria 8891
18 rootH1_10119392 3300003316 Bacteria 5986
19 rootH1_10196979 3300003316 Bacteria 1750
20 rootH2_10000579 3300003320 Bacteria 178428
21 rootH2_10062830 3300003320 Bacteria 3045
22 rootL2_10002073 3300003322 Bacteria 21415
23 rootL2_10002103 3300003322 Bacteria 5592
24 rootL2_10208326 3300003322 Bacteria 3650
25 rootL2_10235720 3300003322 Bacteria 4451
26 rootH1_10007209 3300003323 Unclassified 3536
27 rootH1_10015499 3300003323 Bacteria 86587
28 rootH1_10037915 3300003323 Bacteria 3178
29 rootH1_10287539 3300003323 Bacteria 3291
30 rootH1_10398462 3300003323 Bacteria 1495
31 Ga0055536_1000002 3300003781 Bacteria 605605
32 Ga0055531_10000148 3300003794 Bacteria 80963
33 Ga0065714_10008186 3300005288 Bacteria 8232
34 Ga0065714_10211774 3300005288 Bacteria 864
35 Ga0065704_10070133 3300005289 Bacteria 1266035
36 Ga0065704_10130168 3300005289 Bacteria 1639
37 Ga0070658_10000032 3300005327 Bacteria 147726
38 Ga0070658_10147027 3300005327 Bacteria 1971
39 Ga0070658_10265188 3300005327 Bacteria 1459
40 Ga0070683_100046319 3300005329 Bacteria 4017
41 Ga0068868_100104169 3300005338 Bacteria 2299
42 Ga0070660_100035273 3300005339 Bacteria 3785
43 Ga0070660_100048737 3300005339 Bacteria 3254
44 Ga0070660_100370305 3300005339 Bacteria 1182
45 Ga0070660_100544041 3300005339 Bacteria 968
46 Ga0070674_100261087 3300005356 Bacteria 1365
47 Ga0070674_100485354 3300005356 Bacteria 1026
48 Ga0070673_100004132 3300005364 Bacteria 9144
49 Ga0070688_100172111 3300005365 Bacteria 1495
50 Ga0070659_100000644 3300005366 Bacteria 25506
51 Ga0070659_100003119 3300005366 Bacteria 11796
52 Ga0070678_100002599 3300005456 Bacteria 9928
53 Ga0070662_100001063 3300005457 Bacteria 16771
54 Ga0068867_100005421 3300005459 Bacteria 9026
55 Ga0068867_100551869 3300005459 Bacteria 998
56 Ga0070679_100029883 3300005530 Bacteria 5377
57 Ga0070684_100029676 3300005535 Bacteria 4637
58 Ga0068853_100093987 3300005539 Bacteria 2641
59 Ga0068853_100098335 3300005539 Bacteria 2584
60 Ga0068853_100117946 3300005539 Bacteria 2365
61 Ga0068853_100559188 3300005539 Bacteria 1084
62 Ga0070686_100350277 3300005544 Unclassified 1109
63 Ga0070665_100000017 3300005548 Bacteria 448013
64 Ga0070665_100006883 3300005548 Bacteria 11557
65 Ga0070665_100641306 3300005548 Bacteria 1075
66 Ga0068855_100000160 3300005563 Bacteria 86118
67 Ga0068855_100034280 3300005563 Bacteria 6056
68 Ga0068855_100081545 3300005563 Bacteria 3749
69 Ga0068855_100084025 3300005563 Unclassified 3687
70 Ga0068855_100094953 3300005563 Bacteria 3438
71 Ga0068855_100095334 3300005563 Bacteria 3430
72 Ga0068857_100088507 3300005577 Unclassified 2770
73 Ga0068856_100000399 3300005614 Bacteria 47601
74 Ga0068856_100421801 3300005614 Bacteria 1354
75 Ga0068856_100476576 3300005614 Bacteria 1269
76 Ga0068856_100533950 3300005614 Bacteria 1194
77 Ga0068856_100626067 3300005614 Bacteria 1097
78 Ga0068852_100651113 3300005616 Bacteria 1061
79 Ga0068864_100995302 3300005618 Bacteria 831
80 Ga0068851_10112159 3300005834 Bacteria 1457
81 Ga0068858_100534451 3300005842 Bacteria 1134
82 Ga0075366_10000107 3300006195 Bacteria 33692
83 Ga0075366_10000744 3300006195 Bacteria 15489
84 Ga0075366_10097379 3300006195 Bacteria 1764
85 Ga0097621_100000017 3300006237 Bacteria 90529
86 Ga0075370_10308430 3300006353 Bacteria 942
87 Ga0068871_100000382 3300006358 Bacteria 31056
88 Ga0075428_100020561 3300006844 Bacteria 7309
89 Ga0068865_100000588 3300006881 Bacteria 20399
90 Ga0068865_100651213 3300006881 Bacteria 895
91 Ga0105240_10000011 3300009093 Bacteria 523646
92 Ga0105240_10032900 3300009093 Bacteria 6706
93 Ga0105240_10035797 3300009093 Bacteria 6393
94 Ga0105240_10123907 3300009093 Bacteria 3109
95 Ga0105240_10366256 3300009093 Bacteria 1631
96 Ga0105240_10598344 3300009093 Bacteria 1214
97 Ga0105240_10640943 3300009093 Bacteria 1166
98 Ga0111539_10010811 3300009094 Bacteria 11490
99 Ga0105243_10000046 3300009148 Bacteria 155277
100 Ga0105243_11165093 3300009148 Bacteria 782
101 Ga0105241_10001226 3300009174 Bacteria 19619
102 Ga0105241_10007524 3300009174 Bacteria 8012
103 Ga0105241_10030386 3300009174 Bacteria 4037
104 Ga0105241_10310385 3300009174 Bacteria 1357
105 Ga0105242_10010296 3300009176 Bacteria 7170
106 Ga0105242_10027841 3300009176 Bacteria 4494
107 Ga0105242_10281671 3300009176 Unclassified 1510
108 Ga0105237_10006545 3300009545 Bacteria 12887
109 Ga0105237_10007575 3300009545 Bacteria 11868
110 Ga0105237_10029873 3300009545 Bacteria 5536
111 Ga0105237_10048048 3300009545 Bacteria 4290
112 Ga0105237_10061672 3300009545 Bacteria 3748
113 Ga0105237_10578492 3300009545 Bacteria 1130
114 Ga0105238_10018325 3300009551 Bacteria 7124
115 Ga0105238_10065217 3300009551 Bacteria 3642
116 Ga0105238_10476517 3300009551 Bacteria 1247
117 Ga0105238_10552788 3300009551 Unclassified 1156
118 Ga0105249_10288342 3300009553 Bacteria 1642
119 Ga0105239_10000095 3300010375 Bacteria 124330
120 Ga0105239_10000122 3300010375 Bacteria 109167
121 Ga0105239_10000161 3300010375 Bacteria 97242
122 Ga0105239_10000708 3300010375 Bacteria 47248
123 Ga0105239_10003554 3300010375 Bacteria 19061
124 Ga0105239_10056789 3300010375 Bacteria 4294
125 Ga0105239_10066927 3300010375 Bacteria 3946
126 Ga0105239_10070823 3300010375 Bacteria 3830
127 Ga0105239_10113114 3300010375 Bacteria 3010
128 Ga0105239_10778437 3300010375 Unclassified 1096
129 Ga0157373_10000150 3300013100 Bacteria 56030
130 Ga0157373_10000509 3300013100 Bacteria 30602
131 Ga0157371_10000297 3300013102 Bacteria 65919
132 Ga0157371_10036406 3300013102 Bacteria 3524
133 Ga0157371_10122065 3300013102 Bacteria 1853
134 Ga0157370_10038733 3300013104 Bacteria 4610
135 Ga0157370_10043758 3300013104 Bacteria 4308
136 Ga0157370_10051490 3300013104 Unclassified 3934
137 Ga0157370_10194722 3300013104 Bacteria 1881
138 Ga0157370_10459530 3300013104 Bacteria 1170
139 Ga0157369_10002452 3300013105 Bacteria 22259
140 Ga0157369_10046973 3300013105 Bacteria 4689
141 Ga0157369_10321816 3300013105 Bacteria 1608
142 Ga0157374_10000122 3300013296 Bacteria 70398
143 Ga0157374_10001925 3300013296 Bacteria 17411
144 Ga0157374_10002696 3300013296 Bacteria 14924
145 Ga0157374_10212680 3300013296 Bacteria 1896
146 Ga0157374_10435277 3300013296 Unclassified 1311
147 Ga0157378_10009225 3300013297 Bacteria 8593
148 Ga0157378_10011475 3300013297 Bacteria 7753
149 Ga0157378_10123586 3300013297 Bacteria 2388
150 Ga0163162_10000011 3300013306 Bacteria 299877
151 Ga0163162_10000071 3300013306 Bacteria 94831
152 Ga0163162_10001312 3300013306 Bacteria 23236
153 Ga0163162_10490610 3300013306 Bacteria 1359
154 Ga0157372_10000077 3300013307 Bacteria 102192
155 Ga0157372_10000285 3300013307 Bacteria 56173
156 Ga0157372_10001304 3300013307 Bacteria 26971
157 Ga0157372_10009576 3300013307 Bacteria 10298
158 Ga0157372_10010462 3300013307 Bacteria 9872
159 Ga0157372_10228902 3300013307 Bacteria 2155
160 Ga0157372_10671003 3300013307 Bacteria 1207
161 Ga0157372_11118344 3300013307 Bacteria 911
162 Ga0157380_10000008 3300014326 Bacteria 154993
163 Ga0157376_10021004 3300014969 Bacteria 5065
164 Ga0182007_10048540 3300015262 Bacteria 1403
165 Ga0183373_1002 3300015682 Bacteria 990153
166 Ga0163161_10907952 3300017792 Unclassified 747
167 Ga0213872_10015536 3300021361 Bacteria 3537
168 Ga0207427_100071 3300025231 Bacteria 159974
169 Ga0209437_100021 3300025233 Bacteria 646400
170 Ga0209437_100124 3300025233 Bacteria 199789
171 Ga0209026_1000250 3300025250 Bacteria 68451
172 Ga0209026_1005861 3300025250 Bacteria 3169
173 Ga0209026_1006790 3300025250 Bacteria 2721
174 Ga0209129_1012623 3300025258 Bacteria 1924
175 Ga0209233_1000035 3300025261 Bacteria 568478
176 Ga0209233_1015534 3300025261 Unclassified 2118
177 Ga0209455_1002730 3300025272 Bacteria 6626
178 Ga0209257_1000006 3300025304 Bacteria 1570111
179 Ga0207647_10000146 3300025904 Bacteria 56177
180 Ga0207647_10001267 3300025904 Bacteria 19442
181 Ga0207647_10186518 3300025904 Bacteria 1203
182 Ga0207645_10000502 3300025907 Bacteria 32417
183 Ga0207705_10000032 3300025909 Bacteria 224376
184 Ga0207705_10155574 3300025909 Bacteria 1715
185 Ga0207705_10306782 3300025909 Bacteria 1218
186 Ga0207705_10546897 3300025909 Bacteria 900
187 Ga0207654_10000684 3300025911 Bacteria 18967
188 Ga0207654_10001427 3300025911 Bacteria 12688
189 Ga0207695_10000010 3300025913 Bacteria 981919
190 Ga0207695_10000127 3300025913 Bacteria 227338
191 Ga0207695_10010077 3300025913 Bacteria 11604
192 Ga0207695_10071230 3300025913 Bacteria 3551
193 Ga0207695_10092507 3300025913 Bacteria 3034
194 Ga0207695_10185900 3300025913 Bacteria 1997
195 Ga0207695_10198036 3300025913 Bacteria 1924
196 Ga0207695_10261785 3300025913 Bacteria 1627
197 Ga0207695_10395441 3300025913 Bacteria 1267
198 Ga0207695_10490037 3300025913 Bacteria 1111
199 Ga0207695_10587082 3300025913 Bacteria 995
200 Ga0207671_10000438 3300025914 Bacteria 57265
201 Ga0207671_10001597 3300025914 Bacteria 25752
202 Ga0207671_10002672 3300025914 Bacteria 18703
203 Ga0207671_10002935 3300025914 Bacteria 17576
204 Ga0207671_10007650 3300025914 Bacteria 9333
205 Ga0207671_10047923 3300025914 Bacteria 3162
206 Ga0207671_10054139 3300025914 Bacteria 2973
207 Ga0207671_10396486 3300025914 Bacteria 1097
208 Ga0207657_10016245 3300025919 Bacteria 7184
209 Ga0207657_10094377 3300025919 Bacteria 2491
210 Ga0207657_10227720 3300025919 Bacteria 1491
211 Ga0207657_10485589 3300025919 Bacteria 968
212 Ga0207652_10021045 3300025921 Bacteria 5380
213 Ga0207694_10012096 3300025924 Bacteria 6507
214 Ga0207694_10164386 3300025924 Bacteria 1794
215 Ga0207694_10391434 3300025924 Unclassified 1155
216 Ga0207644_10006310 3300025931 Bacteria 7720
217 Ga0207690_10000049 3300025932 Bacteria 113589
218 Ga0207690_10008615 3300025932 Bacteria 6049
219 Ga0207706_10000007 3300025933 Bacteria 211081
220 Ga0207686_10035140 3300025934 Bacteria 3006
221 Ga0207686_10073350 3300025934 Bacteria 2208
222 Ga0207709_10000020 3300025935 Bacteria 392366
223 Ga0207669_10476031 3300025937 Bacteria 994
224 Ga0207704_10000033 3300025938 Bacteria 101319
225 Ga0207661_10045175 3300025944 Bacteria 3485
226 Ga0207667_10000033 3300025949 Bacteria 314353
227 Ga0207667_10011959 3300025949 Bacteria 10047
228 Ga0207667_10041243 3300025949 Bacteria 4910
229 Ga0207667_10143088 3300025949 Bacteria 2462
230 Ga0207651_10004742 3300025960 Bacteria 6909
231 Ga0207651_10443944 3300025960 Bacteria 1112
232 Ga0207712_10207937 3300025961 Bacteria 1556
233 Ga0207640_10125362 3300025981 Bacteria 1848
234 Ga0207677_10091989 3300026023 Bacteria 2208
235 Ga0207703_10456936 3300026035 Unclassified 1194
236 Ga0207639_10009365 3300026041 Bacteria 6753
237 Ga0207639_10090866 3300026041 Bacteria 2443
238 Ga0207639_10091145 3300026041 Bacteria 2440
239 Ga0207702_10010102 3300026078 Bacteria 7909
240 Ga0207702_10027712 3300026078 Bacteria 4706
241 Ga0207702_10271784 3300026078 Bacteria 1599
242 Ga0207702_10494006 3300026078 Bacteria 1192
243 Ga0207702_10724480 3300026078 Bacteria 981
244 Ga0207648_10003681 3300026089 Bacteria 16038
245 Ga0207674_10016248 3300026116 Bacteria 8152
246 Ga0207683_10004961 3300026121 Bacteria 11442
247 Ga0207698_10395407 3300026142 Bacteria 1319
248 Ga0268266_10000195 3300028379 Bacteria 105788
249 Ga0268266_10021858 3300028379 Bacteria 5451
250 Ga0268266_10567508 3300028379 Bacteria 1088
251 Ga0307517_10000335 3300028786 Bacteria 81908
252 Ga0307515_10000081 3300028794 Bacteria 224753
253 Ga0307515_10007156 3300028794 Bacteria 22140
254 Ga0307515_10153459 3300028794 Bacteria 2393
255 Ga0307515_10310343 3300028794 Bacteria 1253
256 Ga0265338_10027493 3300028800 Bacteria 5705
257 Ga0265338_10034270 3300028800 Unclassified 4911
258 Ga0316176_1007214 3300030732 Bacteria 17102
259 Ga0316183_1006105 3300030742 Bacteria 90612
260 Ga0316181_1071217 3300030744 Unclassified 2950
261 Ga0316182_1041168 3300030745 Bacteria 1433
262 Ga0265331_10095434 3300031250 Bacteria 1372
263 Ga0265327_10000038 3300031251 Bacteria 292416
264 Ga0265327_10000089 3300031251 Bacteria 197227
265 Ga0265327_10000296 3300031251 Bacteria 96658
266 Ga0265327_10005806 3300031251 Bacteria 10140
267 Ga0265327_10018205 3300031251 Bacteria 4365
268 Ga0265327_10155157 3300031251 Unclassified 1061
269 Ga0307509_10015955 3300031507 Bacteria 8723
270 Ga0307509_10080953 3300031507 Bacteria 3357
271 Ga0307408_100001056 3300031548 Bacteria 21143
272 Ga0265314_10004313 3300031711 Bacteria 13277
273 Ga0307410_10109617 3300031852 Bacteria 1995
274 Ga0307412_10036332 3300031911 Bacteria 3155
275 Ga0307412_10059042 3300031911 Bacteria 2569
276 Ga0307409_100045814 3300031995 Bacteria 3305
277 Ga0307409_100128936 3300031995 Bacteria 2157
278 Ga0307416_100004189 3300032002 Bacteria 8647
279 Ga0307414_10822256 3300032004 Bacteria 848
280 Ga0307411_10285104 3300032005 Bacteria 1317
281 Ga0307415_100009833 3300032126 Bacteria 5388
282 Ga0307507_10000097 3300033179 Bacteria 139761
283 Ga0307510_10002118 3300033180 Bacteria 22455
284 Ga0316584_0492287 3300036712 Bacteria 862
285 Ga0395899_0000152 3300037312 Bacteria 105233
286 Ga0395899_0002794 3300037312 Bacteria 14063
287 Ga0395899_0352631 3300037312 Bacteria 984
288 Ga0395900_0000288 3300037418 Bacteria 75715
289 Ga0395900_0004910 3300037418 Bacteria 14077
290 Ga0395900_0027354 3300037418 Bacteria 5840
291 Ga0395898_0065115 3300037466 Bacteria 3534
292 Ga0395898_0278016 3300037466 Unclassified 1597
293 Ga0395905_0000001 3300037471 Bacteria 2037079
294 Ga0395905_0018603 3300037471 Bacteria 6591
295 Ga0395901_0020318 3300038443 Bacteria 6798
296 Ga0395901_0111916 3300038443 Bacteria 2867
297 Ga0395901_0116390 3300038443 Unclassified 2808
298 Ga0436361_1222875 3300039447 Bacteria 13496
299 Ga0451802_0491918 3300041460 Unclassified 641
300 Ga0451804_0069962 3300041463 Bacteria 822
301 Ga0451807_2643164 3300041486 Bacteria 723
302 Ga0451833_0017293 3300041491 Bacteria 732
303 Ga0451837_0688012 3300041494 Bacteria 1285
304 Ga0451837_1404140 3300041494 Bacteria 1495
305 Ga0439431_0000493 3300041997 Bacteria 8352
306 Ga0439445_0004333 3300042004 Bacteria 3213
307 Ga0439448_0000917 3300042005 Bacteria 7257
308 Ga0439449_0015842 3300042007 Bacteria 2834
309 Ga0451577_0000452 3300042876 Bacteria 71587
310 Ga0451577_0087539 3300042876 Unclassified 2779
311 Ga0451577_0104106 3300042876 Unclassified 2536
312 Ga0453683_0000109 3300044673 Bacteria 123662
313 Ga0466965_0074647 3300044683 Bacteria 1709
314 Ga0466966_0598040 3300044684 Bacteria 664
315 Ga0466961_0045428 3300044693 Bacteria 2810
316 Ga0453684_0000283 3300044712 Bacteria 219542
317 Ga0453684_0001960 3300044712 Bacteria 53054
318 Ga0453684_0008113 3300044712 Bacteria 18972
319 Ga0453684_0012736 3300044712 Bacteria 13810
320 Ga0453684_0105791 3300044712 Unclassified 3431
321 Ga0453684_0192487 3300044712 Bacteria 2385
322 Ga0453684_0595083 3300044712 Bacteria 1213
323 Ga0453684_0836839 3300044712 Bacteria 990
324 Ga0466970_0167160 3300044765 Bacteria 1218
325 Ga0466957_0575229 3300044842 Unclassified 787
326 Ga0466959_0037151 3300045049 Bacteria 3599
327 Ga0466959_0233295 3300045049 Bacteria 1273
328 Ga0451576_0000047 3300045051 Bacteria 329357
329 Ga0451576_0007591 3300045051 Bacteria 12920
330 Ga0451576_0008658 3300045051 Bacteria 11915
331 Ga0451576_0399626 3300045051 Bacteria 1441
332 Ga0466958_0010241 3300045836 Bacteria 5246
333 Ga0495627_012397 3300046453 Bacteria 3026
334 Ga0495638_0078155 3300046460 Bacteria 2014
335 Ga0495638_0082127 3300046460 Bacteria 1955
336 Ga0495651_0054300 3300046462 Bacteria 3082
337 Ga0495650_0000095 3300046471 Bacteria 218020
338 Ga0495650_0015455 3300046471 Bacteria 3915
339 Ga0495650_0180319 3300046471 Bacteria 743
340 Ga0495585_0000034 3300046492 Bacteria 143120
341 Ga0495585_0001255 3300046492 Bacteria 20460
342 Ga0495583_0004729 3300046506 Bacteria 9576
343 Ga0495606_0000009 3300046507 Bacteria 306313
344 Ga0495606_0007225 3300046507 Bacteria 10014
345 Ga0495606_0011487 3300046507 Bacteria 7220
346 Ga0495610_0003578 3300046512 Bacteria 12006
347 Ga0495616_0003331 3300046513 Bacteria 10322
348 Ga0495631_0002842 3300046518 Bacteria 9612
349 Ga0495631_0171107 3300046518 Bacteria 931
350 Ga0495632_0131923 3300046519 Bacteria 1162
351 Ga0495644_0022414 3300046523 Bacteria 2407
352 Ga0495648_0015321 3300046524 Bacteria 5573
353 Ga0495663_0145161 3300046525 Bacteria 807
354 Ga0495652_0138250 3300046529 Bacteria 1919
355 Ga0495652_0232153 3300046529 Bacteria 1379
356 Ga0495652_0410817 3300046529 Bacteria 956
357 Ga0495654_0039431 3300046530 Bacteria 2358
358 Ga0495609_0009733 3300046538 Bacteria 4636
359 Ga0495609_0051802 3300046538 Bacteria 1827
360 Ga0495622_0141840 3300046557 Bacteria 1090
361 Ga0495633_0000017 3300046558 Bacteria 249973
362 Ga0495633_0000042 3300046558 Bacteria 173748
363 Ga0495633_0013498 3300046558 Bacteria 4303
364 Ga0495633_0064852 3300046558 Bacteria 1707
365 Ga0495668_0000058 3300046616 Bacteria 195501
366 Ga0495668_0068441 3300046616 Bacteria 1953
367 Ga0495668_0152857 3300046616 Bacteria 1264
368 Ga0495634_0339288 3300046642 Bacteria 902
369 Ga0495611_0209915 3300046648 Bacteria 907
370 Ga0495625_0000007 3300046660 Bacteria 565749
371 Ga0495625_0005655 3300046660 Bacteria 11328
372 Ga0495625_0008788 3300046660 Bacteria 8554
373 Ga0495625_0018751 3300046660 Bacteria 5390
374 Ga0495625_0057837 3300046660 Bacteria 2756
375 Ga0495625_0124059 3300046660 Bacteria 1755
376 Ga0495625_0161496 3300046660 Bacteria 1501
377 Ga0495625_0193828 3300046660 Bacteria 1344
378 Ga0495661_0002451 3300046665 Bacteria 14291
379 Ga0495661_0289082 3300046665 Bacteria 824
380 Ga0495658_0045548 3300046683 Bacteria 2462
381 Ga0495669_0113087 3300046684 Bacteria 1269
382 Ga0495670_0022830 3300046691 Bacteria 3090
383 Ga0495671_0104830 3300046692 Bacteria 1381
384 Ga0495649_0000007 3300046694 Bacteria 518037
385 Ga0495649_0081741 3300046694 Bacteria 1727
386 Ga0495589_0104389 3300046794 Bacteria 1370
387 Ga0495600_0288478 3300046809 Bacteria 1037
388 Ga0495660_0026355 3300046810 Bacteria 3296
389 Ga0495660_0158024 3300046810 Bacteria 1114
390 Ga0495636_0000184 3300047318 Bacteria 24852
391 Ga0495683_0028159 3300047323 Bacteria 2873
392 Ga0495683_0078015 3300047323 Bacteria 1619
393 Ga0495687_000846 3300047443 Bacteria 32608
394 Ga0495687_155272 3300047443 Bacteria 777
395 Ga0495685_035888 3300047447 Bacteria 1703
396 Ga0495673_0008158 3300047469 Bacteria 5922
397 Ga0495681_0169763 3300047470 Bacteria 903
398 Ga0495686_0000614 3300047472 Bacteria 49242
399 Ga0495686_0001530 3300047472 Bacteria 24840
400 Ga0495686_0030845 3300047472 Bacteria 3480
401 Ga0495686_0441510 3300047472 Bacteria 692
402 Ga0496114_0000134 3300048917 Bacteria 53462
403 Ga0496116_0004756 3300048919 Bacteria 12822
404 Ga0496117_0000995 3300048920 Bacteria 43366
405 Ga0496118_0130271 3300048921 Bacteria 1617
406 Ga0496123_0027067 3300048926 Bacteria 4279
407 Ga0495678_014667 3300049459 Bacteria 3637
408 Ga0495682_0018844 3300049460 Bacteria 2599
409 Ga0501225_0026156 3300049705 Unclassified 1606
410 Ga0501268_044416 3300049765 Bacteria 845
411 Ga0501035_0166508 3300049822 Bacteria 1906
412 nmdc:mga0k408_12250_c1 3300050493 Bacteria 4686
413 nmdc:mga0k408_135_c1 3300050493 Bacteria 36841
414 nmdc:mga0k408_429_c1 3300050493 Bacteria 22975
415 nmdc:mga06r32_630206_c1 3300050510 Bacteria 1041
416 nmdc:mga08y16_53095_c1 3300050511 Unclassified 4239
417 Ga0500635_0000752 3300053080 Bacteria 8075
418 Ga0500578_0176868 3300053086 Bacteria 1317
419 Ga0500583_0306018 3300053092 Bacteria 777
420 Ga0500650_0130254 3300053098 Bacteria 1170
421 Ga0500608_001569 3300053122 Bacteria 8197
422 Ga0500614_091073 3300053123 Bacteria 866
423 Ga0500618_000481 3300053125 Bacteria 25631
424 Ga0500618_083781 3300053125 Bacteria 715
425 Ga0500652_172689 3300053131 Bacteria 889
426 Ga0500568_0179429 3300053139 Bacteria 779
427 Ga0500616_0042623 3300053153 Bacteria 2430
428 Ga0500622_0000319 3300053156 Bacteria 48315
429 Ga0500622_0002244 3300053156 Bacteria 14209
430 Ga0500622_0081573 3300053156 Bacteria 1619
431 Ga0500624_000183 3300053157 Bacteria 24891
432 Ga0500634_0064947 3300053161 Bacteria 1927
433 Ga0500656_041132 3300053732 Bacteria 647
434 Ga0500552_006660 3300053733 Bacteria 1305

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053732 Ga0500656_041132 Ga0500656_041132_86_616 173
2 3300031251 Ga0265327_10000038 Ga0265327_1000003877 180
3 3300041460 Ga0451802_0491918 Ga0451802_0491918_31_618 190
4 3300041486 Ga0451807_2643164 Ga0451807_2643164_106_693 190
5 3300031711 Ga0265314_10004313 Ga0265314_100043134 197
6 3300044712 Ga0453684_0192487 Ga0453684_0192487_1176_1835 202
7 3300046648 Ga0495611_0209915 Ga0495611_0209915_20_634 202
8 iso_pu_bacteria 2599185184 2599480791 206
9 iso_pu_bacteria 2852623160 2852626515 206
10 iso_pu_bacteria 2884933994 2884934941 206
11 iso_pu_bacteria 2919437846 2919439712 206
12 iso_pu_bacteria 2928078545 2928081687 206
13 iso_pu_bacteria 2928147474 2928150285 206
14 iso_pu_bacteria 2932082852 2932085110 206
15 3300044712 Ga0453684_0105791 Ga0453684_0105791_1764_2396 207
16 iso_pu_bacteria 2842903701 2842907276 207
17 iso_pu_bacteria 2883068021 2883073132 207
18 iso_pu_bacteria 2890804823 2890805808 207
19 iso_pu_bacteria 2896085136 2896087448 207
20 iso_pu_bacteria 2896344016 2896347309 207
21 iso_pu_bacteria 2910245624 2910246298 207
22 iso_pu_bacteria 2919177583 2919178498 207
23 3300028794 Ga0307515_10007156 Ga0307515_100071568 209
24 3300001979 JGI24740J21852_10078012 JGI24740J21852_100780121 210
25 3300001990 JGI24737J22298_10002990 JGI24737J22298_100029905 210
26 3300001990 JGI24737J22298_10017236 JGI24737J22298_100172362 210
27 3300001991 JGI24743J22301_10000856 JGI24743J22301_100008564 210
28 3300002067 JGI24735J21928_10026239 JGI24735J21928_100262393 210
29 3300002077 JGI24744J21845_10004162 JGI24744J21845_100041621 210
30 3300002741 JGI25157J39369_1010215 JGI25157J39369_10102151 210
31 3300003316 rootH1_10008730 rootH1_100087303 210
32 3300003316 rootH1_10119392 rootH1_101193923 210
33 3300003320 rootH2_10000579 rootH2_10000579126 210
34 3300003322 rootL2_10208326 rootL2_102083263 210
35 3300005288 Ga0065714_10008186 Ga0065714_100081862 210
36 3300005288 Ga0065714_10211774 Ga0065714_102117742 210
37 3300005327 Ga0070658_10000032 Ga0070658_10000032126 210
38 3300005327 Ga0070658_10147027 Ga0070658_101470272 210
39 3300005327 Ga0070658_10265188 Ga0070658_102651882 210
40 3300005338 Ga0068868_100104169 Ga0068868_1001041693 210
41 3300005339 Ga0070660_100370305 Ga0070660_1003703052 210
42 3300005356 Ga0070674_100485354 Ga0070674_1004853542 210
43 3300005364 Ga0070673_100004132 Ga0070673_1000041327 210
44 3300005366 Ga0070659_100003119 Ga0070659_10000311911 210
45 3300005456 Ga0070678_100002599 Ga0070678_1000025997 210
46 3300005457 Ga0070662_100001063 Ga0070662_10000106314 210
47 3300005459 Ga0068867_100005421 Ga0068867_1000054216 210
48 3300005530 Ga0070679_100029883 Ga0070679_1000298835 210
49 3300005539 Ga0068853_100093987 Ga0068853_1000939873 210
50 3300005539 Ga0068853_100098335 Ga0068853_1000983352 210
51 3300005539 Ga0068853_100117946 Ga0068853_1001179463 210
52 3300005548 Ga0070665_100000017 Ga0070665_100000017369 210
53 3300005563 Ga0068855_100034280 Ga0068855_1000342805 210
54 3300005563 Ga0068855_100081545 Ga0068855_1000815453 210
55 3300005563 Ga0068855_100094953 Ga0068855_1000949534 210
56 3300005563 Ga0068855_100095334 Ga0068855_1000953342 210
57 3300005577 Ga0068857_100088507 Ga0068857_1000885073 210
58 3300005614 Ga0068856_100000399 Ga0068856_10000039923 210
59 3300005614 Ga0068856_100476576 Ga0068856_1004765762 210
60 3300005614 Ga0068856_100533950 Ga0068856_1005339502 210
61 3300005616 Ga0068852_100651113 Ga0068852_1006511132 210
62 3300005834 Ga0068851_10112159 Ga0068851_101121592 210
63 3300006195 Ga0075366_10000107 Ga0075366_1000010732 210
64 3300006195 Ga0075366_10000744 Ga0075366_1000074410 210
65 3300006195 Ga0075366_10097379 Ga0075366_100973792 210
66 3300006237 Ga0097621_100000017 Ga0097621_10000001779 210
67 3300006358 Ga0068871_100000382 Ga0068871_10000038220 210
68 3300006881 Ga0068865_100000588 Ga0068865_1000005887 210
69 3300009093 Ga0105240_10032900 Ga0105240_100329006 210
70 3300009093 Ga0105240_10035797 Ga0105240_100357975 210
71 3300009093 Ga0105240_10123907 Ga0105240_101239073 210
72 3300009093 Ga0105240_10598344 Ga0105240_105983442 210
73 3300009093 Ga0105240_10640943 Ga0105240_106409432 210
74 3300009148 Ga0105243_11165093 Ga0105243_111650931 210
75 3300009174 Ga0105241_10001226 Ga0105241_1000122614 210
76 3300009174 Ga0105241_10007524 Ga0105241_100075247 210
77 3300009174 Ga0105241_10030386 Ga0105241_100303864 210
78 3300009174 Ga0105241_10310385 Ga0105241_103103852 210
79 3300009176 Ga0105242_10010296 Ga0105242_100102969 210
80 3300009545 Ga0105237_10007575 Ga0105237_100075752 210
81 3300009545 Ga0105237_10029873 Ga0105237_100298734 210
82 3300009545 Ga0105237_10048048 Ga0105237_100480485 210
83 3300009545 Ga0105237_10061672 Ga0105237_100616724 210
84 3300009551 Ga0105238_10018325 Ga0105238_100183255 210
85 3300009551 Ga0105238_10065217 Ga0105238_100652173 210
86 3300009551 Ga0105238_10476517 Ga0105238_104765172 210
87 3300009553 Ga0105249_10288342 Ga0105249_102883422 210
88 3300010375 Ga0105239_10000095 Ga0105239_1000009565 210
89 3300010375 Ga0105239_10000161 Ga0105239_1000016128 210
90 3300010375 Ga0105239_10000708 Ga0105239_1000070828 210
91 3300010375 Ga0105239_10003554 Ga0105239_1000355420 210
92 3300010375 Ga0105239_10056789 Ga0105239_100567892 210
93 3300010375 Ga0105239_10066927 Ga0105239_100669272 210
94 3300010375 Ga0105239_10070823 Ga0105239_100708231 210
95 3300010375 Ga0105239_10113114 Ga0105239_101131143 210
96 3300013100 Ga0157373_10000509 Ga0157373_100005093 210
97 3300013102 Ga0157371_10000297 Ga0157371_1000029714 210
98 3300013104 Ga0157370_10051490 Ga0157370_100514904 210
99 3300013104 Ga0157370_10194722 Ga0157370_101947222 210
100 3300013105 Ga0157369_10002452 Ga0157369_1000245220 210
101 3300013105 Ga0157369_10046973 Ga0157369_100469732 210
102 3300013296 Ga0157374_10000122 Ga0157374_1000012241 210
103 3300013296 Ga0157374_10002696 Ga0157374_100026967 210
104 3300013296 Ga0157374_10212680 Ga0157374_102126802 210
105 3300013296 Ga0157374_10435277 Ga0157374_104352772 210
106 3300013297 Ga0157378_10011475 Ga0157378_100114756 210
107 3300013297 Ga0157378_10123586 Ga0157378_101235863 210
108 3300013306 Ga0163162_10000071 Ga0163162_1000007137 210
109 3300013306 Ga0163162_10001312 Ga0163162_1000131219 210
110 3300013307 Ga0157372_10000077 Ga0157372_1000007793 210
111 3300013307 Ga0157372_10000285 Ga0157372_1000028530 210
112 3300013307 Ga0157372_10009576 Ga0157372_100095766 210
113 3300013307 Ga0157372_10228902 Ga0157372_102289022 210
114 3300014969 Ga0157376_10021004 Ga0157376_100210043 210
115 3300015262 Ga0182007_10048540 Ga0182007_100485402 210
116 3300021361 Ga0213872_10015536 Ga0213872_100155361 210
117 3300025233 Ga0209437_100124 Ga0209437_100124110 210
118 3300025250 Ga0209026_1005861 Ga0209026_10058614 210
119 3300025250 Ga0209026_1006790 Ga0209026_10067904 210
120 3300025258 Ga0209129_1012623 Ga0209129_10126231 210
121 3300025261 Ga0209233_1015534 Ga0209233_10155341 210
122 3300025272 Ga0209455_1002730 Ga0209455_10027305 210
123 3300025904 Ga0207647_10000146 Ga0207647_1000014629 210
124 3300025904 Ga0207647_10001267 Ga0207647_100012678 210
125 3300025907 Ga0207645_10000502 Ga0207645_1000050210 210
126 3300025909 Ga0207705_10000032 Ga0207705_1000003295 210
127 3300025909 Ga0207705_10155574 Ga0207705_101555742 210
128 3300025909 Ga0207705_10546897 Ga0207705_105468971 210
129 3300025911 Ga0207654_10000684 Ga0207654_1000068417 210
130 3300025911 Ga0207654_10001427 Ga0207654_100014272 210
131 3300025913 Ga0207695_10000127 Ga0207695_1000012733 210
132 3300025913 Ga0207695_10071230 Ga0207695_100712305 210
133 3300025913 Ga0207695_10092507 Ga0207695_100925073 210
134 3300025913 Ga0207695_10185900 Ga0207695_101859003 210
135 3300025913 Ga0207695_10198036 Ga0207695_101980362 210
136 3300025913 Ga0207695_10261785 Ga0207695_102617852 210
137 3300025913 Ga0207695_10395441 Ga0207695_103954412 210
138 3300025913 Ga0207695_10490037 Ga0207695_104900372 210
139 3300025913 Ga0207695_10587082 Ga0207695_105870821 210
140 3300025914 Ga0207671_10001597 Ga0207671_1000159711 210
141 3300025914 Ga0207671_10002672 Ga0207671_100026724 210
142 3300025914 Ga0207671_10002935 Ga0207671_100029355 210
143 3300025914 Ga0207671_10007650 Ga0207671_1000765011 210
144 3300025914 Ga0207671_10047923 Ga0207671_100479235 210
145 3300025914 Ga0207671_10054139 Ga0207671_100541394 210
146 3300025919 Ga0207657_10016245 Ga0207657_100162454 210
147 3300025919 Ga0207657_10227720 Ga0207657_102277203 210
148 3300025919 Ga0207657_10485589 Ga0207657_104855892 210
149 3300025921 Ga0207652_10021045 Ga0207652_100210454 210
150 3300025924 Ga0207694_10012096 Ga0207694_100120966 210
151 3300025924 Ga0207694_10164386 Ga0207694_101643862 210
152 3300025931 Ga0207644_10006310 Ga0207644_100063102 210
153 3300025932 Ga0207690_10008615 Ga0207690_100086157 210
154 3300025933 Ga0207706_10000007 Ga0207706_1000000758 210
155 3300025934 Ga0207686_10035140 Ga0207686_100351402 210
156 3300025937 Ga0207669_10476031 Ga0207669_104760311 210
157 3300025938 Ga0207704_10000033 Ga0207704_1000003370 210
158 3300025949 Ga0207667_10011959 Ga0207667_100119596 210
159 3300025949 Ga0207667_10041243 Ga0207667_100412433 210
160 3300025949 Ga0207667_10143088 Ga0207667_101430884 210
161 3300025960 Ga0207651_10004742 Ga0207651_100047427 210
162 3300025960 Ga0207651_10443944 Ga0207651_104439442 210
163 3300025961 Ga0207712_10207937 Ga0207712_102079372 210
164 3300025981 Ga0207640_10125362 Ga0207640_101253622 210
165 3300026023 Ga0207677_10091989 Ga0207677_100919893 210
166 3300026041 Ga0207639_10009365 Ga0207639_100093657 210
167 3300026041 Ga0207639_10090866 Ga0207639_100908662 210
168 3300026041 Ga0207639_10091145 Ga0207639_100911453 210
169 3300026078 Ga0207702_10010102 Ga0207702_100101023 210
170 3300026078 Ga0207702_10027712 Ga0207702_100277124 210
171 3300026078 Ga0207702_10271784 Ga0207702_102717842 210
172 3300026078 Ga0207702_10494006 Ga0207702_104940062 210
173 3300026078 Ga0207702_10724480 Ga0207702_107244801 210
174 3300026089 Ga0207648_10003681 Ga0207648_1000368110 210
175 3300026116 Ga0207674_10016248 Ga0207674_100162487 210
176 3300026121 Ga0207683_10004961 Ga0207683_100049619 210
177 3300026142 Ga0207698_10395407 Ga0207698_103954072 210
178 3300028379 Ga0268266_10000195 Ga0268266_1000019548 210
179 3300028786 Ga0307517_10000335 Ga0307517_1000033531 210
180 3300028794 Ga0307515_10000081 Ga0307515_10000081138 210
181 3300028794 Ga0307515_10153459 Ga0307515_101534593 210
182 3300028800 Ga0265338_10027493 Ga0265338_100274935 210
183 3300031852 Ga0307410_10109617 Ga0307410_101096173 210
184 3300031911 Ga0307412_10059042 Ga0307412_100590422 210
185 3300031995 Ga0307409_100045814 Ga0307409_1000458143 210
186 3300031995 Ga0307409_100128936 Ga0307409_1001289363 210
187 3300033179 Ga0307507_10000097 Ga0307507_1000009749 210
188 3300033180 Ga0307510_10002118 Ga0307510_100021189 210
189 3300037312 Ga0395899_0000152 Ga0395899_0000152_76821_77459 210
190 3300037312 Ga0395899_0002794 Ga0395899_0002794_6487_7125 210
191 3300037312 Ga0395899_0352631 Ga0395899_0352631_144_782 210
192 3300037418 Ga0395900_0000288 Ga0395900_0000288_36726_37364 210
193 3300037418 Ga0395900_0004910 Ga0395900_0004910_3550_4188 210
194 3300037418 Ga0395900_0027354 Ga0395900_0027354_3867_4505 210
195 3300037466 Ga0395898_0065115 Ga0395898_0065115_2568_3206 210
196 3300037466 Ga0395898_0278016 Ga0395898_0278016_539_1177 210
197 3300037471 Ga0395905_0018603 Ga0395905_0018603_1308_1946 210
198 3300038443 Ga0395901_0020318 Ga0395901_0020318_1629_2267 210
199 3300038443 Ga0395901_0111916 Ga0395901_0111916_514_1152 210
200 3300038443 Ga0395901_0116390 Ga0395901_0116390_244_882 210
201 3300039447 Ga0436361_1222875 Ga0436361_1222875_11088_11726 210
202 3300041491 Ga0451833_0017293 Ga0451833_0017293_41_679 210
203 3300041494 Ga0451837_1404140 Ga0451837_1404140_716_1348 210
204 3300042005 Ga0439448_0000917 Ga0439448_0000917_3194_3832 210
205 3300044673 Ga0453683_0000109 Ga0453683_0000109_11766_12410 210
206 3300044684 Ga0466966_0598040 Ga0466966_0598040_14_652 210
207 3300044693 Ga0466961_0045428 Ga0466961_0045428_1933_2571 210
208 3300044712 Ga0453684_0000283 Ga0453684_0000283_198595_199239 210
209 3300045049 Ga0466959_0037151 Ga0466959_0037151_106_744 210
210 3300045049 Ga0466959_0233295 Ga0466959_0233295_565_1203 210
211 3300045051 Ga0451576_0000047 Ga0451576_0000047_225739_226383 210
212 3300045836 Ga0466958_0010241 Ga0466958_0010241_3082_3720 210
213 3300046460 Ga0495638_0078155 Ga0495638_0078155_79_717 210
214 3300046460 Ga0495638_0082127 Ga0495638_0082127_917_1555 210
215 3300046462 Ga0495651_0054300 Ga0495651_0054300_265_903 210
216 3300046471 Ga0495650_0000095 Ga0495650_0000095_195957_196595 210
217 3300046471 Ga0495650_0015455 Ga0495650_0015455_1799_2437 210
218 3300046471 Ga0495650_0180319 Ga0495650_0180319_85_723 210
219 3300046492 Ga0495585_0000034 Ga0495585_0000034_42471_43109 210
220 3300046492 Ga0495585_0001255 Ga0495585_0001255_1023_1661 210
221 3300046506 Ga0495583_0004729 Ga0495583_0004729_8641_9279 210
222 3300046507 Ga0495606_0000009 Ga0495606_0000009_54204_54842 210
223 3300046507 Ga0495606_0007225 Ga0495606_0007225_1959_2597 210
224 3300046512 Ga0495610_0003578 Ga0495610_0003578_3212_3850 210
225 3300046513 Ga0495616_0003331 Ga0495616_0003331_6238_6876 210
226 3300046518 Ga0495631_0002842 Ga0495631_0002842_5343_5981 210
227 3300046518 Ga0495631_0171107 Ga0495631_0171107_200_838 210
228 3300046519 Ga0495632_0131923 Ga0495632_0131923_23_661 210
229 3300046523 Ga0495644_0022414 Ga0495644_0022414_447_1085 210
230 3300046524 Ga0495648_0015321 Ga0495648_0015321_3821_4459 210
231 3300046525 Ga0495663_0145161 Ga0495663_0145161_149_787 210
232 3300046529 Ga0495652_0138250 Ga0495652_0138250_93_731 210
233 3300046529 Ga0495652_0232153 Ga0495652_0232153_385_1023 210
234 3300046529 Ga0495652_0410817 Ga0495652_0410817_258_896 210
235 3300046530 Ga0495654_0039431 Ga0495654_0039431_1048_1686 210
236 3300046538 Ga0495609_0009733 Ga0495609_0009733_3297_3935 210
237 3300046538 Ga0495609_0051802 Ga0495609_0051802_121_759 210
238 3300046557 Ga0495622_0141840 Ga0495622_0141840_283_921 210
239 3300046558 Ga0495633_0000042 Ga0495633_0000042_160625_161263 210
240 3300046558 Ga0495633_0013498 Ga0495633_0013498_3447_4085 210
241 3300046558 Ga0495633_0064852 Ga0495633_0064852_530_1168 210
242 3300046616 Ga0495668_0000058 Ga0495668_0000058_17545_18183 210
243 3300046616 Ga0495668_0068441 Ga0495668_0068441_783_1421 210
244 3300046616 Ga0495668_0152857 Ga0495668_0152857_485_1123 210
245 3300046642 Ga0495634_0339288 Ga0495634_0339288_165_803 210
246 3300046660 Ga0495625_0005655 Ga0495625_0005655_10502_11140 210
247 3300046660 Ga0495625_0008788 Ga0495625_0008788_7845_8483 210
248 3300046660 Ga0495625_0018751 Ga0495625_0018751_966_1604 210
249 3300046660 Ga0495625_0057837 Ga0495625_0057837_1861_2499 210
250 3300046660 Ga0495625_0124059 Ga0495625_0124059_148_786 210
251 3300046660 Ga0495625_0193828 Ga0495625_0193828_228_866 210
252 3300046665 Ga0495661_0002451 Ga0495661_0002451_3361_3999 210
253 3300046665 Ga0495661_0289082 Ga0495661_0289082_70_708 210
254 3300046683 Ga0495658_0045548 Ga0495658_0045548_296_934 210
255 3300046684 Ga0495669_0113087 Ga0495669_0113087_502_1140 210
256 3300046691 Ga0495670_0022830 Ga0495670_0022830_427_1065 210
257 3300046694 Ga0495649_0081741 Ga0495649_0081741_683_1321 210
258 3300046794 Ga0495589_0104389 Ga0495589_0104389_404_1042 210
259 3300046809 Ga0495600_0288478 Ga0495600_0288478_251_889 210
260 3300046810 Ga0495660_0026355 Ga0495660_0026355_1599_2237 210
261 3300046810 Ga0495660_0158024 Ga0495660_0158024_209_847 210
262 3300047323 Ga0495683_0028159 Ga0495683_0028159_1073_1711 210
263 3300047323 Ga0495683_0078015 Ga0495683_0078015_184_822 210
264 3300047443 Ga0495687_000846 Ga0495687_000846_14046_14684 210
265 3300047443 Ga0495687_155272 Ga0495687_155272_119_757 210
266 3300047447 Ga0495685_035888 Ga0495685_035888_401_1039 210
267 3300047469 Ga0495673_0008158 Ga0495673_0008158_1684_2322 210
268 3300047470 Ga0495681_0169763 Ga0495681_0169763_124_762 210
269 3300047472 Ga0495686_0000614 Ga0495686_0000614_24956_25594 210
270 3300047472 Ga0495686_0001530 Ga0495686_0001530_2937_3575 210
271 3300047472 Ga0495686_0030845 Ga0495686_0030845_99_737 210
272 3300047472 Ga0495686_0441510 Ga0495686_0441510_44_682 210
273 3300048917 Ga0496114_0000134 Ga0496114_0000134_15621_16259 210
274 3300049459 Ga0495678_014667 Ga0495678_014667_1572_2210 210
275 3300049460 Ga0495682_0018844 Ga0495682_0018844_509_1147 210
276 3300049765 Ga0501268_044416 Ga0501268_044416_138_770 210
277 3300050493 nmdc:mga0k408_12250_c1 nmdc:mga0k408_12250_c1_1905_2543 210
278 3300050493 nmdc:mga0k408_135_c1 nmdc:mga0k408_135_c1_13374_14012 210
279 3300050493 nmdc:mga0k408_429_c1 nmdc:mga0k408_429_c1_6387_7025 210
280 3300053080 Ga0500635_0000752 Ga0500635_0000752_1256_1894 210
281 3300053092 Ga0500583_0306018 Ga0500583_0306018_70_708 210
282 3300053098 Ga0500650_0130254 Ga0500650_0130254_313_951 210
283 3300053122 Ga0500608_001569 Ga0500608_001569_790_1428 210
284 3300053123 Ga0500614_091073 Ga0500614_091073_137_775 210
285 3300053125 Ga0500618_000481 Ga0500618_000481_3279_3917 210
286 3300053125 Ga0500618_083781 Ga0500618_083781_45_683 210
287 3300053139 Ga0500568_0179429 Ga0500568_0179429_129_767 210
288 3300053153 Ga0500616_0042623 Ga0500616_0042623_1780_2418 210
289 3300053156 Ga0500622_0002244 Ga0500622_0002244_9071_9709 210
290 3300053157 Ga0500624_000183 Ga0500624_000183_12250_12888 210
291 3300053161 Ga0500634_0064947 Ga0500634_0064947_385_1023 210
292 3300003316 rootH1_10196979 rootH1_101969792 211
293 3300003320 rootH2_10062830 rootH2_100628302 211
294 3300003322 rootL2_10002073 rootL2_100020735 211
295 3300003322 rootL2_10002103 rootL2_100021034 211
296 3300003322 rootL2_10235720 rootL2_102357202 211
297 3300003323 rootH1_10007209 rootH1_100072092 211
298 3300003323 rootH1_10015499 rootH1_1001549916 211
299 3300003323 rootH1_10037915 rootH1_100379154 211
300 3300003781 Ga0055536_1000002 Ga0055536_1000002272 211
301 3300003794 Ga0055531_10000148 Ga0055531_1000014876 211
302 3300005329 Ga0070683_100046319 Ga0070683_1000463193 211
303 3300005339 Ga0070660_100544041 Ga0070660_1005440411 211
304 3300005356 Ga0070674_100261087 Ga0070674_1002610872 211
305 3300005365 Ga0070688_100172111 Ga0070688_1001721112 211
306 3300005459 Ga0068867_100551869 Ga0068867_1005518691 211
307 3300005535 Ga0070684_100029676 Ga0070684_1000296765 211
308 3300005548 Ga0070665_100641306 Ga0070665_1006413062 211
309 3300005563 Ga0068855_100084025 Ga0068855_1000840253 211
310 3300005614 Ga0068856_100626067 Ga0068856_1006260672 211
311 3300005618 Ga0068864_100995302 Ga0068864_1009953021 211
312 3300006844 Ga0075428_100020561 Ga0075428_1000205612 211
313 3300006881 Ga0068865_100651213 Ga0068865_1006512131 211
314 3300009094 Ga0111539_10010811 Ga0111539_100108117 211
315 3300009176 Ga0105242_10027841 Ga0105242_100278414 211
316 3300009176 Ga0105242_10281671 Ga0105242_102816712 211
317 3300009545 Ga0105237_10578492 Ga0105237_105784922 211
318 3300013100 Ga0157373_10000150 Ga0157373_1000015049 211
319 3300013102 Ga0157371_10036406 Ga0157371_100364062 211
320 3300013102 Ga0157371_10122065 Ga0157371_101220652 211
321 3300013104 Ga0157370_10038733 Ga0157370_100387335 211
322 3300013104 Ga0157370_10459530 Ga0157370_104595301 211
323 3300013306 Ga0163162_10000011 Ga0163162_1000001128 211
324 3300013307 Ga0157372_10010462 Ga0157372_100104622 211
325 3300013307 Ga0157372_10671003 Ga0157372_106710032 211
326 3300014326 Ga0157380_10000008 Ga0157380_10000008123 211
327 3300015682 Ga0183373_1002 Ga0183373_1002281 211
328 3300017792 Ga0163161_10907952 Ga0163161_109079522 211
329 3300025250 Ga0209026_1000250 Ga0209026_100025063 211
330 3300025304 Ga0209257_1000006 Ga0209257_10000061218 211
331 3300025914 Ga0207671_10396486 Ga0207671_103964861 211
332 3300025934 Ga0207686_10073350 Ga0207686_100733502 211
333 3300025944 Ga0207661_10045175 Ga0207661_100451753 211
334 3300028379 Ga0268266_10567508 Ga0268266_105675082 211
335 3300028794 Ga0307515_10310343 Ga0307515_103103432 211
336 3300031251 Ga0265327_10000296 Ga0265327_1000029648 211
337 3300031251 Ga0265327_10005806 Ga0265327_100058063 211
338 3300031251 Ga0265327_10018205 Ga0265327_100182052 211
339 3300031507 Ga0307509_10015955 Ga0307509_100159559 211
340 3300031548 Ga0307408_100001056 Ga0307408_10000105618 211
341 3300032002 Ga0307416_100004189 Ga0307416_1000041892 211
342 3300032004 Ga0307414_10822256 Ga0307414_108222562 211
343 3300032005 Ga0307411_10285104 Ga0307411_102851041 211
344 3300032126 Ga0307415_100009833 Ga0307415_1000098332 211
345 3300036712 Ga0316584_0492287 Ga0316584_0492287_130_768 211
346 3300037471 Ga0395905_0000001 Ga0395905_0000001_124957_125598 211
347 3300041463 Ga0451804_0069962 Ga0451804_0069962_150_788 211
348 3300041494 Ga0451837_0688012 Ga0451837_0688012_305_940 211
349 3300041997 Ga0439431_0000493 Ga0439431_0000493_3505_4146 211
350 3300042004 Ga0439445_0004333 Ga0439445_0004333_1478_2119 211
351 3300042007 Ga0439449_0015842 Ga0439449_0015842_1420_2064 211
352 3300042876 Ga0451577_0087539 Ga0451577_0087539_2102_2737 211
353 3300042876 Ga0451577_0104106 Ga0451577_0104106_820_1464 211
354 3300044683 Ga0466965_0074647 Ga0466965_0074647_211_855 211
355 3300044712 Ga0453684_0001960 Ga0453684_0001960_25986_26630 211
356 3300044712 Ga0453684_0008113 Ga0453684_0008113_8544_9188 211
357 3300044712 Ga0453684_0012736 Ga0453684_0012736_11823_12464 211
358 3300045051 Ga0451576_0007591 Ga0451576_0007591_1983_2618 211
359 3300045051 Ga0451576_0008658 Ga0451576_0008658_5461_6105 211
360 3300045051 Ga0451576_0399626 Ga0451576_0399626_198_833 211
361 3300046453 Ga0495627_012397 Ga0495627_012397_1709_2353 211
362 3300048926 Ga0496123_0027067 Ga0496123_0027067_1875_2510 211
363 3300050510 nmdc:mga06r32_630206_c1 nmdc:mga06r32_630206_c1_99_740 211
364 3300050511 nmdc:mga08y16_53095_c1 nmdc:mga08y16_53095_c1_1019_1660 211
365 3300053086 Ga0500578_0176868 Ga0500578_0176868_215_856 211
366 3300053131 Ga0500652_172689 Ga0500652_172689_36_680 211
367 3300053156 Ga0500622_0000319 Ga0500622_0000319_45257_45901 211
368 3300053733 Ga0500552_006660 Ga0500552_006660_449_1090 211
369 iso_pu_bacteria 2881955468 2881956858 211
370 3300005544 Ga0070686_100350277 Ga0070686_1003502772 212
371 3300044712 Ga0453684_0595083 Ga0453684_0595083_471_1115 212
372 2162886007 SwRhRL2b_contig_677025 SwRhRL2b_0927.00001140 213
373 3300003323 rootH1_10287539 rootH1_102875392 213
374 3300003323 rootH1_10398462 rootH1_103984622 213
375 3300005289 Ga0065704_10070133 Ga0065704_10070133378 213
376 3300005539 Ga0068853_100559188 Ga0068853_1005591882 213
377 3300005548 Ga0070665_100006883 Ga0070665_1000068835 213
378 3300005842 Ga0068858_100534451 Ga0068858_1005344512 213
379 3300009093 Ga0105240_10000011 Ga0105240_1000001137 213
380 3300009093 Ga0105240_10366256 Ga0105240_103662562 213
381 3300009545 Ga0105237_10006545 Ga0105237_1000654512 213
382 3300009551 Ga0105238_10552788 Ga0105238_105527881 213
383 3300010375 Ga0105239_10000122 Ga0105239_1000012212 213
384 3300010375 Ga0105239_10778437 Ga0105239_107784372 213
385 3300013105 Ga0157369_10321816 Ga0157369_103218163 213
386 3300013297 Ga0157378_10009225 Ga0157378_100092253 213
387 3300013306 Ga0163162_10490610 Ga0163162_104906102 213
388 3300013307 Ga0157372_10001304 Ga0157372_1000130410 213
389 3300013307 Ga0157372_11118344 Ga0157372_111183441 213
390 3300025904 Ga0207647_10186518 Ga0207647_101865182 213
391 3300025913 Ga0207695_10000010 Ga0207695_10000010425 213
392 3300025913 Ga0207695_10010077 Ga0207695_1001007710 213
393 3300025914 Ga0207671_10000438 Ga0207671_1000043820 213
394 3300025924 Ga0207694_10391434 Ga0207694_103914342 213
395 3300026035 Ga0207703_10456936 Ga0207703_104569362 213
396 3300028379 Ga0268266_10021858 Ga0268266_100218582 213
397 3300028800 Ga0265338_10034270 Ga0265338_100342703 213
398 3300031250 Ga0265331_10095434 Ga0265331_100954342 213
399 3300031251 Ga0265327_10000089 Ga0265327_1000008915 213
400 3300031251 Ga0265327_10155157 Ga0265327_101551572 213
401 3300031911 Ga0307412_10036332 Ga0307412_100363324 213
402 3300044712 Ga0453684_0836839 Ga0453684_0836839_252_908 213
403 3300044765 Ga0466970_0167160 Ga0466970_0167160_396_1052 213
404 3300044842 Ga0466957_0575229 Ga0466957_0575229_60_716 213
405 3300047318 Ga0495636_0000184 Ga0495636_0000184_22561_23214 213
406 3300049822 Ga0501035_0166508 Ga0501035_0166508_531_1190 213
407 3300001989 JGI24739J22299_10049133 JGI24739J22299_100491332 214
408 3300001990 JGI24737J22298_10000017 JGI24737J22298_100000173 214
409 3300002067 JGI24735J21928_10000024 JGI24735J21928_1000002481 214
410 3300005339 Ga0070660_100035273 Ga0070660_1000352732 214
411 3300005563 Ga0068855_100000160 Ga0068855_10000016032 214
412 3300006353 Ga0075370_10308430 Ga0075370_103084301 214
413 3300013296 Ga0157374_10001925 Ga0157374_100019254 214
414 3300025949 Ga0207667_10000033 Ga0207667_10000033122 214
415 3300046660 Ga0495625_0161496 Ga0495625_0161496_800_1456 214
416 iso_pu_bacteria 2977232053 2977234679 214
417 3300030732 Ga0316176_1007214 Ga0316176_100721416 215
418 3300030742 Ga0316183_1006105 Ga0316183_100610550 215
419 3300030744 Ga0316181_1071217 Ga0316181_10712172 215
420 3300030745 Ga0316182_1041168 Ga0316182_10411682 215
421 3300046660 Ga0495625_0000007 Ga0495625_0000007_278003_278671 215
422 3300046692 Ga0495671_0104830 Ga0495671_0104830_74_742 215
423 3300046694 Ga0495649_0000007 Ga0495649_0000007_173328_173996 215
424 3300053156 Ga0500622_0081573 Ga0500622_0081573_364_1032 215
425 iso_pu_bacteria 2721755487 2722731229 215
426 iso_pu_bacteria 2904780799 2904782305 215
427 3300031507 Ga0307509_10080953 Ga0307509_100809533 217
428 3300046558 Ga0495633_0000017 Ga0495633_0000017_196544_197236 217
429 3300002737 JGI25162J39368_1002329 JGI25162J39368_10023294 218
430 3300002772 JGI25164J39214_1001393 JGI25164J39214_10013933 218
431 3300003214 JGI25165J46597_1001345 JGI25165J46597_10013457 218
432 3300005339 Ga0070660_100048737 Ga0070660_1000487373 218
433 3300005366 Ga0070659_100000644 Ga0070659_10000064421 218
434 3300005614 Ga0068856_100421801 Ga0068856_1004218013 218
435 3300013104 Ga0157370_10043758 Ga0157370_100437582 218
436 3300025231 Ga0207427_100071 Ga0207427_100071107 218
437 3300025233 Ga0209437_100021 Ga0209437_100021153 218
438 3300025261 Ga0209233_1000035 Ga0209233_1000035485 218
439 3300025909 Ga0207705_10306782 Ga0207705_103067821 218
440 3300025919 Ga0207657_10094377 Ga0207657_100943773 218
441 3300025932 Ga0207690_10000049 Ga0207690_1000004988 218
442 3300046507 Ga0495606_0011487 Ga0495606_0011487_889_1656 218
443 3300049705 Ga0501225_0026156 Ga0501225_0026156_65_751 218
444 2162886007 SwRhRL2b_contig_2261022 SwRhRL2b_0681.00000840 219
445 3300005289 Ga0065704_10130168 Ga0065704_101301681 219
446 3300009148 Ga0105243_10000046 Ga0105243_1000004652 219
447 3300025935 Ga0207709_10000020 Ga0207709_10000020290 219
448 3300042876 Ga0451577_0000452 Ga0451577_0000452_66596_67288 219
449 3300048919 Ga0496116_0004756 Ga0496116_0004756_10527_11186 219
450 3300048920 Ga0496117_0000995 Ga0496117_0000995_7343_8002 219
451 3300048921 Ga0496118_0130271 Ga0496118_0130271_297_956 219
452 iso_pu_bacteria 2896317667 2896320284 219

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01596

Methyltransf_3

O-methyltransferase

56

255

0.94

PF13578

Methyltransf_24

Methyltransferase domain

105

207

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cbg-assembly1.cif.gz_A-2 functional and structural characterization of a cationdependent o-methyltransferase from the cyanobacterium synechocystis sp. strain pcc 6803 0.9543 14 219
8gxo-assembly1.cif.gz_A the crystal structure of csfaomt1 in complex with sah 0.9397 14 218
2hnk-assembly1.cif.gz_C crystal structure of sam-dependent o-methyltransferase from pathogenic bacterium leptospira interrogans 0.9353 14 219
8gxn-assembly1.cif.gz_B the crystal structure of csfaomt2 in complex with sah 0.9333 14 218
2hnk-assembly2.cif.gz_B-2 crystal structure of sam-dependent o-methyltransferase from pathogenic bacterium leptospira interrogans 0.9325 14 219
ID Description Score Start End Superfamily
af_Q5BLE6_34_270_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9565 12 218 3.40.50.150
3cbgA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9543 14 219 3.40.50.150
af_Q86IC9_10_229_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9359 14 219 3.40.50.150
2hnkB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9325 14 219 3.40.50.150
af_Q9M266_77_290_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9305 14 219 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A519WQJ5-F1-model_v4 Methyltransferase 0.9914 14 124 GO:0008171
GO:0008757
GO:0032259
AF-A0A350C221-F1-model_v4 Methyltransferase 0.9907 27 219 GO:0008171
GO:0008757
GO:0032259
AF-E4RY83-F1-model_v4 O-methyltransferase family 3 0.9878 16 218 GO:0008171
GO:0008757
GO:0032259
AF-A0A838NAY4-F1-model_v4 deleted 0.9863 140 218
AF-A0A350C221-F1-model_v4 Methyltransferase 0.9856 27 219 GO:0008171
GO:0008757
GO:0032259

Feature Viewer

pLDDT pTM Quality
90.62 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map