F447022

General Info

Members Datasets Scaffolds Average Seq Length
452 226 904 152

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0539885|Ga0395900_0539885_522_1073
Length 183
Sequence VLDPGELHPFHVADDRKPHVSHLGGGVRFMESMAAVVPPFEAFYEAHKAEVLRFLGRRLGRERAEDAFQETFLRALRAYPRLEHGEHLRAWVLTIASRIVLDDVRRARPQGALPELATEDGRPAFEELAPLTDGLPPKERAAVVLRYGYDLDYDEIGDALGSTGSAARQAASAGVRRLRKEQQ

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
119 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
120 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
121 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
122 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
123 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
124 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
125 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
126 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
127 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
128 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
129 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
130 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
131 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
132 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
133 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
134 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
135 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
136 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
139 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
140 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
141 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
154 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
155 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
156 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
157 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
158 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
159 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
160 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
161 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
162 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
163 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
167 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
168 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
169 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
170 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
171 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
172 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
197 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
198 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
201 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
204 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
205 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
206 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
207 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
210 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
214 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
215 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
216 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
217 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
224 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
225 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
226 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.34
Metatranscriptomes 0.66
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.21
Nodule 0
Rhizoplane 6.19
Rhizosphere 90.93
Stem 0
Stem Tuber 0
Unclassified 11.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0539885 3300037418 Bacteria 1112
2 Ga0070658_10044948 3300005327 Bacteria 3570
3 Ga0070658_10117433 3300005327 Bacteria 2209
4 Ga0070676_10254998 3300005328 Bacteria 1172
5 Ga0070683_100107076 3300005329 Bacteria 2636
6 Ga0070683_100397533 3300005329 Bacteria 1314
7 Ga0070670_100196578 3300005331 Bacteria 1752
8 Ga0068869_100063728 3300005334 Bacteria 2709
9 Ga0070680_100009971 3300005336 Bacteria 7318
10 Ga0070680_100033907 3300005336 Bacteria 4117
11 Ga0070680_100565491 3300005336 Unclassified 975
12 Ga0070682_100004695 3300005337 Bacteria 7590
13 Ga0070660_100003676 3300005339 Bacteria 10591
14 Ga0070660_100011957 3300005339 Bacteria 6193
15 Ga0070660_100116807 3300005339 Bacteria 2127
16 Ga0070660_100223220 3300005339 Bacteria 1532
17 Ga0070660_100618619 3300005339 Unclassified 906
18 Ga0070661_100051253 3300005344 Bacteria 3020
19 Ga0070661_100608168 3300005344 Bacteria 884
20 Ga0070692_10023864 3300005345 Bacteria 3000
21 Ga0070675_100162431 3300005354 Bacteria 1922
22 Ga0070671_100449985 3300005355 Bacteria 1105
23 Ga0070674_100457013 3300005356 Bacteria 1055
24 Ga0070659_100056950 3300005366 Bacteria 3082
25 Ga0070659_100081162 3300005366 Bacteria 2590
26 Ga0070659_100316988 3300005366 Bacteria 1303
27 Ga0070659_100657434 3300005366 Bacteria 904
28 Ga0070709_10017495 3300005434 Bacteria 4113
29 Ga0070709_10065587 3300005434 Bacteria 2325
30 Ga0070709_10178387 3300005434 Unclassified 1490
31 Ga0070709_10428890 3300005434 Bacteria 992
32 Ga0070714_100002939 3300005435 Bacteria 12619
33 Ga0070714_100033269 3300005435 Bacteria 4309
34 Ga0070714_100049236 3300005435 Bacteria 3587
35 Ga0070714_100221908 3300005435 Bacteria 1737
36 Ga0070714_100709668 3300005435 Bacteria 971
37 Ga0070714_101548981 3300005435 Bacteria 647
38 Ga0070713_100039904 3300005436 Bacteria 3814
39 Ga0070710_10634747 3300005437 Bacteria 747
40 Ga0070700_100015797 3300005441 Bacteria 4288
41 Ga0070708_100546488 3300005445 Bacteria 1093
42 Ga0070678_100316712 3300005456 Bacteria 1331
43 Ga0070662_100015116 3300005457 Bacteria 5165
44 Ga0070681_10030898 3300005458 Bacteria 5376
45 Ga0070681_10081590 3300005458 Bacteria 3190
46 Ga0070681_10082376 3300005458 Bacteria 3172
47 Ga0070681_10103333 3300005458 Bacteria 2794
48 Ga0070681_10706229 3300005458 Bacteria 924
49 Ga0070681_10991848 3300005458 Bacteria 760
50 Ga0070706_101577277 3300005467 Unclassified 599
51 Ga0070707_100239571 3300005468 Bacteria 1766
52 Ga0070707_100631602 3300005468 Bacteria 1034
53 Ga0070698_100072962 3300005471 Bacteria 3439
54 Ga0070698_100074154 3300005471 Bacteria 3408
55 Ga0070698_100155672 3300005471 Bacteria 2231
56 Ga0070698_100244880 3300005471 Unclassified 1726
57 Ga0070698_100393969 3300005471 Bacteria 1318
58 Ga0070679_100026989 3300005530 Bacteria 5648
59 Ga0070679_100354524 3300005530 Bacteria 1414
60 Ga0070679_100389551 3300005530 Bacteria 1340
61 Ga0070684_100087315 3300005535 Bacteria 2769
62 Ga0070684_100153068 3300005535 Bacteria 2090
63 Ga0070684_100226487 3300005535 Bacteria 1706
64 Ga0068853_100082782 3300005539 Bacteria 2811
65 Ga0070696_100120929 3300005546 Bacteria 1895
66 Ga0070696_100357702 3300005546 Bacteria 1132
67 Ga0070693_100594674 3300005547 Bacteria 798
68 Ga0070704_100013567 3300005549 Bacteria 5060
69 Ga0070664_100013436 3300005564 Bacteria 6669
70 Ga0068857_100113765 3300005577 Bacteria 2433
71 Ga0068857_100347796 3300005577 Bacteria 1372
72 Ga0068854_100032112 3300005578 Bacteria 3651
73 Ga0068854_100707573 3300005578 Bacteria 870
74 Ga0068856_100041257 3300005614 Bacteria 4535
75 Ga0070702_100161017 3300005615 Bacteria 1451
76 Ga0068852_100308332 3300005616 Bacteria 1534
77 Ga0068870_10488193 3300005840 Bacteria 819
78 Ga0068862_100537353 3300005844 Bacteria 1114
79 Ga0081455_10037599 3300005937 Bacteria 4295
80 Ga0081539_10000866 3300005985 Bacteria 57957
81 Ga0081539_10019117 3300005985 Bacteria 4707
82 Ga0070717_10158663 3300006028 Bacteria 1961
83 Ga0070717_10208580 3300006028 Unclassified 1714
84 Ga0070717_10835541 3300006028 Bacteria 838
85 Ga0075365_10215318 3300006038 Unclassified 1347
86 Ga0075365_10252781 3300006038 Bacteria 1238
87 Ga0075364_10170649 3300006051 Bacteria 1470
88 Ga0075364_10194767 3300006051 Bacteria 1373
89 Ga0075432_10003086 3300006058 Bacteria 5616
90 Ga0075432_10054007 3300006058 Bacteria 1422
91 Ga0070716_100129944 3300006173 Bacteria 1591
92 Ga0070716_100154488 3300006173 Bacteria 1480
93 Ga0070712_100025148 3300006175 Bacteria 3954
94 Ga0070712_100079780 3300006175 Bacteria 2366
95 Ga0075367_10044319 3300006178 Bacteria 2607
96 Ga0075370_10070924 3300006353 Bacteria 1993
97 Ga0075428_100000682 3300006844 Bacteria 34885
98 Ga0075428_100085889 3300006844 Bacteria 3432
99 Ga0075433_10322543 3300006852 Bacteria 1366
100 Ga0075434_100101646 3300006871 Bacteria 2882
101 Ga0075434_100756227 3300006871 Bacteria 989
102 Ga0075429_100102848 3300006880 Bacteria 2494
103 Ga0075429_100464448 3300006880 Unclassified 1109
104 Ga0068865_100076608 3300006881 Bacteria 2388
105 Ga0099794_10271618 3300007265 Bacteria 876
106 Ga0105240_10501060 3300009093 Bacteria 1350
107 Ga0105240_10666648 3300009093 Bacteria 1138
108 Ga0111539_10002341 3300009094 Bacteria 25232
109 Ga0111539_10070907 3300009094 Bacteria 4113
110 Ga0105245_10052077 3300009098 Bacteria 3670
111 Ga0105245_10257631 3300009098 Bacteria 1697
112 Ga0114129_10060992 3300009147 Bacteria 5272
113 Ga0114129_10124262 3300009147 Bacteria 3549
114 Ga0114129_10821709 3300009147 Unclassified 1184
115 Ga0105243_10196109 3300009148 Bacteria 1768
116 Ga0105241_10143346 3300009174 Bacteria 1948
117 Ga0105241_10900199 3300009174 Unclassified 822
118 Ga0105242_10223504 3300009176 Bacteria 1684
119 Ga0105242_10418966 3300009176 Bacteria 1254
120 Ga0105242_10830273 3300009176 Bacteria 918
121 Ga0105248_10587328 3300009177 Bacteria 1257
122 Ga0105248_10949216 3300009177 Bacteria 971
123 Ga0105238_10390175 3300009551 Bacteria 1384
124 Ga0105249_10286374 3300009553 Bacteria 1647
125 Ga0105249_11843621 3300009553 Bacteria 677
126 Ga0105239_10060066 3300010375 Bacteria 4172
127 Ga0105239_10230376 3300010375 Bacteria 2078
128 Ga0105239_10747108 3300010375 Bacteria 1120
129 Ga0105239_10949039 3300010375 Bacteria 988
130 Ga0105239_11033471 3300010375 Bacteria 945
131 Ga0157373_10081396 3300013100 Bacteria 2283
132 Ga0157373_10125484 3300013100 Bacteria 1805
133 Ga0157371_10165590 3300013102 Bacteria 1579
134 Ga0157370_10265283 3300013104 Bacteria 1587
135 Ga0157370_11538664 3300013104 Bacteria 598
136 Ga0157369_10191600 3300013105 Bacteria 2148
137 Ga0157369_10229355 3300013105 Unclassified 1942
138 Ga0157369_10997258 3300013105 Bacteria 857
139 Ga0157374_10146052 3300013296 Bacteria 2297
140 Ga0163162_12382653 3300013306 Bacteria 608
141 Ga0157372_10057940 3300013307 Bacteria 4330
142 Ga0157372_10383909 3300013307 Bacteria 1636
143 Ga0157372_11537088 3300013307 Bacteria 766
144 Ga0157375_10580079 3300013308 Bacteria 1282
145 Ga0163163_10190706 3300014325 Bacteria 2098
146 Ga0163163_10951216 3300014325 Bacteria 922
147 Ga0182008_10147519 3300014497 Bacteria 1179
148 Ga0182008_10319625 3300014497 Bacteria 816
149 Ga0157377_10020397 3300014745 Bacteria 3472
150 Ga0157377_10020776 3300014745 Bacteria 3445
151 Ga0157377_10782780 3300014745 Bacteria 701
152 Ga0206354_11654818 3300020081 Bacteria 959
153 Ga0206353_11434344 3300020082 Bacteria 1837
154 Ga0206353_11678121 3300020082 Bacteria 3843
155 Ga0213871_10052971 3300021441 Bacteria 1116
156 Ga0207688_10002061 3300025901 Bacteria 10803
157 Ga0207688_10221497 3300025901 Bacteria 1140
158 Ga0207699_10055195 3300025906 Bacteria 2363
159 Ga0207699_10138455 3300025906 Bacteria 1597
160 Ga0207643_10049402 3300025908 Bacteria 2383
161 Ga0207705_10072421 3300025909 Bacteria 2499
162 Ga0207705_10086598 3300025909 Bacteria 2290
163 Ga0207705_10236762 3300025909 Bacteria 1390
164 Ga0207684_10740490 3300025910 Bacteria 834
165 Ga0207684_11121628 3300025910 Unclassified 654
166 Ga0207707_10016228 3300025912 Bacteria 6497
167 Ga0207707_10025343 3300025912 Bacteria 5187
168 Ga0207707_10315768 3300025912 Bacteria 1350
169 Ga0207695_10464806 3300025913 Bacteria 1148
170 Ga0207695_11077566 3300025913 Bacteria 683
171 Ga0207693_10221156 3300025915 Bacteria 1488
172 Ga0207693_10659257 3300025915 Bacteria 812
173 Ga0207693_10888896 3300025915 Unclassified 684
174 Ga0207660_10056255 3300025917 Bacteria 2814
175 Ga0207660_10342115 3300025917 Unclassified 1197
176 Ga0207657_10000961 3300025919 Bacteria 30509
177 Ga0207657_10009114 3300025919 Bacteria 10011
178 Ga0207657_10033077 3300025919 Bacteria 4665
179 Ga0207657_10076718 3300025919 Bacteria 2818
180 Ga0207657_10206666 3300025919 Bacteria 1577
181 Ga0207649_10127576 3300025920 Bacteria 1724
182 Ga0207652_10021532 3300025921 Bacteria 5321
183 Ga0207652_10144572 3300025921 Bacteria 2128
184 Ga0207652_10277287 3300025921 Bacteria 1512
185 Ga0207646_10460039 3300025922 Bacteria 1148
186 Ga0207646_10947636 3300025922 Unclassified 762
187 Ga0207694_10765626 3300025924 Bacteria 815
188 Ga0207687_10021217 3300025927 Bacteria 4314
189 Ga0207687_10120085 3300025927 Bacteria 1964
190 Ga0207687_10204000 3300025927 Bacteria 1547
191 Ga0207700_10104943 3300025928 Bacteria 2262
192 Ga0207664_10001976 3300025929 Bacteria 13497
193 Ga0207664_10008274 3300025929 Bacteria 7246
194 Ga0207664_10168060 3300025929 Bacteria 1875
195 Ga0207664_10309379 3300025929 Bacteria 1392
196 Ga0207664_10818647 3300025929 Bacteria 837
197 Ga0207644_10285153 3300025931 Bacteria 1327
198 Ga0207690_10065604 3300025932 Bacteria 2483
199 Ga0207690_10434452 3300025932 Unclassified 1052
200 Ga0207686_10394623 3300025934 Bacteria 1052
201 Ga0207686_10670602 3300025934 Unclassified 822
202 Ga0207669_10510940 3300025937 Bacteria 963
203 Ga0207669_10855820 3300025937 Unclassified 757
204 Ga0207665_10172151 3300025939 Bacteria 1564
205 Ga0207689_10566283 3300025942 Bacteria 955
206 Ga0207661_10004021 3300025944 Bacteria 10282
207 Ga0207661_10075766 3300025944 Bacteria 2761
208 Ga0207661_10333831 3300025944 Bacteria 1365
209 Ga0207667_11093681 3300025949 Bacteria 781
210 Ga0207668_11205136 3300025972 Bacteria 680
211 Ga0207640_10105107 3300025981 Bacteria 1989
212 Ga0207640_10663627 3300025981 Bacteria 890
213 Ga0207639_10271537 3300026041 Bacteria 1488
214 Ga0207708_10027187 3300026075 Bacteria 4331
215 Ga0207702_10125014 3300026078 Bacteria 2307
216 Ga0207702_10766627 3300026078 Bacteria 953
217 Ga0207702_10984273 3300026078 Unclassified 837
218 Ga0207674_10020813 3300026116 Bacteria 7080
219 Ga0207674_10178776 3300026116 Bacteria 2073
220 Ga0207683_10249360 3300026121 Bacteria 1620
221 Ga0207683_10472901 3300026121 Bacteria 1156
222 Ga0207698_10164406 3300026142 Bacteria 1945
223 Ga0207428_10000222 3300027907 Bacteria 78747
224 Ga0207428_10025927 3300027907 Bacteria 4898
225 Ga0268265_10280385 3300028380 Bacteria 1491
226 Ga0265326_10035067 3300028558 Bacteria 1427
227 Ga0265319_1028723 3300028563 Bacteria 1958
228 Ga0265319_1058351 3300028563 Unclassified 1257
229 Ga0265334_10054076 3300028573 Bacteria 1531
230 Ga0265318_10008332 3300028577 Bacteria 4621
231 Ga0265318_10047343 3300028577 Bacteria 1622
232 Ga0265318_10074175 3300028577 Bacteria 1260
233 Ga0265322_10008089 3300028654 Bacteria 3066
234 Ga0265322_10083453 3300028654 Bacteria 907
235 Ga0265336_10039806 3300028666 Bacteria 1440
236 Ga0265338_10015968 3300028800 Bacteria 8210
237 Ga0265338_10047369 3300028800 Bacteria 3926
238 Ga0265338_10162747 3300028800 Bacteria 1721
239 Ga0265338_10398586 3300028800 Unclassified 981
240 Ga0265338_10679888 3300028800 Bacteria 711
241 Ga0265324_10150377 3300029957 Bacteria 790
242 Ga0265330_10005638 3300031235 Bacteria 6224
243 Ga0265330_10064515 3300031235 Bacteria 1591
244 Ga0265332_10008063 3300031238 Bacteria 4740
245 Ga0265332_10110012 3300031238 Unclassified 1161
246 Ga0265328_10009201 3300031239 Bacteria 4031
247 Ga0265320_10047985 3300031240 Bacteria 2086
248 Ga0265320_10065990 3300031240 Bacteria 1716
249 Ga0265320_10103115 3300031240 Bacteria 1312
250 Ga0265320_10120867 3300031240 Unclassified 1194
251 Ga0265325_10006670 3300031241 Bacteria 6984
252 Ga0265325_10105693 3300031241 Bacteria 1373
253 Ga0265329_10009861 3300031242 Bacteria 3537
254 Ga0265340_10057082 3300031247 Bacteria 1876
255 Ga0265339_10002100 3300031249 Bacteria 14527
256 Ga0265339_10032106 3300031249 Bacteria 2962
257 Ga0265339_10070201 3300031249 Unclassified 1869
258 Ga0265339_10103424 3300031249 Bacteria 1479
259 Ga0265331_10031291 3300031250 Bacteria 2645
260 Ga0265331_10061778 3300031250 Unclassified 1768
261 Ga0265327_10037760 3300031251 Bacteria 2640
262 Ga0265327_10138908 3300031251 Bacteria 1137
263 Ga0265316_10029669 3300031344 Bacteria 4492
264 Ga0265316_10058806 3300031344 Bacteria 2992
265 Ga0265316_10334688 3300031344 Bacteria 1098
266 Ga0307408_100134110 3300031548 Bacteria 1935
267 Ga0265313_10005017 3300031595 Bacteria 9885
268 Ga0265313_10034017 3300031595 Bacteria 2582
269 Ga0265313_10162936 3300031595 Bacteria 946
270 Ga0265314_10050539 3300031711 Bacteria 2902
271 Ga0265314_10072998 3300031711 Bacteria 2289
272 Ga0265314_10091787 3300031711 Bacteria 1975
273 Ga0265342_10036130 3300031712 Bacteria 3019
274 Ga0265342_10043325 3300031712 Bacteria 2716
275 Ga0265342_10271301 3300031712 Unclassified 900
276 Ga0307407_10113631 3300031903 Bacteria 1704
277 Ga0307412_10006980 3300031911 Bacteria 6413
278 Ga0307412_10743931 3300031911 Bacteria 846
279 Ga0307409_100107835 3300031995 Bacteria 2327
280 Ga0307416_100008076 3300032002 Bacteria 6748
281 Ga0307414_10050810 3300032004 Bacteria 2874
282 Ga0307411_10034971 3300032005 Bacteria 3132
283 Ga0373931_0116682 3300035691 Bacteria 1521
284 Ga0395899_0008276 3300037312 Bacteria 8008
285 Ga0395900_0045019 3300037418 Bacteria 4545
286 Ga0395898_0273659 3300037466 Bacteria 1610
287 Ga0395898_0311207 3300037466 Bacteria 1502
288 Ga0395898_0612889 3300037466 Unclassified 1031
289 Ga0395905_0124002 3300037471 Bacteria 2429
290 Ga0395905_0734447 3300037471 Bacteria 890
291 Ga0395905_0883016 3300037471 Unclassified 797
292 Ga0395901_0067159 3300038443 Bacteria 3734
293 Ga0395901_0320611 3300038443 Unclassified 1603
294 Ga0395901_0551040 3300038443 Bacteria 1169
295 Ga0395901_0851085 3300038443 Bacteria 897
296 Ga0436365_0518448 3300039437 Bacteria 1234
297 Ga0436360_0301195 3300039438 Bacteria 1241
298 Ga0436362_1066997 3300039453 Bacteria 1719
299 Ga0451853_0419703 3300041512 Bacteria 989
300 Ga0451853_1509951 3300041512 Bacteria 1462
301 Ga0439448_0268436 3300042005 Bacteria 604
302 Ga0439458_0029603 3300042157 Bacteria 1300
303 Ga0466966_0725825 3300044684 Unclassified 599
304 Ga0466963_0062393 3300044694 Bacteria 2493
305 Ga0466963_0093254 3300044694 Bacteria 2052
306 Ga0466963_0318797 3300044694 Bacteria 1094
307 Ga0466963_0359879 3300044694 Bacteria 1025
308 Ga0466963_0404078 3300044694 Bacteria 963
309 Ga0466963_1037294 3300044694 Bacteria 577
310 Ga0466963_1300290 3300044694 Unclassified 510
311 Ga0466964_0080589 3300044706 Bacteria 1396
312 Ga0466964_0111130 3300044706 Bacteria 1222
313 Ga0466971_0195077 3300044719 Bacteria 955
314 Ga0466968_0036415 3300044735 Bacteria 2063
315 Ga0466957_0148435 3300044842 Unclassified 1515
316 Ga0466957_0251980 3300044842 Bacteria 1174
317 Ga0466958_0180073 3300045836 Bacteria 1341
318 Ga0466958_0253610 3300045836 Bacteria 1126
319 Ga0466967_0005132 3300045976 Bacteria 9003
320 Ga0466967_0006841 3300045976 Bacteria 8132
321 Ga0466967_0022359 3300045976 Bacteria 5157
322 Ga0466967_0078143 3300045976 Bacteria 2981
323 Ga0466967_0171363 3300045976 Bacteria 2042
324 Ga0466967_0232644 3300045976 Bacteria 1755
325 Ga0466967_0779536 3300045976 Bacteria 949
326 Ga0466967_1908514 3300045976 Unclassified 591
327 Ga0495641_0427349 3300046461 Unclassified 602
328 Ga0495618_0158867 3300046514 Bacteria 1442
329 Ga0495630_0705533 3300046517 Bacteria 772
330 Ga0495652_0871943 3300046529 Unclassified 595
331 Ga0495684_0798456 3300047471 Bacteria 617
332 Ga0496100_0094684 3300048903 Bacteria 2046
333 Ga0496100_0209590 3300048903 Bacteria 1425
334 Ga0496101_0146292 3300048904 Bacteria 1805
335 Ga0496101_0151065 3300048904 Bacteria 1777
336 Ga0496101_0264641 3300048904 Bacteria 1342
337 Ga0496102_0321285 3300048905 Bacteria 1458
338 Ga0496104_0159522 3300048907 Bacteria 2164
339 Ga0496104_0757383 3300048907 Unclassified 878
340 Ga0496105_0176895 3300048908 Bacteria 1748
341 Ga0496106_0017574 3300048909 Bacteria 5290
342 Ga0496107_0140997 3300048910 Bacteria 1781
343 Ga0496107_1228064 3300048910 Unclassified 538
344 Ga0496108_0361875 3300048911 Bacteria 1266
345 Ga0496109_0027953 3300048912 Bacteria 5041
346 Ga0496109_1603514 3300048912 Bacteria 585
347 Ga0496110_0057726 3300048913 Bacteria 3417
348 Ga0496111_0001158 3300048914 Bacteria 14654
349 Ga0496111_0087158 3300048914 Bacteria 2285
350 Ga0496111_0422417 3300048914 Bacteria 985
351 Ga0496112_0040389 3300048915 Bacteria 4562
352 Ga0496112_0072693 3300048915 Bacteria 3400
353 Ga0496112_0330037 3300048915 Bacteria 1469
354 Ga0496112_0412726 3300048915 Bacteria 1289
355 Ga0496113_0258571 3300048916 Bacteria 1391
356 Ga0496114_0138938 3300048917 Bacteria 2102
357 Ga0496114_0346734 3300048917 Bacteria 1313
358 Ga0496114_0397877 3300048917 Bacteria 1220
359 Ga0496114_0586360 3300048917 Bacteria 984
360 Ga0501032_0140253 3300049569 Bacteria 1592
361 Ga0501032_0920918 3300049569 Bacteria 550
362 Ga0501034_0013258 3300049571 Bacteria 8491
363 Ga0501036_0022719 3300049572 Bacteria 5280
364 Ga0501036_0260038 3300049572 Bacteria 1454
365 Ga0501039_0150575 3300049575 Bacteria 1828
366 Ga0501039_0213991 3300049575 Bacteria 1515
367 Ga0501040_0070580 3300049576 Bacteria 2411
368 Ga0501040_0258732 3300049576 Bacteria 1242
369 Ga0501040_0304982 3300049576 Unclassified 1138
370 Ga0501041_0051623 3300049577 Bacteria 2506
371 Ga0501041_0200072 3300049577 Bacteria 1252
372 Ga0501041_0305068 3300049577 Unclassified 1003
373 Ga0501042_0082324 3300049578 Bacteria 2307
374 Ga0501043_0576701 3300049579 Bacteria 833
375 Ga0501046_0147061 3300049580 Bacteria 1779
376 Ga0501046_0810164 3300049580 Unclassified 656
377 Ga0501047_0470381 3300049581 Unclassified 1085
378 Ga0501048_0187578 3300049582 Bacteria 1465
379 Ga0501048_0629314 3300049582 Bacteria 770
380 Ga0501067_0090602 3300049583 Bacteria 1697
381 Ga0501068_0327561 3300049584 Bacteria 982
382 Ga0501068_0369513 3300049584 Bacteria 923
383 Ga0501068_0726967 3300049584 Unclassified 649
384 Ga0501069_0003499 3300049585 Bacteria 8089
385 Ga0501069_0183765 3300049585 Bacteria 1209
386 Ga0501070_0004009 3300049586 Bacteria 12659
387 Ga0501070_0071058 3300049586 Bacteria 2882
388 Ga0501071_0003695 3300049587 Bacteria 9599
389 Ga0501072_0009849 3300049588 Bacteria 7267
390 Ga0501072_0015694 3300049588 Bacteria 5805
391 Ga0501072_0054805 3300049588 Bacteria 3142
392 Ga0501072_0210832 3300049588 Unclassified 1548
393 Ga0501073_0068702 3300049589 Bacteria 2469
394 Ga0501074_0017225 3300049590 Bacteria 5243
395 Ga0501074_0019944 3300049590 Bacteria 4871
396 Ga0501074_0304414 3300049590 Bacteria 1132
397 Ga0501075_0003897 3300049591 Bacteria 10046
398 Ga0501075_0011831 3300049591 Bacteria 6190
399 Ga0501075_0059936 3300049591 Bacteria 2868
400 Ga0501075_0245523 3300049591 Unclassified 1365
401 Ga0501076_0017242 3300049592 Bacteria 5484
402 Ga0501076_0080826 3300049592 Bacteria 2609
403 Ga0501076_0116097 3300049592 Bacteria 2166
404 Ga0501076_0129406 3300049592 Unclassified 2047
405 Ga0501076_0213391 3300049592 Bacteria 1577
406 Ga0501076_0572953 3300049592 Bacteria 931
407 Ga0501077_0019864 3300049593 Bacteria 4250
408 Ga0501077_0022039 3300049593 Bacteria 4035
409 Ga0501077_0050060 3300049593 Bacteria 2655
410 Ga0501079_0001449 3300049741 Bacteria 16777
411 Ga0501079_0064843 3300049741 Unclassified 2818
412 Ga0501079_0132161 3300049741 Bacteria 1942
413 Ga0501079_0525409 3300049741 Unclassified 930
414 Ga0501080_0000605 3300049742 Bacteria 28394
415 Ga0501080_0063799 3300049742 Bacteria 3427
416 Ga0501080_0107865 3300049742 Bacteria 2581
417 Ga0501080_0268174 3300049742 Bacteria 1554
418 Ga0501081_0052513 3300049743 Bacteria 2813
419 Ga0501081_0112441 3300049743 Unclassified 1933
420 Ga0501081_0275802 3300049743 Bacteria 1230
421 Ga0501081_0391624 3300049743 Bacteria 1028
422 Ga0501083_0002047 3300049744 Bacteria 13867
423 Ga0501083_0088719 3300049744 Bacteria 2044
424 Ga0501035_0170302 3300049822 Bacteria 1882
425 Ga0501044_0303444 3300049823 Bacteria 1525
426 Ga0501045_0063267 3300049824 Bacteria 2715
427 Ga0501045_0075987 3300049824 Bacteria 2474
428 Ga0501045_0160142 3300049824 Unclassified 1675
429 nmdc:mga03n38_69679_c1 3300050490 Bacteria 1624
430 nmdc:mga00v17_47441_c1 3300050491 Bacteria 2602
431 nmdc:mga0yw44_33886_c1 3300050492 Bacteria 2988
432 nmdc:mga07m45_63924_c1 3300050496 Bacteria 2087
433 nmdc:mga05p37_32138_c1 3300050507 Bacteria 6417
434 nmdc:mga09592_17326_c1 3300050508 Bacteria 5901
435 nmdc:mga09592_491788_c1 3300050508 Bacteria 1056
436 nmdc:mga08y16_1915184_c1 3300050511 Viruses 543
437 nmdc:mga08y16_25738_c1 3300050511 Bacteria 6209
438 nmdc:mga0n895_110061_c1 3300050512 Bacteria 2770
439 nmdc:mga0n895_260594_c1 3300050512 Bacteria 1759
440 nmdc:mga0n895_701354_c1 3300050512 Bacteria 1008
441 nmdc:mga0a205_203173_c1 3300050515 Bacteria 1871
442 nmdc:mga0a205_236082_c1 3300050515 Bacteria 1710
443 Ga0495619_0152418 3300053085 Bacteria 1595
444 Ga0501084_0046099 3300054114 Bacteria 3650
445 Ga0501084_0123844 3300054114 Bacteria 2174
446 Ga0501084_0414058 3300054114 Unclassified 1139
447 Ga0501082_0084265 3300060353 Bacteria 2742
448 Ga0501082_0561517 3300060353 Bacteria 998
449 Ga0530510_0026502 3300061734 Bacteria 4150
450 Ga0530510_0291536 3300061734 Bacteria 1220
451 Ga0530510_1158626 3300061734 Bacteria 592
452 Ga0530510_1229990 3300061734 Bacteria 574
453 Ga0395900_0539885
454 Ga0070658_10044948
455 Ga0070658_10117433
456 Ga0070676_10254998
457 Ga0070683_100107076
458 Ga0070683_100397533
459 Ga0070670_100196578
460 Ga0068869_100063728
461 Ga0070680_100009971
462 Ga0070680_100033907
463 Ga0070680_100565491
464 Ga0070682_100004695
465 Ga0070660_100003676
466 Ga0070660_100011957
467 Ga0070660_100116807
468 Ga0070660_100223220
469 Ga0070660_100618619
470 Ga0070661_100051253
471 Ga0070661_100608168
472 Ga0070692_10023864
473 Ga0070675_100162431
474 Ga0070671_100449985
475 Ga0070674_100457013
476 Ga0070659_100056950
477 Ga0070659_100081162
478 Ga0070659_100316988
479 Ga0070659_100657434
480 Ga0070709_10017495
481 Ga0070709_10065587
482 Ga0070709_10178387
483 Ga0070709_10428890
484 Ga0070714_100002939
485 Ga0070714_100033269
486 Ga0070714_100049236
487 Ga0070714_100221908
488 Ga0070714_100709668
489 Ga0070714_101548981
490 Ga0070713_100039904
491 Ga0070710_10634747
492 Ga0070700_100015797
493 Ga0070708_100546488
494 Ga0070678_100316712
495 Ga0070662_100015116
496 Ga0070681_10030898
497 Ga0070681_10081590
498 Ga0070681_10082376
499 Ga0070681_10103333
500 Ga0070681_10706229
501 Ga0070681_10991848
502 Ga0070706_101577277
503 Ga0070707_100239571
504 Ga0070707_100631602
505 Ga0070698_100072962
506 Ga0070698_100074154
507 Ga0070698_100155672
508 Ga0070698_100244880
509 Ga0070698_100393969
510 Ga0070679_100026989
511 Ga0070679_100354524
512 Ga0070679_100389551
513 Ga0070684_100087315
514 Ga0070684_100153068
515 Ga0070684_100226487
516 Ga0068853_100082782
517 Ga0070696_100120929
518 Ga0070696_100357702
519 Ga0070693_100594674
520 Ga0070704_100013567
521 Ga0070664_100013436
522 Ga0068857_100113765
523 Ga0068857_100347796
524 Ga0068854_100032112
525 Ga0068854_100707573
526 Ga0068856_100041257
527 Ga0070702_100161017
528 Ga0068852_100308332
529 Ga0068870_10488193
530 Ga0068862_100537353
531 Ga0081455_10037599
532 Ga0081539_10000866
533 Ga0081539_10019117
534 Ga0070717_10158663
535 Ga0070717_10208580
536 Ga0070717_10835541
537 Ga0075365_10215318
538 Ga0075365_10252781
539 Ga0075364_10170649
540 Ga0075364_10194767
541 Ga0075432_10003086
542 Ga0075432_10054007
543 Ga0070716_100129944
544 Ga0070716_100154488
545 Ga0070712_100025148
546 Ga0070712_100079780
547 Ga0075367_10044319
548 Ga0075370_10070924
549 Ga0075428_100000682
550 Ga0075428_100085889
551 Ga0075433_10322543
552 Ga0075434_100101646
553 Ga0075434_100756227
554 Ga0075429_100102848
555 Ga0075429_100464448
556 Ga0068865_100076608
557 Ga0099794_10271618
558 Ga0105240_10501060
559 Ga0105240_10666648
560 Ga0111539_10002341
561 Ga0111539_10070907
562 Ga0105245_10052077
563 Ga0105245_10257631
564 Ga0114129_10060992
565 Ga0114129_10124262
566 Ga0114129_10821709
567 Ga0105243_10196109
568 Ga0105241_10143346
569 Ga0105241_10900199
570 Ga0105242_10223504
571 Ga0105242_10418966
572 Ga0105242_10830273
573 Ga0105248_10587328
574 Ga0105248_10949216
575 Ga0105238_10390175
576 Ga0105249_10286374
577 Ga0105249_11843621
578 Ga0105239_10060066
579 Ga0105239_10230376
580 Ga0105239_10747108
581 Ga0105239_10949039
582 Ga0105239_11033471
583 Ga0157373_10081396
584 Ga0157373_10125484
585 Ga0157371_10165590
586 Ga0157370_10265283
587 Ga0157370_11538664
588 Ga0157369_10191600
589 Ga0157369_10229355
590 Ga0157369_10997258
591 Ga0157374_10146052
592 Ga0163162_12382653
593 Ga0157372_10057940
594 Ga0157372_10383909
595 Ga0157372_11537088
596 Ga0157375_10580079
597 Ga0163163_10190706
598 Ga0163163_10951216
599 Ga0182008_10147519
600 Ga0182008_10319625
601 Ga0157377_10020397
602 Ga0157377_10020776
603 Ga0157377_10782780
604 Ga0206354_11654818
605 Ga0206353_11434344
606 Ga0206353_11678121
607 Ga0213871_10052971
608 Ga0207688_10002061
609 Ga0207688_10221497
610 Ga0207699_10055195
611 Ga0207699_10138455
612 Ga0207643_10049402
613 Ga0207705_10072421
614 Ga0207705_10086598
615 Ga0207705_10236762
616 Ga0207684_10740490
617 Ga0207684_11121628
618 Ga0207707_10016228
619 Ga0207707_10025343
620 Ga0207707_10315768
621 Ga0207695_10464806
622 Ga0207695_11077566
623 Ga0207693_10221156
624 Ga0207693_10659257
625 Ga0207693_10888896
626 Ga0207660_10056255
627 Ga0207660_10342115
628 Ga0207657_10000961
629 Ga0207657_10009114
630 Ga0207657_10033077
631 Ga0207657_10076718
632 Ga0207657_10206666
633 Ga0207649_10127576
634 Ga0207652_10021532
635 Ga0207652_10144572
636 Ga0207652_10277287
637 Ga0207646_10460039
638 Ga0207646_10947636
639 Ga0207694_10765626
640 Ga0207687_10021217
641 Ga0207687_10120085
642 Ga0207687_10204000
643 Ga0207700_10104943
644 Ga0207664_10001976
645 Ga0207664_10008274
646 Ga0207664_10168060
647 Ga0207664_10309379
648 Ga0207664_10818647
649 Ga0207644_10285153
650 Ga0207690_10065604
651 Ga0207690_10434452
652 Ga0207686_10394623
653 Ga0207686_10670602
654 Ga0207669_10510940
655 Ga0207669_10855820
656 Ga0207665_10172151
657 Ga0207689_10566283
658 Ga0207661_10004021
659 Ga0207661_10075766
660 Ga0207661_10333831
661 Ga0207667_11093681
662 Ga0207668_11205136
663 Ga0207640_10105107
664 Ga0207640_10663627
665 Ga0207639_10271537
666 Ga0207708_10027187
667 Ga0207702_10125014
668 Ga0207702_10766627
669 Ga0207702_10984273
670 Ga0207674_10020813
671 Ga0207674_10178776
672 Ga0207683_10249360
673 Ga0207683_10472901
674 Ga0207698_10164406
675 Ga0207428_10000222
676 Ga0207428_10025927
677 Ga0268265_10280385
678 Ga0265326_10035067
679 Ga0265319_1028723
680 Ga0265319_1058351
681 Ga0265334_10054076
682 Ga0265318_10008332
683 Ga0265318_10047343
684 Ga0265318_10074175
685 Ga0265322_10008089
686 Ga0265322_10083453
687 Ga0265336_10039806
688 Ga0265338_10015968
689 Ga0265338_10047369
690 Ga0265338_10162747
691 Ga0265338_10398586
692 Ga0265338_10679888
693 Ga0265324_10150377
694 Ga0265330_10005638
695 Ga0265330_10064515
696 Ga0265332_10008063
697 Ga0265332_10110012
698 Ga0265328_10009201
699 Ga0265320_10047985
700 Ga0265320_10065990
701 Ga0265320_10103115
702 Ga0265320_10120867
703 Ga0265325_10006670
704 Ga0265325_10105693
705 Ga0265329_10009861
706 Ga0265340_10057082
707 Ga0265339_10002100
708 Ga0265339_10032106
709 Ga0265339_10070201
710 Ga0265339_10103424
711 Ga0265331_10031291
712 Ga0265331_10061778
713 Ga0265327_10037760
714 Ga0265327_10138908
715 Ga0265316_10029669
716 Ga0265316_10058806
717 Ga0265316_10334688
718 Ga0307408_100134110
719 Ga0265313_10005017
720 Ga0265313_10034017
721 Ga0265313_10162936
722 Ga0265314_10050539
723 Ga0265314_10072998
724 Ga0265314_10091787
725 Ga0265342_10036130
726 Ga0265342_10043325
727 Ga0265342_10271301
728 Ga0307407_10113631
729 Ga0307412_10006980
730 Ga0307412_10743931
731 Ga0307409_100107835
732 Ga0307416_100008076
733 Ga0307414_10050810
734 Ga0307411_10034971
735 Ga0373931_0116682
736 Ga0395899_0008276
737 Ga0395900_0045019
738 Ga0395898_0273659
739 Ga0395898_0311207
740 Ga0395898_0612889
741 Ga0395905_0124002
742 Ga0395905_0734447
743 Ga0395905_0883016
744 Ga0395901_0067159
745 Ga0395901_0320611
746 Ga0395901_0551040
747 Ga0395901_0851085
748 Ga0436365_0518448
749 Ga0436360_0301195
750 Ga0436362_1066997
751 Ga0451853_0419703
752 Ga0451853_1509951
753 Ga0439448_0268436
754 Ga0439458_0029603
755 Ga0466966_0725825
756 Ga0466963_0062393
757 Ga0466963_0093254
758 Ga0466963_0318797
759 Ga0466963_0359879
760 Ga0466963_0404078
761 Ga0466963_1037294
762 Ga0466963_1300290
763 Ga0466964_0080589
764 Ga0466964_0111130
765 Ga0466971_0195077
766 Ga0466968_0036415
767 Ga0466957_0148435
768 Ga0466957_0251980
769 Ga0466958_0180073
770 Ga0466958_0253610
771 Ga0466967_0005132
772 Ga0466967_0006841
773 Ga0466967_0022359
774 Ga0466967_0078143
775 Ga0466967_0171363
776 Ga0466967_0232644
777 Ga0466967_0779536
778 Ga0466967_1908514
779 Ga0495641_0427349
780 Ga0495618_0158867
781 Ga0495630_0705533
782 Ga0495652_0871943
783 Ga0495684_0798456
784 Ga0496100_0094684
785 Ga0496100_0209590
786 Ga0496101_0146292
787 Ga0496101_0151065
788 Ga0496101_0264641
789 Ga0496102_0321285
790 Ga0496104_0159522
791 Ga0496104_0757383
792 Ga0496105_0176895
793 Ga0496106_0017574
794 Ga0496107_0140997
795 Ga0496107_1228064
796 Ga0496108_0361875
797 Ga0496109_0027953
798 Ga0496109_1603514
799 Ga0496110_0057726
800 Ga0496111_0001158
801 Ga0496111_0087158
802 Ga0496111_0422417
803 Ga0496112_0040389
804 Ga0496112_0072693
805 Ga0496112_0330037
806 Ga0496112_0412726
807 Ga0496113_0258571
808 Ga0496114_0138938
809 Ga0496114_0346734
810 Ga0496114_0397877
811 Ga0496114_0586360
812 Ga0501032_0140253
813 Ga0501032_0920918
814 Ga0501034_0013258
815 Ga0501036_0022719
816 Ga0501036_0260038
817 Ga0501039_0150575
818 Ga0501039_0213991
819 Ga0501040_0070580
820 Ga0501040_0258732
821 Ga0501040_0304982
822 Ga0501041_0051623
823 Ga0501041_0200072
824 Ga0501041_0305068
825 Ga0501042_0082324
826 Ga0501043_0576701
827 Ga0501046_0147061
828 Ga0501046_0810164
829 Ga0501047_0470381
830 Ga0501048_0187578
831 Ga0501048_0629314
832 Ga0501067_0090602
833 Ga0501068_0327561
834 Ga0501068_0369513
835 Ga0501068_0726967
836 Ga0501069_0003499
837 Ga0501069_0183765
838 Ga0501070_0004009
839 Ga0501070_0071058
840 Ga0501071_0003695
841 Ga0501072_0009849
842 Ga0501072_0015694
843 Ga0501072_0054805
844 Ga0501072_0210832
845 Ga0501073_0068702
846 Ga0501074_0017225
847 Ga0501074_0019944
848 Ga0501074_0304414
849 Ga0501075_0003897
850 Ga0501075_0011831
851 Ga0501075_0059936
852 Ga0501075_0245523
853 Ga0501076_0017242
854 Ga0501076_0080826
855 Ga0501076_0116097
856 Ga0501076_0129406
857 Ga0501076_0213391
858 Ga0501076_0572953
859 Ga0501077_0019864
860 Ga0501077_0022039
861 Ga0501077_0050060
862 Ga0501079_0001449
863 Ga0501079_0064843
864 Ga0501079_0132161
865 Ga0501079_0525409
866 Ga0501080_0000605
867 Ga0501080_0063799
868 Ga0501080_0107865
869 Ga0501080_0268174
870 Ga0501081_0052513
871 Ga0501081_0112441
872 Ga0501081_0275802
873 Ga0501081_0391624
874 Ga0501083_0002047
875 Ga0501083_0088719
876 Ga0501035_0170302
877 Ga0501044_0303444
878 Ga0501045_0063267
879 Ga0501045_0075987
880 Ga0501045_0160142
881 nmdc:mga03n38_69679_c1
882 nmdc:mga00v17_47441_c1
883 nmdc:mga0yw44_33886_c1
884 nmdc:mga07m45_63924_c1
885 nmdc:mga05p37_32138_c1
886 nmdc:mga09592_17326_c1
887 nmdc:mga09592_491788_c1
888 nmdc:mga08y16_1915184_c1
889 nmdc:mga08y16_25738_c1
890 nmdc:mga0n895_110061_c1
891 nmdc:mga0n895_260594_c1
892 nmdc:mga0n895_701354_c1
893 nmdc:mga0a205_203173_c1
894 nmdc:mga0a205_236082_c1
895 Ga0495619_0152418
896 Ga0501084_0046099
897 Ga0501084_0123844
898 Ga0501084_0414058
899 Ga0501082_0084265
900 Ga0501082_0561517
901 Ga0530510_0026502
902 Ga0530510_0291536
903 Ga0530510_1158626
904 Ga0530510_1229990

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04545

Sigma70_r4

Sigma-70, region 4

133

180

0.98

PF04542

Sigma70_r2

Sigma-70 region 2

43

110

0.94

PF08281

Sigma70_r4_2

Sigma-70, region 4

126

178

0.92

Map