metagRoot

F447009

General Info

Members	Datasets	Scaffolds	Average Seq Length
452	261	451	202

Family's Representative Sequence

Representative Sequence	3300026023\|Ga0207677_10325470\|Ga0207677_103254702
Length	232
Sequence	MDAPRQDRFRGRKNRGAALRRVGAGDARHAMTTAFPLVVAITGASGAPYAVRLLEALVHARQPVQLIVSDHGLRLLRTETDVDTVEALRARIGGVAWDACVTLFDDNDRGAAPASGSARNRGMVICPCSMGTISAISQGTSRSLVERAADVALKERRTLVVVPRETPYSAIHLENMLRLTRAGAIILPASPGFYHRPTRIDELVDFIVARVLDHLGVEHAIGRRWGDGPEDA

Samples

	Sample ID	Description	Type	Environment
1	2923525760	Aeromonas caviae SLBN-129	Isolate	Rhizosphere
2	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
3	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
4	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
5	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
6	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
7	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
8	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
9	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
10	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
11	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
12	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
13	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
14	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
15	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
16	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
17	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
18	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
19	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
20	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
21	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
22	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
23	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
24	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
25	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
26	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
27	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
28	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
29	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
30	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
31	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
32	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
33	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
34	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
35	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
36	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
37	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
38	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
39	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
40	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
41	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
42	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
43	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
44	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
45	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
46	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
47	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
48	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
49	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
50	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
51	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
52	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
53	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
54	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
55	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
56	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
57	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
58	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
59	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
60	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
61	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
62	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
63	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
64	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
65	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
66	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
67	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
68	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
69	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
70	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
71	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
72	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
73	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
74	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
75	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
76	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
77	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
78	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
79	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
80	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
81	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
82	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
83	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
84	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
85	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
86	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
87	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
88	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
89	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
90	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
91	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
92	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
93	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
94	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
95	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
96	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
97	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
98	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
99	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
100	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
101	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
158	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
159	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
160	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
161	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
162	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
163	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
164	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
165	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
166	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
167	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
168	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
169	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
170	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
171	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
172	3300033541	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
173	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
174	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
175	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
176	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
177	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
178	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
179	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
180	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
181	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
182	3300038725	Seagrass microbial communities from Seahorse Key, FL, USA - HV0818	Metagenome	Unclassified
183	3300038726	Seagrass microbial communities from Seahorse Key, FL, USA - TH0319	Metagenome	Unclassified
184	3300038735	Seagrass microbial communities from Seahorse Key, FL, USA - SH0319	Metagenome	Unclassified
185	3300038741	Seagrass microbial communities from Seahorse Key, FL, USA - SV0818	Metagenome	Unclassified
186	3300038742	Seagrass microbial communities from Seahorse Key, FL, USA - SH0818	Metagenome	Unclassified
187	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
188	3300039093	Seagrass microbial communities from Seahorse Key, FL, USA - TH0818	Metagenome	Unclassified
189	3300039110	Seagrass microbial communities from Seahorse Key, FL, USA - SV0319	Metagenome	Unclassified
190	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
191	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
192	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
193	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
194	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
195	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
196	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
197	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
198	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
199	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
200	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
201	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
202	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
203	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
204	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
205	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
206	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
207	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
208	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
209	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
210	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
211	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
212	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
213	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
214	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
215	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
216	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
217	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
218	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
219	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
220	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
221	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
222	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
223	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
224	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
225	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
226	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
227	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
228	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
229	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
230	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
231	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
232	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
233	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
234	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
235	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
236	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
237	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
238	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
239	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
240	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
241	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
242	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
243	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
244	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
245	3300049661	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control	Metagenome	Rhizosphere
246	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
247	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
248	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
249	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
250	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
251	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
252	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
253	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
254	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
255	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
256	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
257	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
258	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
259	3300053129	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere	Metagenome	Endosphere
260	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
261	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.34
Metatranscriptomes	0.44
Isolates	0.22

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	1.33
Nodule	0
Rhizoplane	2.21
Rhizosphere	91.59
Stem	0
Stem Tuber	0
Unclassified	4.87

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24737J22298_10084147	3300001990	Bacteria	946
2	rootH2_10032907	3300003320	Bacteria	16130
3	rootL2_10243202	3300003322	Bacteria	2133
4	Ga0070658_10009092	3300005327	Bacteria	7990
5	Ga0070676_10149937	3300005328	Bacteria	1492
6	Ga0070683_100003157	3300005329	Bacteria	13282
7	Ga0070683_100041003	3300005329	Bacteria	4257
8	Ga0070683_100076014	3300005329	Bacteria	3139
9	Ga0070683_100098277	3300005329	Unclassified	2755
10	Ga0070690_100226594	3300005330	Bacteria	1312
11	Ga0070680_100109860	3300005336	Unclassified	2295
12	Ga0070682_100367498	3300005337	Bacteria	1078
13	Ga0068868_100213903	3300005338	Bacteria	1612
14	Ga0068868_100267284	3300005338	Bacteria	1444
15	Ga0070660_100100235	3300005339	Bacteria	2294
16	Ga0070689_100065990	3300005340	Bacteria	2819
17	Ga0070691_10004087	3300005341	Bacteria	6617
18	Ga0070687_100020830	3300005343	Bacteria	3072
19	Ga0070661_100010151	3300005344	Bacteria	6540
20	Ga0070692_10525477	3300005345	Bacteria	771
21	Ga0070668_100040826	3300005347	Unclassified	3552
22	Ga0070668_100179718	3300005347	Bacteria	1728
23	Ga0070669_100009204	3300005353	Bacteria	7038
24	Ga0070669_100009562	3300005353	Bacteria	6903
25	Ga0070669_100051525	3300005353	Bacteria	3009
26	Ga0070669_100697598	3300005353	Bacteria	857
27	Ga0070675_100005786	3300005354	Bacteria	9462
28	Ga0070675_100071385	3300005354	Bacteria	2880
29	Ga0070675_100685790	3300005354	Bacteria	932
30	Ga0070674_100055633	3300005356	Unclassified	2741
31	Ga0070674_100224462	3300005356	Bacteria	1463
32	Ga0070674_100745234	3300005356	Bacteria	841
33	Ga0070673_100076738	3300005364	Bacteria	2699
34	Ga0070688_100008142	3300005365	Bacteria	5681
35	Ga0070688_100037611	3300005365	Bacteria	2950
36	Ga0070659_100261063	3300005366	Unclassified	1437
37	Ga0070667_100033702	3300005367	Bacteria	4284
38	Ga0070667_100037629	3300005367	Bacteria	4056
39	Ga0070667_100165635	3300005367	Bacteria	1949
40	Ga0070667_100374510	3300005367	Bacteria	1292
41	Ga0070709_10000598	3300005434	Bacteria	21084
42	Ga0070714_100014718	3300005435	Bacteria	6288
43	Ga0070713_100000274	3300005436	Bacteria	33771
44	Ga0070713_100059343	3300005436	Bacteria	3195
45	Ga0070710_10614580	3300005437	Bacteria	758
46	Ga0070701_10091409	3300005438	Bacteria	1668
47	Ga0070701_10260968	3300005438	Bacteria	1050
48	Ga0070711_100003271	3300005439	Bacteria	9420
49	Ga0070705_100036609	3300005440	Bacteria	2761
50	Ga0070700_100181199	3300005441	Bacteria	1466
51	Ga0070694_100139270	3300005444	Bacteria	1760
52	Ga0070678_100873178	3300005456	Bacteria	821
53	Ga0070662_100376659	3300005457	Bacteria	1168
54	Ga0070662_100443021	3300005457	Bacteria	1077
55	Ga0070681_10003433	3300005458	Bacteria	14840
56	Ga0070681_10793826	3300005458	Unclassified	864
57	Ga0068867_100851597	3300005459	Bacteria	817
58	Ga0070685_10002860	3300005466	Bacteria	8826
59	Ga0070685_10024946	3300005466	Bacteria	3288
60	Ga0070685_10475407	3300005466	Bacteria	880
61	Ga0070698_100078372	3300005471	Bacteria	3303
62	Ga0070698_100492522	3300005471	Bacteria	1163
63	Ga0070699_100208757	3300005518	Bacteria	1738
64	Ga0070699_100372002	3300005518	Unclassified	1289
65	Ga0070679_100056961	3300005530	Bacteria	3895
66	Ga0070684_100005587	3300005535	Bacteria	9659
67	Ga0070684_100080766	3300005535	Bacteria	2877
68	Ga0070684_100090164	3300005535	Bacteria	2726
69	Ga0070684_100114112	3300005535	Bacteria	2425
70	Ga0070697_100059625	3300005536	Bacteria	3108
71	Ga0068853_100139966	3300005539	Bacteria	2172
72	Ga0068853_100244021	3300005539	Bacteria	1647
73	Ga0070672_100005897	3300005543	Bacteria	8174
74	Ga0070672_100071005	3300005543	Bacteria	2768
75	Ga0070672_100152856	3300005543	Bacteria	1910
76	Ga0070672_100194016	3300005543	Bacteria	1697
77	Ga0070672_100528662	3300005543	Bacteria	1022
78	Ga0070686_100000013	3300005544	Bacteria	169327
79	Ga0070686_100166242	3300005544	Bacteria	1557
80	Ga0070695_100536704	3300005545	Bacteria	910
81	Ga0070696_100507487	3300005546	Bacteria	960
82	Ga0070665_100000030	3300005548	Bacteria	335245
83	Ga0070665_100080780	3300005548	Bacteria	3257
84	Ga0068855_100027692	3300005563	Bacteria	6780
85	Ga0068855_100442593	3300005563	Bacteria	1419
86	Ga0070664_100003727	3300005564	Bacteria	12289
87	Ga0070664_100005063	3300005564	Bacteria	10569
88	Ga0070664_100020968	3300005564	Bacteria	5383
89	Ga0070664_100023979	3300005564	Bacteria	5041
90	Ga0070664_100033329	3300005564	Bacteria	4314
91	Ga0070664_100055698	3300005564	Bacteria	3358
92	Ga0070664_100483455	3300005564	Bacteria	1140
93	Ga0068857_100001192	3300005577	Bacteria	20294
94	Ga0068857_100006933	3300005577	Bacteria	9751
95	Ga0068856_100117310	3300005614	Bacteria	2662
96	Ga0068856_100962035	3300005614	Bacteria	872
97	Ga0068856_101291479	3300005614	Bacteria	745
98	Ga0070702_100653069	3300005615	Bacteria	796
99	Ga0068852_100313301	3300005616	Bacteria	1522
100	Ga0068859_100253722	3300005617	Unclassified	1849
101	Ga0068864_100101168	3300005618	Bacteria	2556
102	Ga0068864_101210712	3300005618	Bacteria	754
103	Ga0068851_10003280	3300005834	Bacteria	7182
104	Ga0068851_10117366	3300005834	Bacteria	1427
105	Ga0068851_10184875	3300005834	Bacteria	1156
106	Ga0068870_10004881	3300005840	Bacteria	5801
107	Ga0068870_10035706	3300005840	Bacteria	2553
108	Ga0068863_100098923	3300005841	Unclassified	2771
109	Ga0068858_100009520	3300005842	Bacteria	9270
110	Ga0068858_100188965	3300005842	Unclassified	1946
111	Ga0068858_100203923	3300005842	Bacteria	1871
112	Ga0068858_100437063	3300005842	Bacteria	1260
113	Ga0068860_100468735	3300005843	Bacteria	1254
114	Ga0068862_100000513	3300005844	Bacteria	41174
115	Ga0068862_100017633	3300005844	Bacteria	5944
116	Ga0068862_100197673	3300005844	Bacteria	1812
117	Ga0070717_10068539	3300006028	Bacteria	2953
118	Ga0070716_100014090	3300006173	Bacteria	4090
119	Ga0070712_100318691	3300006175	Bacteria	1263
120	Ga0075428_100167918	3300006844	Bacteria	2380
121	Ga0075430_100096226	3300006846	Bacteria	2475
122	Ga0075430_100209039	3300006846	Bacteria	1619
123	Ga0075430_100557375	3300006846	Bacteria	945
124	Ga0075431_100004058	3300006847	Bacteria	14269
125	Ga0075431_100013704	3300006847	Bacteria	8192
126	Ga0075431_100135848	3300006847	Bacteria	2535
127	Ga0075431_100168462	3300006847	Bacteria	2251
128	Ga0075431_100238418	3300006847	Unclassified	1851
129	Ga0075433_10000144	3300006852	Bacteria	37455
130	Ga0075433_10007996	3300006852	Bacteria	8417
131	Ga0075433_10009053	3300006852	Bacteria	7953
132	Ga0075433_10016502	3300006852	Bacteria	6090
133	Ga0075434_100000281	3300006871	Bacteria	36197
134	Ga0075434_100110892	3300006871	Bacteria	2754
135	Ga0075429_100048213	3300006880	Bacteria	3705
136	Ga0075429_100121337	3300006880	Unclassified	2285
137	Ga0075429_100271060	3300006880	Bacteria	1487
138	Ga0068865_100101445	3300006881	Bacteria	2107
139	Ga0068865_100380545	3300006881	Bacteria	1151
140	Ga0075436_100029868	3300006914	Bacteria	3749
141	Ga0075436_100210126	3300006914	Bacteria	1379
142	Ga0097620_100253729	3300006931	Unclassified	1849
143	Ga0075435_100777580	3300007076	Bacteria	833
144	Ga0099794_10008630	3300007265	Bacteria	4243
145	Ga0105240_10010683	3300009093	Bacteria	12884
146	Ga0111539_10008670	3300009094	Bacteria	12908
147	Ga0111539_10038142	3300009094	Bacteria	5797
148	Ga0111539_10113405	3300009094	Bacteria	3179
149	Ga0111539_10156096	3300009094	Bacteria	2670
150	Ga0111539_10188229	3300009094	Bacteria	2409
151	Ga0105247_10086991	3300009101	Bacteria	1978
152	Ga0114129_10017750	3300009147	Bacteria	10134
153	Ga0114129_10192864	3300009147	Bacteria	2765
154	Ga0114129_10509279	3300009147	Bacteria	1571
155	Ga0105243_10128870	3300009148	Bacteria	2144
156	Ga0105243_10265164	3300009148	Bacteria	1540
157	Ga0105248_10074183	3300009177	Bacteria	3824
158	Ga0105248_10190077	3300009177	Bacteria	2314
159	Ga0105248_10317159	3300009177	Bacteria	1756
160	Ga0105248_10465824	3300009177	Bacteria	1425
161	Ga0105237_10003664	3300009545	Bacteria	18113
162	Ga0105237_10118717	3300009545	Bacteria	2639
163	Ga0105238_10048080	3300009551	Bacteria	4300
164	Ga0105249_10000251	3300009553	Bacteria	59080
165	Ga0105249_10149781	3300009553	Unclassified	2245
166	Ga0105239_10491210	3300010375	Bacteria	1395
167	Ga0105246_10527344	3300011119	Bacteria	1008
168	Ga0157373_10112296	3300013100	Bacteria	1916
169	Ga0157371_10790090	3300013102	Bacteria	715
170	Ga0157370_10062420	3300013104	Bacteria	3534
171	Ga0163162_10152404	3300013306	Bacteria	2430
172	Ga0163162_10163145	3300013306	Bacteria	2351
173	Ga0163162_10606922	3300013306	Bacteria	1220
174	Ga0157372_10054354	3300013307	Bacteria	4466
175	Ga0157372_10484799	3300013307	Bacteria	1441
176	Ga0157375_10046646	3300013308	Bacteria	4227
177	Ga0157375_10054996	3300013308	Bacteria	3922
178	Ga0157375_10110317	3300013308	Bacteria	2848
179	Ga0157375_10111201	3300013308	Bacteria	2838
180	Ga0157375_10223489	3300013308	Bacteria	2042
181	Ga0163163_10755978	3300014325	Bacteria	1035
182	Ga0157379_10738295	3300014968	Bacteria	926
183	Ga0182007_10040227	3300015262	Bacteria	1561
184	Ga0163161_10063093	3300017792	Bacteria	2700
185	Ga0213872_10000582	3300021361	Bacteria	28136
186	Ga0207656_10137109	3300025321	Bacteria	1151
187	Ga0207682_10043513	3300025893	Bacteria	1838
188	Ga0207692_10499008	3300025898	Bacteria	772
189	Ga0207710_10114211	3300025900	Bacteria	1284
190	Ga0207688_10089180	3300025901	Bacteria	1769
191	Ga0207699_10010878	3300025906	Unclassified	4582
192	Ga0207645_10058624	3300025907	Bacteria	2458
193	Ga0207645_10249203	3300025907	Bacteria	1175
194	Ga0207645_10334347	3300025907	Bacteria	1012
195	Ga0207643_10002389	3300025908	Bacteria	10186
196	Ga0207643_10004838	3300025908	Bacteria	7210
197	Ga0207684_10799585	3300025910	Bacteria	797
198	Ga0207654_10068109	3300025911	Bacteria	2105
199	Ga0207707_10007585	3300025912	Bacteria	9455
200	Ga0207695_10008487	3300025913	Bacteria	12846
201	Ga0207671_10028327	3300025914	Bacteria	4185
202	Ga0207693_10006746	3300025915	Bacteria	9480
203	Ga0207663_10000030	3300025916	Bacteria	98882
204	Ga0207662_10000706	3300025918	Bacteria	15281
205	Ga0207662_10016178	3300025918	Bacteria	4207
206	Ga0207662_10401696	3300025918	Unclassified	929
207	Ga0207657_10074972	3300025919	Bacteria	2856
208	Ga0207657_10177540	3300025919	Bacteria	1723
209	Ga0207649_10018491	3300025920	Bacteria	3965
210	Ga0207649_10072881	3300025920	Unclassified	2199
211	Ga0207649_10431601	3300025920	Bacteria	991
212	Ga0207652_10015544	3300025921	Bacteria	6191
213	Ga0207652_10916561	3300025921	Bacteria	773
214	Ga0207681_10001166	3300025923	Bacteria	16947
215	Ga0207681_10061280	3300025923	Bacteria	2586
216	Ga0207681_10583501	3300025923	Bacteria	922
217	Ga0207694_10039213	3300025924	Bacteria	3645
218	Ga0207694_10314187	3300025924	Bacteria	1292
219	Ga0207650_10242646	3300025925	Bacteria	1456
220	Ga0207650_10289365	3300025925	Bacteria	1336
221	Ga0207659_10039256	3300025926	Bacteria	3300
222	Ga0207659_10043274	3300025926	Bacteria	3162
223	Ga0207659_10422022	3300025926	Bacteria	1119
224	Ga0207659_10710899	3300025926	Bacteria	861
225	Ga0207700_10140069	3300025928	Bacteria	1986
226	Ga0207700_10266644	3300025928	Unclassified	1468
227	Ga0207664_10016358	3300025929	Bacteria	5410
228	Ga0207644_10052301	3300025931	Bacteria	2935
229	Ga0207644_10299719	3300025931	Bacteria	1295
230	Ga0207690_10040963	3300025932	Bacteria	3032
231	Ga0207706_10124936	3300025933	Unclassified	2263
232	Ga0207706_10183293	3300025933	Bacteria	1839
233	Ga0207706_10217713	3300025933	Bacteria	1673
234	Ga0207706_10295335	3300025933	Bacteria	1412
235	Ga0207686_10060489	3300025934	Bacteria	2398
236	Ga0207709_10183697	3300025935	Bacteria	1479
237	Ga0207669_10082513	3300025937	Unclassified	2064
238	Ga0207669_10245384	3300025937	Bacteria	1330
239	Ga0207669_10602452	3300025937	Bacteria	893
240	Ga0207691_10004665	3300025940	Bacteria	13267
241	Ga0207691_10011271	3300025940	Bacteria	8576
242	Ga0207691_10044234	3300025940	Bacteria	4099
243	Ga0207711_10208230	3300025941	Bacteria	1786
244	Ga0207711_10413820	3300025941	Bacteria	1253
245	Ga0207711_10567689	3300025941	Bacteria	1058
246	Ga0207711_10845726	3300025941	Bacteria	852
247	Ga0207689_10071106	3300025942	Bacteria	2858
248	Ga0207689_11042997	3300025942	Bacteria	690
249	Ga0207661_10145365	3300025944	Bacteria	2045
250	Ga0207661_10206975	3300025944	Bacteria	1727
251	Ga0207679_10004146	3300025945	Bacteria	9008
252	Ga0207679_10004479	3300025945	Bacteria	8707
253	Ga0207679_10106486	3300025945	Bacteria	2204
254	Ga0207679_10376010	3300025945	Bacteria	1244
255	Ga0207667_10018243	3300025949	Bacteria	7875
256	Ga0207651_10039968	3300025960	Bacteria	3098
257	Ga0207712_10009001	3300025961	Bacteria	6315
258	Ga0207712_10031648	3300025961	Unclassified	3565
259	Ga0207668_10006562	3300025972	Bacteria	6877
260	Ga0207668_10094740	3300025972	Bacteria	2202
261	Ga0207658_10183150	3300025986	Bacteria	1735
262	Ga0207658_10346573	3300025986	Bacteria	1292
263	Ga0207677_10302406	3300026023	Bacteria	1322
264	Ga0207677_10325470	3300026023	Bacteria	1279
265	Ga0207677_10841555	3300026023	Bacteria	824
266	Ga0207703_10007776	3300026035	Bacteria	8484
267	Ga0207703_10153683	3300026035	Unclassified	2009
268	Ga0207703_10310247	3300026035	Bacteria	1442
269	Ga0207639_10190305	3300026041	Bacteria	1752
270	Ga0207639_10321727	3300026041	Unclassified	1374
271	Ga0207678_10550673	3300026067	Bacteria	1009
272	Ga0207708_10449652	3300026075	Bacteria	1073
273	Ga0207702_10149508	3300026078	Bacteria	2123
274	Ga0207702_11165694	3300026078	Bacteria	765
275	Ga0207641_10132684	3300026088	Bacteria	2238
276	Ga0207641_10362196	3300026088	Bacteria	1385
277	Ga0207648_10041908	3300026089	Bacteria	4020
278	Ga0207648_10226686	3300026089	Bacteria	1662
279	Ga0207676_10133576	3300026095	Bacteria	2114
280	Ga0207674_10003423	3300026116	Bacteria	19422
281	Ga0207674_10004844	3300026116	Bacteria	16115
282	Ga0207674_10009304	3300026116	Bacteria	11253
283	Ga0207674_10052948	3300026116	Bacteria	4138
284	Ga0207675_100228094	3300026118	Bacteria	1796
285	Ga0207683_10216133	3300026121	Bacteria	1746
286	Ga0207698_10229439	3300026142	Bacteria	1684
287	Ga0268266_10000031	3300028379	Bacteria	406292
288	Ga0268265_10001595	3300028380	Bacteria	18725
289	Ga0268265_10073909	3300028380	Unclassified	2664
290	Ga0265338_10017993	3300028800	Bacteria	7587
291	Ga0265338_10069960	3300028800	Bacteria	3012
292	Ga0307511_10000356	3300030521	Bacteria	48468
293	Ga0265340_10045038	3300031247	Bacteria	2157
294	Ga0265314_10008518	3300031711	Bacteria	8769
295	Ga0307405_10021697	3300031731	Bacteria	3615
296	Ga0307405_10195992	3300031731	Bacteria	1463
297	Ga0307413_10185976	3300031824	Bacteria	1486
298	Ga0307413_10359336	3300031824	Bacteria	1127
299	Ga0307413_10420057	3300031824	Bacteria	1053
300	Ga0307410_10151456	3300031852	Bacteria	1727
301	Ga0307410_10292518	3300031852	Bacteria	1282
302	Ga0307406_10296895	3300031901	Bacteria	1239
303	Ga0307407_10051960	3300031903	Bacteria	2351
304	Ga0307412_10087585	3300031911	Bacteria	2170
305	Ga0307412_10224419	3300031911	Bacteria	1442
306	Ga0307409_100299336	3300031995	Unclassified	1495
307	Ga0307416_100212956	3300032002	Bacteria	1845
308	Ga0307416_100228148	3300032002	Bacteria	1793
309	Ga0307416_100619674	3300032002	Bacteria	1164
310	Ga0307416_100745661	3300032002	Bacteria	1071
311	Ga0307414_10307075	3300032004	Bacteria	1345
312	Ga0307411_10155905	3300032005	Bacteria	1703
313	Ga0307415_100044356	3300032126	Bacteria	2972
314	Ga0316596_1001341	3300033541	Bacteria	4906
315	Ga0316596_1026691	3300033541	Bacteria	1489
316	Ga0373960_0182107	3300035121	Unclassified	734
317	Ga0373943_0506295	3300035170	Unclassified	706
318	Ga0373955_0102248	3300035172	Bacteria	1647
319	Ga0373955_0241713	3300035172	Bacteria	1081
320	Ga0373931_0521787	3300035691	Bacteria	769
321	Ga0373947_0365049	3300035725	Unclassified	970
322	Ga0373937_0084835	3300036401	Bacteria	2931
323	Ga0316584_0498470	3300036712	Bacteria	856
324	Ga0373925_0622809	3300037068	Unclassified	889
325	Ga0395900_0490841	3300037418	Bacteria	1179
326	Ga0400484_29658	3300038725	Bacteria	15551
327	Ga0400490_22863	3300038726	Bacteria	7882
328	Ga0400490_36575	3300038726	Bacteria	6040
329	Ga0400490_45626	3300038726	Bacteria	3147
330	Ga0400485_05898	3300038735	Bacteria	1839
331	Ga0400485_15827	3300038735	Bacteria	4260
332	Ga0400488_09736	3300038741	Bacteria	1575
333	Ga0400486_12802	3300038742	Unclassified	1830
334	Ga0400486_24095	3300038742	Bacteria	7418
335	Ga0400483_011763	3300039062	Bacteria	1090
336	Ga0400483_071682	3300039062	Bacteria	12736
337	Ga0400483_179461	3300039062	Bacteria	9570
338	Ga0400483_221855	3300039062	Bacteria	4173
339	Ga0400489_74202	3300039093	Bacteria	17544
340	Ga0400489_93411	3300039093	Bacteria	1644
341	Ga0400487_28730	3300039110	Bacteria	5976
342	Ga0400487_56080	3300039110	Bacteria	12734
343	Ga0436365_0968870	3300039437	Bacteria	5425
344	Ga0436361_0085764	3300039447	Bacteria	21430
345	Ga0436361_0532182	3300039447	Bacteria	9986
346	Ga0439439_0050913	3300041406	Bacteria	1086
347	Ga0451577_0000264	3300042876	Bacteria	103723
348	Ga0451577_0150991	3300042876	Bacteria	2090
349	Ga0451577_0578203	3300042876	Bacteria	1020
350	Ga0466972_0030005	3300044658	Bacteria	2677
351	Ga0466963_0333028	3300044694	Bacteria	1069
352	Ga0453684_0000063	3300044712	Bacteria	486079
353	Ga0453684_0000222	3300044712	Bacteria	249870
354	Ga0466960_0068510	3300044901	Bacteria	1761
355	Ga0451576_0018803	3300045051	Bacteria	7554
356	Ga0451576_0533051	3300045051	Bacteria	1233
357	Ga0466958_0008680	3300045836	Bacteria	5643
358	Ga0466967_0066629	3300045976	Bacteria	3209
359	Ga0466967_0372351	3300045976	Bacteria	1385
360	Ga0466967_0876188	3300045976	Bacteria	892
361	Ga0495651_0245570	3300046462	Bacteria	1225
362	Ga0495653_0066433	3300046463	Bacteria	2713
363	Ga0495662_0034603	3300046476	Bacteria	2438
364	Ga0495608_0076639	3300046511	Bacteria	2177
365	Ga0495618_0068148	3300046514	Bacteria	2263
366	Ga0495628_0022638	3300046516	Bacteria	5161
367	Ga0495628_0048553	3300046516	Bacteria	3364
368	Ga0495628_0151644	3300046516	Bacteria	1765
369	Ga0495630_0004452	3300046517	Bacteria	9827
370	Ga0495665_0045799	3300046531	Bacteria	2324
371	Ga0495621_0005142	3300046539	Bacteria	3740
372	Ga0495645_0096173	3300046543	Bacteria	2111
373	Ga0495667_0155747	3300046559	Bacteria	1470
374	Ga0495634_0140735	3300046642	Bacteria	1532
375	Ga0495635_0037258	3300046663	Bacteria	3367
376	Ga0495635_0409323	3300046663	Bacteria	900
377	Ga0495657_0100900	3300046675	Unclassified	1839
378	Ga0495623_0098931	3300046679	Bacteria	1780
379	Ga0495646_0018565	3300046680	Bacteria	4404
380	Ga0495669_0180179	3300046684	Bacteria	1007
381	Ga0495613_0048216	3300046689	Bacteria	3145
382	Ga0495624_0116443	3300046690	Bacteria	1642
383	Ga0495600_0257717	3300046809	Bacteria	1108
384	Ga0495604_0050059	3300047317	Bacteria	3245
385	Ga0495604_0130935	3300047317	Bacteria	1803
386	Ga0495674_0015937	3300047319	Bacteria	7017
387	Ga0495676_0255494	3300047321	Bacteria	1194
388	Ga0495680_0052727	3300047322	Bacteria	3169
389	Ga0495680_0416918	3300047322	Bacteria	924
390	Ga0495675_0040335	3300047444	Bacteria	2975
391	Ga0495684_0136232	3300047471	Bacteria	1842
392	Ga0495602_0070684	3300048088	Bacteria	2985
393	Ga0495602_0384240	3300048088	Bacteria	1005
394	Ga0496100_0127018	3300048903	Bacteria	1791
395	Ga0496104_0249630	3300048907	Bacteria	1687
396	Ga0496104_0789126	3300048907	Bacteria	856
397	Ga0496108_0041285	3300048911	Bacteria	3851
398	Ga0496108_0605402	3300048911	Bacteria	955
399	Ga0496109_0024770	3300048912	Bacteria	5338
400	Ga0496110_0020349	3300048913	Bacteria	5603
401	Ga0496112_0092194	3300048915	Bacteria	2999
402	Ga0496112_0629494	3300048915	Bacteria	1003
403	Ga0496113_0023707	3300048916	Bacteria	4354
404	Ga0496126_0000003	3300048929	Bacteria	961576
405	Ga0501034_0491442	3300049571	Bacteria	1142
406	Ga0501034_0724466	3300049571	Bacteria	891
407	Ga0501036_0054148	3300049572	Bacteria	3398
408	Ga0501037_0325022	3300049573	Bacteria	1064
409	Ga0501039_0210081	3300049575	Bacteria	1531
410	Ga0501043_0282007	3300049579	Bacteria	1273
411	Ga0501047_0584759	3300049581	Bacteria	939
412	Ga0501073_0276484	3300049589	Bacteria	1158
413	Ga0501074_0099924	3300049590	Bacteria	2077
414	Ga0501076_0434429	3300049592	Bacteria	1081
415	Ga0501217_023284	3300049661	Bacteria	1475
416	Ga0501083_0016070	3300049744	Bacteria	5241
417	Ga0501083_0338480	3300049744	Bacteria	978
418	nmdc:mga05p37_15879_c1	3300050507	Bacteria	7261
419	nmdc:mga05p37_231395_c1	3300050507	Bacteria	2226
420	nmdc:mga05p37_23735_c1	3300050507	Bacteria	7447
421	nmdc:mga09592_310055_c1	3300050508	Bacteria	1368
422	nmdc:mga0qj67_221742_c1	3300050509	Bacteria	1535
423	nmdc:mga0qj67_30544_c1	3300050509	Bacteria	4196
424	nmdc:mga0qj67_35455_c1	3300050509	Bacteria	3901
425	nmdc:mga0qj67_45425_c1	3300050509	Bacteria	3466
426	nmdc:mga0qj67_53466_c1	3300050509	Bacteria	3198
427	nmdc:mga0qj67_536114_c1	3300050509	Bacteria	939
428	nmdc:mga0qj67_9110_c1	3300050509	Bacteria	7365
429	nmdc:mga06r32_100941_c1	3300050510	Bacteria	2831
430	nmdc:mga06r32_115942_c1	3300050510	Unclassified	2639
431	nmdc:mga06r32_268140_c1	3300050510	Bacteria	1695
432	nmdc:mga06r32_29285_c1	3300050510	Bacteria	5159
433	nmdc:mga06r32_48278_c1	3300050510	Bacteria	4068
434	nmdc:mga08y16_176433_c1	3300050511	Bacteria	2219
435	nmdc:mga08y16_23008_c2	3300050511	Bacteria	6222
436	nmdc:mga08y16_6696_c1	3300050511	Bacteria	12086
437	nmdc:mga08y16_87352_c1	3300050511	Bacteria	3249
438	nmdc:mga0n895_201_c1	3300050512	Bacteria	37245
439	nmdc:mga08x19_427642_c1	3300050514	Bacteria	931
440	nmdc:mga0a205_230773_c1	3300050515	Bacteria	1734
441	nmdc:mga0a205_244973_c1	3300050515	Bacteria	1673
442	nmdc:mga0a205_3162_c1	3300050515	Bacteria	14617
443	nmdc:mga0a205_34123_c1	3300050515	Bacteria	4015
444	nmdc:mga0a205_665_c1	3300050515	Bacteria	27382
445	Ga0495612_0008054	3300053078	Bacteria	4291
446	Ga0500643_112696	3300053087	Unclassified	734
447	Ga0500650_0287032	3300053098	Unclassified	731
448	Ga0500555_000016	3300053103	Bacteria	203144
449	Ga0500628_000094	3300053129	Bacteria	20048
450	Ga0500616_0011480	3300053153	Bacteria	5225
451	Ga0500645_043613	3300053730	Bacteria	1321

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300007076	Ga0075435_100777580	Ga0075435_1007775802	168
2	3300050514	nmdc:mga08x19_427642_c1	nmdc:mga08x19_427642_c1_160_684	174
3	3300005466	Ga0070685_10002860	Ga0070685_100028607	176
4	3300049571	Ga0501034_0491442	Ga0501034_0491442_574_1131	179
5	3300030521	Ga0307511_10000356	Ga0307511_1000035635	181
6	3300003322	rootL2_10243202	rootL2_102432023	185
7	3300005367	Ga0070667_100374510	Ga0070667_1003745102	185
8	3300005548	Ga0070665_100000030	Ga0070665_100000030126	185
9	3300005842	Ga0068858_100009520	Ga0068858_1000095208	185
10	3300005842	Ga0068858_100188965	Ga0068858_1001889652	185
11	3300006914	Ga0075436_100210126	Ga0075436_1002101262	185
12	3300007265	Ga0099794_10008630	Ga0099794_100086303	185
13	3300009093	Ga0105240_10010683	Ga0105240_1001068312	185
14	3300009101	Ga0105247_10086991	Ga0105247_100869913	185
15	3300009545	Ga0105237_10003664	Ga0105237_1000366412	185
16	3300013306	Ga0163162_10606922	Ga0163162_106069221	185
17	3300025900	Ga0207710_10114211	Ga0207710_101142112	185
18	3300025913	Ga0207695_10008487	Ga0207695_1000848712	185
19	3300025986	Ga0207658_10346573	Ga0207658_103465732	185
20	3300026035	Ga0207703_10007776	Ga0207703_100077767	185
21	3300026035	Ga0207703_10153683	Ga0207703_101536833	185
22	3300028379	Ga0268266_10000031	Ga0268266_10000031126	185
23	3300028800	Ga0265338_10017993	Ga0265338_100179932	185
24	3300028800	Ga0265338_10069960	Ga0265338_100699601	185
25	3300053087	Ga0500643_112696	Ga0500643_112696_68_628	185
26	3300053730	Ga0500645_043613	Ga0500645_043613_43_603	185
27	3300003320	rootH2_10032907	rootH2_100329075	186
28	3300009551	Ga0105238_10048080	Ga0105238_100480805	186
29	3300025924	Ga0207694_10039213	Ga0207694_100392132	186
30	3300049744	Ga0501083_0016070	Ga0501083_0016070_4408_4971	186
31	3300053098	Ga0500650_0287032	Ga0500650_0287032_149_721	186
32	3300053103	Ga0500555_000016	Ga0500555_000016_103629_104192	186
33	3300053153	Ga0500616_0011480	Ga0500616_0011480_418_981	186
34	3300005435	Ga0070714_100014718	Ga0070714_1000147183	187
35	3300005436	Ga0070713_100000274	Ga0070713_1000002743	187
36	3300005842	Ga0068858_100437063	Ga0068858_1004370632	187
37	3300006028	Ga0070717_10068539	Ga0070717_100685393	187
38	3300006175	Ga0070712_100318691	Ga0070712_1003186912	187
39	3300009177	Ga0105248_10465824	Ga0105248_104658242	187
40	3300025915	Ga0207693_10006746	Ga0207693_100067463	187
41	3300025928	Ga0207700_10140069	Ga0207700_101400694	187
42	3300025929	Ga0207664_10016358	Ga0207664_100163586	187
43	3300025941	Ga0207711_10567689	Ga0207711_105676892	187
44	3300026035	Ga0207703_10310247	Ga0207703_103102472	187
45	3300026088	Ga0207641_10132684	Ga0207641_101326842	187
46	3300005544	Ga0070686_100000013	Ga0070686_100000013163	189
47	3300005434	Ga0070709_10000598	Ga0070709_1000059813	190
48	3300005436	Ga0070713_100059343	Ga0070713_1000593433	190
49	3300005437	Ga0070710_10614580	Ga0070710_106145802	190
50	3300005439	Ga0070711_100003271	Ga0070711_1000032716	190
51	3300005444	Ga0070694_100139270	Ga0070694_1001392702	190
52	3300006173	Ga0070716_100014090	Ga0070716_1000140902	190
53	3300025898	Ga0207692_10499008	Ga0207692_104990081	190
54	3300025906	Ga0207699_10010878	Ga0207699_100108782	190
55	3300025916	Ga0207663_10000030	Ga0207663_10000030105	190
56	3300025928	Ga0207700_10266644	Ga0207700_102666441	190
57	3300042876	Ga0451577_0150991	Ga0451577_0150991_1105_1725	190
58	3300039062	Ga0400483_011763	Ga0400483_011763_376_972	191
59	iso_pu_bacteria	2923525760	2923529873	191
60	3300045976	Ga0466967_0876188	Ga0466967_0876188_175_777	192
61	3300046476	Ga0495662_0034603	Ga0495662_0034603_1506_2087	192
62	3300046531	Ga0495665_0045799	Ga0495665_0045799_226_807	192
63	3300046543	Ga0495645_0096173	Ga0495645_0096173_131_712	192
64	3300046690	Ga0495624_0116443	Ga0495624_0116443_108_689	192
65	3300049581	Ga0501047_0584759	Ga0501047_0584759_118_726	192
66	3300006852	Ga0075433_10007996	Ga0075433_100079963	193
67	3300050515	nmdc:mga0a205_34123_c1	nmdc:mga0a205_34123_c1_2017_2601	193
68	3300005341	Ga0070691_10004087	Ga0070691_100040872	194
69	3300005440	Ga0070705_100036609	Ga0070705_1000366093	194
70	3300005614	Ga0068856_100962035	Ga0068856_1009620352	194
71	3300006846	Ga0075430_100557375	Ga0075430_1005573752	194
72	3300025910	Ga0207684_10799585	Ga0207684_107995852	194
73	3300038741	Ga0400488_09736	Ga0400488_09736_248_853	194
74	3300042876	Ga0451577_0000264	Ga0451577_0000264_38238_38843	194
75	3300044712	Ga0453684_0000063	Ga0453684_0000063_211499_212104	194
76	3300044712	Ga0453684_0000222	Ga0453684_0000222_166503_167108	194
77	3300046675	Ga0495657_0100900	Ga0495657_0100900_314_898	194
78	3300047317	Ga0495604_0050059	Ga0495604_0050059_549_1133	194
79	3300047444	Ga0495675_0040335	Ga0495675_0040335_1366_1950	194
80	3300048088	Ga0495602_0384240	Ga0495602_0384240_17_601	194
81	3300050509	nmdc:mga0qj67_536114_c1	nmdc:mga0qj67_536114_c1_143_727	194
82	3300005536	Ga0070697_100059625	Ga0070697_1000596253	195
83	3300006847	Ga0075431_100004058	Ga0075431_1000040589	195
84	3300006852	Ga0075433_10009053	Ga0075433_100090534	195
85	3300006871	Ga0075434_100000281	Ga0075434_10000028132	195
86	3300006880	Ga0075429_100121337	Ga0075429_1001213372	195
87	3300006914	Ga0075436_100029868	Ga0075436_1000298682	195
88	3300009147	Ga0114129_10509279	Ga0114129_105092792	195
89	3300042876	Ga0451577_0578203	Ga0451577_0578203_388_978	195
90	3300045051	Ga0451576_0018803	Ga0451576_0018803_830_1420	195
91	3300045051	Ga0451576_0533051	Ga0451576_0533051_277_867	195
92	3300050507	nmdc:mga05p37_15879_c1	nmdc:mga05p37_15879_c1_2355_2945	195
93	3300050508	nmdc:mga09592_310055_c1	nmdc:mga09592_310055_c1_241_831	195
94	3300050510	nmdc:mga06r32_115942_c1	nmdc:mga06r32_115942_c1_349_939	195
95	3300050512	nmdc:mga0n895_201_c1	nmdc:mga0n895_201_c1_28169_28759	195
96	3300050515	nmdc:mga0a205_3162_c1	nmdc:mga0a205_3162_c1_12132_12722	195
97	3300006847	Ga0075431_100168462	Ga0075431_1001684623	196
98	3300038725	Ga0400484_29658	Ga0400484_29658_8081_8704	196
99	3300038726	Ga0400490_22863	Ga0400490_22863_4720_5343	196
100	3300038726	Ga0400490_36575	Ga0400490_36575_2334_2957	196
101	3300038726	Ga0400490_45626	Ga0400490_45626_817_1428	196
102	3300038735	Ga0400485_05898	Ga0400485_05898_380_991	196
103	3300038735	Ga0400485_15827	Ga0400485_15827_1573_2208	196
104	3300038742	Ga0400486_12802	Ga0400486_12802_71_682	196
105	3300038742	Ga0400486_24095	Ga0400486_24095_4179_4814	196
106	3300039062	Ga0400483_071682	Ga0400483_071682_9715_10326	196
107	3300039062	Ga0400483_179461	Ga0400483_179461_2403_3014	196
108	3300039093	Ga0400489_74202	Ga0400489_74202_13117_13752	196
109	3300039093	Ga0400489_93411	Ga0400489_93411_870_1481	196
110	3300039110	Ga0400487_28730	Ga0400487_28730_4258_4893	196
111	3300039110	Ga0400487_56080	Ga0400487_56080_9313_9936	196
112	3300050509	nmdc:mga0qj67_30544_c1	nmdc:mga0qj67_30544_c1_837_1460	196
113	3300050510	nmdc:mga06r32_29285_c1	nmdc:mga06r32_29285_c1_793_1416	196
114	3300005546	Ga0070696_100507487	Ga0070696_1005074871	197
115	3300031247	Ga0265340_10045038	Ga0265340_100450382	197
116	3300031711	Ga0265314_10008518	Ga0265314_100085189	197
117	3300033541	Ga0316596_1001341	Ga0316596_10013412	197
118	3300049571	Ga0501034_0724466	Ga0501034_0724466_138_755	197
119	3300049572	Ga0501036_0054148	Ga0501036_0054148_87_704	197
120	3300049573	Ga0501037_0325022	Ga0501037_0325022_275_892	197
121	3300049575	Ga0501039_0210081	Ga0501039_0210081_864_1481	197
122	3300049579	Ga0501043_0282007	Ga0501043_0282007_597_1214	197
123	3300049589	Ga0501073_0276484	Ga0501073_0276484_55_672	197
124	3300049590	Ga0501074_0099924	Ga0501074_0099924_915_1532	197
125	3300049592	Ga0501076_0434429	Ga0501076_0434429_335_952	197
126	3300049744	Ga0501083_0338480	Ga0501083_0338480_70_687	197
127	3300005545	Ga0070695_100536704	Ga0070695_1005367041	198
128	3300005563	Ga0068855_100027692	Ga0068855_1000276926	198
129	3300005564	Ga0070664_100033329	Ga0070664_1000333296	198
130	3300005614	Ga0068856_100117310	Ga0068856_1001173103	198
131	3300006852	Ga0075433_10000144	Ga0075433_100001445	198
132	3300009094	Ga0111539_10113405	Ga0111539_101134052	198
133	3300009545	Ga0105237_10118717	Ga0105237_101187173	198
134	3300010375	Ga0105239_10491210	Ga0105239_104912102	198
135	3300013104	Ga0157370_10062420	Ga0157370_100624205	198
136	3300025911	Ga0207654_10068109	Ga0207654_100681093	198
137	3300025914	Ga0207671_10028327	Ga0207671_100283273	198
138	3300025918	Ga0207662_10401696	Ga0207662_104016961	198
139	3300025924	Ga0207694_10314187	Ga0207694_103141872	198
140	3300025933	Ga0207706_10183293	Ga0207706_101832933	198
141	3300025934	Ga0207686_10060489	Ga0207686_100604894	198
142	3300025941	Ga0207711_10208230	Ga0207711_102082302	198
143	3300025949	Ga0207667_10018243	Ga0207667_100182432	198
144	3300025972	Ga0207668_10094740	Ga0207668_100947404	198
145	3300026078	Ga0207702_10149508	Ga0207702_101495082	198
146	3300033541	Ga0316596_1026691	Ga0316596_10266913	198
147	3300035121	Ga0373960_0182107	Ga0373960_0182107_92_721	198
148	3300035172	Ga0373955_0102248	Ga0373955_0102248_353_982	198
149	3300035172	Ga0373955_0241713	Ga0373955_0241713_290_943	198
150	3300039062	Ga0400483_221855	Ga0400483_221855_2131_2748	198
151	3300039437	Ga0436365_0968870	Ga0436365_0968870_2066_2695	198
152	3300044658	Ga0466972_0030005	Ga0466972_0030005_1496_2110	198
153	3300044694	Ga0466963_0333028	Ga0466963_0333028_71_691	198
154	3300044901	Ga0466960_0068510	Ga0466960_0068510_198_812	198
155	3300045976	Ga0466967_0372351	Ga0466967_0372351_769_1368	198
156	3300046514	Ga0495618_0068148	Ga0495618_0068148_1423_2076	198
157	3300046516	Ga0495628_0022638	Ga0495628_0022638_3150_3779	198
158	3300046516	Ga0495628_0048553	Ga0495628_0048553_635_1264	198
159	3300046517	Ga0495630_0004452	Ga0495630_0004452_4911_5540	198
160	3300046642	Ga0495634_0140735	Ga0495634_0140735_319_972	198
161	3300046663	Ga0495635_0409323	Ga0495635_0409323_102_755	198
162	3300047322	Ga0495680_0416918	Ga0495680_0416918_215_844	198
163	3300050511	nmdc:mga08y16_87352_c1	nmdc:mga08y16_87352_c1_484_1113	198
164	3300050515	nmdc:mga0a205_230773_c1	nmdc:mga0a205_230773_c1_511_1140	198
165	3300050515	nmdc:mga0a205_665_c1	nmdc:mga0a205_665_c1_23029_23658	198
166	3300053078	Ga0495612_0008054	Ga0495612_0008054_3343_3972	198
167	3300005329	Ga0070683_100076014	Ga0070683_1000760142	199
168	3300005354	Ga0070675_100685790	Ga0070675_1006857901	199
169	3300005518	Ga0070699_100372002	Ga0070699_1003720022	199
170	3300005535	Ga0070684_100114112	Ga0070684_1001141122	199
171	3300009094	Ga0111539_10008670	Ga0111539_100086704	199
172	3300015262	Ga0182007_10040227	Ga0182007_100402272	199
173	3300021361	Ga0213872_10000582	Ga0213872_1000058226	199
174	3300025942	Ga0207689_11042997	Ga0207689_110429972	199
175	3300032002	Ga0307416_100212956	Ga0307416_1002129562	199
176	3300039447	Ga0436361_0085764	Ga0436361_0085764_5949_6572	199
177	3300041406	Ga0439439_0050913	Ga0439439_0050913_277_879	199
178	3300049661	Ga0501217_023284	Ga0501217_023284_448_1050	199
179	3300050511	nmdc:mga08y16_6696_c1	nmdc:mga08y16_6696_c1_2937_3539	199
180	3300005614	Ga0068856_101291479	Ga0068856_1012914791	200
181	3300026078	Ga0207702_11165694	Ga0207702_111656941	200
182	3300031824	Ga0307413_10420057	Ga0307413_104200572	200
183	3300031852	Ga0307410_10292518	Ga0307410_102925182	200
184	3300032004	Ga0307414_10307075	Ga0307414_103070752	200
185	3300036401	Ga0373937_0084835	Ga0373937_0084835_1720_2325	200
186	3300039447	Ga0436361_0532182	Ga0436361_0532182_2484_3110	200
187	3300045976	Ga0466967_0066629	Ga0466967_0066629_1403_2023	200
188	3300046462	Ga0495651_0245570	Ga0495651_0245570_113_718	200
189	3300046463	Ga0495653_0066433	Ga0495653_0066433_942_1547	200
190	3300046511	Ga0495608_0076639	Ga0495608_0076639_676_1281	200
191	3300046516	Ga0495628_0151644	Ga0495628_0151644_77_682	200
192	3300046559	Ga0495667_0155747	Ga0495667_0155747_38_643	200
193	3300046663	Ga0495635_0037258	Ga0495635_0037258_645_1250	200
194	3300046679	Ga0495623_0098931	Ga0495623_0098931_710_1315	200
195	3300046680	Ga0495646_0018565	Ga0495646_0018565_3028_3633	200
196	3300046689	Ga0495613_0048216	Ga0495613_0048216_1168_1773	200
197	3300046809	Ga0495600_0257717	Ga0495600_0257717_333_938	200
198	3300047317	Ga0495604_0130935	Ga0495604_0130935_48_653	200
199	3300047319	Ga0495674_0015937	Ga0495674_0015937_1900_2505	200
200	3300047322	Ga0495680_0052727	Ga0495680_0052727_1193_1798	200
201	3300047471	Ga0495684_0136232	Ga0495684_0136232_1066_1671	200
202	3300048088	Ga0495602_0070684	Ga0495602_0070684_955_1560	200
203	3300048907	Ga0496104_0249630	Ga0496104_0249630_979_1602	200
204	3300048911	Ga0496108_0041285	Ga0496108_0041285_625_1248	200
205	3300048912	Ga0496109_0024770	Ga0496109_0024770_4451_5074	200
206	3300048913	Ga0496110_0020349	Ga0496110_0020349_4923_5546	200
207	3300048915	Ga0496112_0092194	Ga0496112_0092194_918_1541	200
208	3300005330	Ga0070690_100226594	Ga0070690_1002265942	201
209	3300005338	Ga0068868_100213903	Ga0068868_1002139032	201
210	3300005340	Ga0070689_100065990	Ga0070689_1000659903	201
211	3300005343	Ga0070687_100020830	Ga0070687_1000208303	201
212	3300005347	Ga0070668_100179718	Ga0070668_1001797183	201
213	3300005354	Ga0070675_100071385	Ga0070675_1000713853	201
214	3300005365	Ga0070688_100037611	Ga0070688_1000376113	201
215	3300005367	Ga0070667_100033702	Ga0070667_1000337024	201
216	3300005441	Ga0070700_100181199	Ga0070700_1001811992	201
217	3300005466	Ga0070685_10475407	Ga0070685_104754071	201
218	3300005471	Ga0070698_100078372	Ga0070698_1000783723	201
219	3300005543	Ga0070672_100152856	Ga0070672_1001528563	201
220	3300005544	Ga0070686_100166242	Ga0070686_1001662422	201
221	3300005548	Ga0070665_100080780	Ga0070665_1000807803	201
222	3300005617	Ga0068859_100253722	Ga0068859_1002537222	201
223	3300005841	Ga0068863_100098923	Ga0068863_1000989233	201
224	3300005843	Ga0068860_100468735	Ga0068860_1004687352	201
225	3300005844	Ga0068862_100017633	Ga0068862_1000176337	201
226	3300006846	Ga0075430_100096226	Ga0075430_1000962264	201
227	3300006847	Ga0075431_100135848	Ga0075431_1001358482	201
228	3300006847	Ga0075431_100238418	Ga0075431_1002384182	201
229	3300006880	Ga0075429_100048213	Ga0075429_1000482135	201
230	3300006931	Ga0097620_100253729	Ga0097620_1002537292	201
231	3300009148	Ga0105243_10265164	Ga0105243_102651642	201
232	3300009553	Ga0105249_10149781	Ga0105249_101497812	201
233	3300013308	Ga0157375_10223489	Ga0157375_102234892	201
234	3300014325	Ga0163163_10755978	Ga0163163_107559782	201
235	3300025918	Ga0207662_10016178	Ga0207662_100161783	201
236	3300025926	Ga0207659_10039256	Ga0207659_100392563	201
237	3300025941	Ga0207711_10413820	Ga0207711_104138202	201
238	3300025942	Ga0207689_10071106	Ga0207689_100711062	201
239	3300025945	Ga0207679_10376010	Ga0207679_103760102	201
240	3300025961	Ga0207712_10031648	Ga0207712_100316482	201
241	3300026023	Ga0207677_10302406	Ga0207677_103024062	201
242	3300026075	Ga0207708_10449652	Ga0207708_104496522	201
243	3300026089	Ga0207648_10041908	Ga0207648_100419083	201
244	3300028380	Ga0268265_10073909	Ga0268265_100739092	201
245	3300031995	Ga0307409_100299336	Ga0307409_1002993363	201
246	3300032002	Ga0307416_100619674	Ga0307416_1006196742	201
247	3300036712	Ga0316584_0498470	Ga0316584_0498470_34_669	201
248	3300047321	Ga0495676_0255494	Ga0495676_0255494_442_1053	201
249	3300050509	nmdc:mga0qj67_221742_c1	nmdc:mga0qj67_221742_c1_556_1164	201
250	3300050509	nmdc:mga0qj67_45425_c1	nmdc:mga0qj67_45425_c1_1359_1967	201
251	3300050509	nmdc:mga0qj67_9110_c1	nmdc:mga0qj67_9110_c1_4074_4682	201
252	3300050510	nmdc:mga06r32_100941_c1	nmdc:mga06r32_100941_c1_1160_1768	201
253	3300050510	nmdc:mga06r32_48278_c1	nmdc:mga06r32_48278_c1_2497_3105	201
254	3300053129	Ga0500628_000094	Ga0500628_000094_12590_13207	201
255	3300005328	Ga0070676_10149937	Ga0070676_101499372	202
256	3300005329	Ga0070683_100098277	Ga0070683_1000982772	202
257	3300005336	Ga0070680_100109860	Ga0070680_1001098602	202
258	3300005338	Ga0068868_100267284	Ga0068868_1002672843	202
259	3300005339	Ga0070660_100100235	Ga0070660_1001002353	202
260	3300005344	Ga0070661_100010151	Ga0070661_1000101514	202
261	3300005353	Ga0070669_100051525	Ga0070669_1000515252	202
262	3300005356	Ga0070674_100055633	Ga0070674_1000556334	202
263	3300005356	Ga0070674_100745234	Ga0070674_1007452342	202
264	3300005366	Ga0070659_100261063	Ga0070659_1002610632	202
265	3300005458	Ga0070681_10003433	Ga0070681_1000343313	202
266	3300005530	Ga0070679_100056961	Ga0070679_1000569613	202
267	3300005535	Ga0070684_100080766	Ga0070684_1000807662	202
268	3300005539	Ga0068853_100244021	Ga0068853_1002440212	202
269	3300005543	Ga0070672_100528662	Ga0070672_1005286622	202
270	3300005564	Ga0070664_100005063	Ga0070664_1000050638	202
271	3300005577	Ga0068857_100001192	Ga0068857_10000119210	202
272	3300005834	Ga0068851_10003280	Ga0068851_100032804	202
273	3300006846	Ga0075430_100209039	Ga0075430_1002090393	202
274	3300006847	Ga0075431_100013704	Ga0075431_1000137048	202
275	3300006852	Ga0075433_10016502	Ga0075433_100165028	202
276	3300006871	Ga0075434_100110892	Ga0075434_1001108923	202
277	3300006880	Ga0075429_100271060	Ga0075429_1002710602	202
278	3300009094	Ga0111539_10038142	Ga0111539_100381427	202
279	3300009147	Ga0114129_10017750	Ga0114129_100177507	202
280	3300009147	Ga0114129_10192864	Ga0114129_101928644	202
281	3300009177	Ga0105248_10317159	Ga0105248_103171592	202
282	3300025907	Ga0207645_10058624	Ga0207645_100586242	202
283	3300025912	Ga0207707_10007585	Ga0207707_100075854	202
284	3300025919	Ga0207657_10074972	Ga0207657_100749723	202
285	3300025919	Ga0207657_10177540	Ga0207657_101775402	202
286	3300025920	Ga0207649_10072881	Ga0207649_100728812	202
287	3300025921	Ga0207652_10015544	Ga0207652_100155444	202
288	3300025923	Ga0207681_10061280	Ga0207681_100612803	202
289	3300025933	Ga0207706_10295335	Ga0207706_102953352	202
290	3300025937	Ga0207669_10082513	Ga0207669_100825132	202
291	3300025937	Ga0207669_10602452	Ga0207669_106024521	202
292	3300025941	Ga0207711_10845726	Ga0207711_108457262	202
293	3300025945	Ga0207679_10004479	Ga0207679_100044797	202
294	3300026041	Ga0207639_10321727	Ga0207639_103217272	202
295	3300026116	Ga0207674_10003423	Ga0207674_1000342318	202
296	3300031911	Ga0307412_10087585	Ga0307412_100875852	202
297	3300035691	Ga0373931_0521787	Ga0373931_0521787_97_708	202
298	3300037418	Ga0395900_0490841	Ga0395900_0490841_60_716	202
299	3300045836	Ga0466958_0008680	Ga0466958_0008680_4992_5606	202
300	3300050507	nmdc:mga05p37_231395_c1	nmdc:mga05p37_231395_c1_154_765	202
301	3300050507	nmdc:mga05p37_23735_c1	nmdc:mga05p37_23735_c1_3115_3726	202
302	3300050509	nmdc:mga0qj67_53466_c1	nmdc:mga0qj67_53466_c1_2443_3057	202
303	3300050510	nmdc:mga06r32_268140_c1	nmdc:mga06r32_268140_c1_770_1384	202
304	3300050511	nmdc:mga08y16_23008_c2	nmdc:mga08y16_23008_c2_2242_2853	202
305	3300050515	nmdc:mga0a205_244973_c1	nmdc:mga0a205_244973_c1_627_1238	202
306	3300005347	Ga0070668_100040826	Ga0070668_1000408262	203
307	3300005353	Ga0070669_100009204	Ga0070669_1000092048	203
308	3300005438	Ga0070701_10091409	Ga0070701_100914091	203
309	3300005457	Ga0070662_100376659	Ga0070662_1003766592	203
310	3300005458	Ga0070681_10793826	Ga0070681_107938261	203
311	3300005459	Ga0068867_100851597	Ga0068867_1008515971	203
312	3300005471	Ga0070698_100492522	Ga0070698_1004925222	203
313	3300005543	Ga0070672_100071005	Ga0070672_1000710052	203
314	3300005564	Ga0070664_100055698	Ga0070664_1000556984	203
315	3300005577	Ga0068857_100006933	Ga0068857_10000693310	203
316	3300005616	Ga0068852_100313301	Ga0068852_1003133012	203
317	3300005840	Ga0068870_10035706	Ga0068870_100357062	203
318	3300005844	Ga0068862_100000513	Ga0068862_10000051334	203
319	3300005844	Ga0068862_100197673	Ga0068862_1001976733	203
320	3300006881	Ga0068865_100380545	Ga0068865_1003805452	203
321	3300009094	Ga0111539_10156096	Ga0111539_101560962	203
322	3300009553	Ga0105249_10000251	Ga0105249_1000025121	203
323	3300013306	Ga0163162_10152404	Ga0163162_101524044	203
324	3300013308	Ga0157375_10054996	Ga0157375_100549964	203
325	3300025893	Ga0207682_10043513	Ga0207682_100435132	203
326	3300025907	Ga0207645_10249203	Ga0207645_102492031	203
327	3300025908	Ga0207643_10002389	Ga0207643_100023893	203
328	3300025923	Ga0207681_10001166	Ga0207681_1000116616	203
329	3300025925	Ga0207650_10289365	Ga0207650_102893652	203
330	3300025933	Ga0207706_10217713	Ga0207706_102177132	203
331	3300025940	Ga0207691_10011271	Ga0207691_100112715	203
332	3300025961	Ga0207712_10009001	Ga0207712_100090015	203
333	3300025972	Ga0207668_10006562	Ga0207668_100065623	203
334	3300026089	Ga0207648_10226686	Ga0207648_102266862	203
335	3300026116	Ga0207674_10004844	Ga0207674_1000484413	203
336	3300026116	Ga0207674_10052948	Ga0207674_100529482	203
337	3300026118	Ga0207675_100228094	Ga0207675_1002280942	203
338	3300026142	Ga0207698_10229439	Ga0207698_102294392	203
339	3300028380	Ga0268265_10001595	Ga0268265_1000159517	203
340	3300050511	nmdc:mga08y16_176433_c1	nmdc:mga08y16_176433_c1_1359_1976	203
341	3300001990	JGI24737J22298_10084147	JGI24737J22298_100841472	204
342	3300005327	Ga0070658_10009092	Ga0070658_100090924	204
343	3300005329	Ga0070683_100003157	Ga0070683_10000315711	204
344	3300005329	Ga0070683_100041003	Ga0070683_1000410033	204
345	3300005337	Ga0070682_100367498	Ga0070682_1003674982	204
346	3300005345	Ga0070692_10525477	Ga0070692_105254771	204
347	3300005353	Ga0070669_100009562	Ga0070669_1000095628	204
348	3300005353	Ga0070669_100697598	Ga0070669_1006975981	204
349	3300005354	Ga0070675_100005786	Ga0070675_1000057863	204
350	3300005356	Ga0070674_100224462	Ga0070674_1002244623	204
351	3300005364	Ga0070673_100076738	Ga0070673_1000767382	204
352	3300005365	Ga0070688_100008142	Ga0070688_1000081428	204
353	3300005367	Ga0070667_100037629	Ga0070667_1000376292	204
354	3300005367	Ga0070667_100165635	Ga0070667_1001656353	204
355	3300005438	Ga0070701_10260968	Ga0070701_102609681	204
356	3300005456	Ga0070678_100873178	Ga0070678_1008731781	204
357	3300005457	Ga0070662_100443021	Ga0070662_1004430211	204
358	3300005466	Ga0070685_10024946	Ga0070685_100249463	204
359	3300005518	Ga0070699_100208757	Ga0070699_1002087571	204
360	3300005535	Ga0070684_100005587	Ga0070684_1000055874	204
361	3300005535	Ga0070684_100090164	Ga0070684_1000901643	204
362	3300005539	Ga0068853_100139966	Ga0068853_1001399662	204
363	3300005543	Ga0070672_100005897	Ga0070672_1000058977	204
364	3300005543	Ga0070672_100194016	Ga0070672_1001940162	204
365	3300005563	Ga0068855_100442593	Ga0068855_1004425932	204
366	3300005564	Ga0070664_100003727	Ga0070664_1000037277	204
367	3300005564	Ga0070664_100020968	Ga0070664_1000209683	204
368	3300005564	Ga0070664_100023979	Ga0070664_1000239795	204
369	3300005564	Ga0070664_100483455	Ga0070664_1004834552	204
370	3300005615	Ga0070702_100653069	Ga0070702_1006530691	204
371	3300005618	Ga0068864_100101168	Ga0068864_1001011682	204
372	3300005618	Ga0068864_101210712	Ga0068864_1012107121	204
373	3300005834	Ga0068851_10117366	Ga0068851_101173662	204
374	3300005834	Ga0068851_10184875	Ga0068851_101848752	204
375	3300005840	Ga0068870_10004881	Ga0068870_100048817	204
376	3300005842	Ga0068858_100203923	Ga0068858_1002039233	204
377	3300006844	Ga0075428_100167918	Ga0075428_1001679183	204
378	3300006881	Ga0068865_100101445	Ga0068865_1001014452	204
379	3300009094	Ga0111539_10188229	Ga0111539_101882293	204
380	3300009148	Ga0105243_10128870	Ga0105243_101288703	204
381	3300009177	Ga0105248_10074183	Ga0105248_100741832	204
382	3300009177	Ga0105248_10190077	Ga0105248_101900773	204
383	3300011119	Ga0105246_10527344	Ga0105246_105273442	204
384	3300013100	Ga0157373_10112296	Ga0157373_101122962	204
385	3300013102	Ga0157371_10790090	Ga0157371_107900902	204
386	3300013306	Ga0163162_10163145	Ga0163162_101631452	204
387	3300013307	Ga0157372_10054354	Ga0157372_100543542	204
388	3300013307	Ga0157372_10484799	Ga0157372_104847992	204
389	3300013308	Ga0157375_10046646	Ga0157375_100466465	204
390	3300013308	Ga0157375_10110317	Ga0157375_101103171	204
391	3300013308	Ga0157375_10111201	Ga0157375_101112013	204
392	3300014968	Ga0157379_10738295	Ga0157379_107382952	204
393	3300017792	Ga0163161_10063093	Ga0163161_100630934	204
394	3300025321	Ga0207656_10137109	Ga0207656_101371092	204
395	3300025901	Ga0207688_10089180	Ga0207688_100891802	204
396	3300025907	Ga0207645_10334347	Ga0207645_103343472	204
397	3300025908	Ga0207643_10004838	Ga0207643_100048389	204
398	3300025918	Ga0207662_10000706	Ga0207662_1000070610	204
399	3300025920	Ga0207649_10018491	Ga0207649_100184913	204
400	3300025920	Ga0207649_10431601	Ga0207649_104316012	204
401	3300025921	Ga0207652_10916561	Ga0207652_109165612	204
402	3300025923	Ga0207681_10583501	Ga0207681_105835012	204
403	3300025925	Ga0207650_10242646	Ga0207650_102426462	204
404	3300025926	Ga0207659_10043274	Ga0207659_100432742	204
405	3300025926	Ga0207659_10422022	Ga0207659_104220222	204
406	3300025926	Ga0207659_10710899	Ga0207659_107108992	204
407	3300025931	Ga0207644_10052301	Ga0207644_100523013	204
408	3300025931	Ga0207644_10299719	Ga0207644_102997193	204
409	3300025932	Ga0207690_10040963	Ga0207690_100409631	204
410	3300025933	Ga0207706_10124936	Ga0207706_101249362	204
411	3300025935	Ga0207709_10183697	Ga0207709_101836973	204
412	3300025937	Ga0207669_10245384	Ga0207669_102453842	204
413	3300025940	Ga0207691_10004665	Ga0207691_100046658	204
414	3300025940	Ga0207691_10044234	Ga0207691_100442343	204
415	3300025944	Ga0207661_10145365	Ga0207661_101453652	204
416	3300025944	Ga0207661_10206975	Ga0207661_102069752	204
417	3300025945	Ga0207679_10004146	Ga0207679_100041464	204
418	3300025945	Ga0207679_10106486	Ga0207679_101064862	204
419	3300025960	Ga0207651_10039968	Ga0207651_100399684	204
420	3300025986	Ga0207658_10183150	Ga0207658_101831502	204
421	3300026023	Ga0207677_10325470	Ga0207677_103254702	204
422	3300026023	Ga0207677_10841555	Ga0207677_108415551	204
423	3300026041	Ga0207639_10190305	Ga0207639_101903053	204
424	3300026067	Ga0207678_10550673	Ga0207678_105506732	204
425	3300026088	Ga0207641_10362196	Ga0207641_103621962	204
426	3300026095	Ga0207676_10133576	Ga0207676_101335763	204
427	3300026116	Ga0207674_10009304	Ga0207674_100093044	204
428	3300026121	Ga0207683_10216133	Ga0207683_102161332	204
429	3300031731	Ga0307405_10021697	Ga0307405_100216972	204
430	3300031731	Ga0307405_10195992	Ga0307405_101959922	204
431	3300031824	Ga0307413_10185976	Ga0307413_101859762	204
432	3300031824	Ga0307413_10359336	Ga0307413_103593362	204
433	3300031852	Ga0307410_10151456	Ga0307410_101514562	204
434	3300031901	Ga0307406_10296895	Ga0307406_102968952	204
435	3300031903	Ga0307407_10051960	Ga0307407_100519602	204
436	3300031911	Ga0307412_10224419	Ga0307412_102244192	204
437	3300032002	Ga0307416_100228148	Ga0307416_1002281482	204
438	3300032002	Ga0307416_100745661	Ga0307416_1007456612	204
439	3300032005	Ga0307411_10155905	Ga0307411_101559052	204
440	3300032126	Ga0307415_100044356	Ga0307415_1000443564	204
441	3300035170	Ga0373943_0506295	Ga0373943_0506295_68_682	204
442	3300035725	Ga0373947_0365049	Ga0373947_0365049_296_910	204
443	3300037068	Ga0373925_0622809	Ga0373925_0622809_60_674	204
444	3300046539	Ga0495621_0005142	Ga0495621_0005142_1133_1747	204
445	3300046684	Ga0495669_0180179	Ga0495669_0180179_191_805	204
446	3300048903	Ga0496100_0127018	Ga0496100_0127018_92_706	204
447	3300048907	Ga0496104_0789126	Ga0496104_0789126_166_780	204
448	3300048911	Ga0496108_0605402	Ga0496108_0605402_122_736	204
449	3300048915	Ga0496112_0629494	Ga0496112_0629494_119_733	204
450	3300048916	Ga0496113_0023707	Ga0496113_0023707_3401_4015	204
451	3300048929	Ga0496126_0000003	Ga0496126_0000003_517635_518285	204
452	3300050509	nmdc:mga0qj67_35455_c1	nmdc:mga0qj67_35455_c1_397_1035	204

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02441

Flavoprotein

35

215

0.9 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
7km3-assembly1.cif.gz_A	dodecameric structure of the chlamydia trachomatis flavin prenyltransferase ubix ortholog ct220 with fmn and dmap	0.9764	7	195
7km2-assembly1.cif.gz_K	dodecameric structure of the chlamydia trachomatis flavin prenyltransferase ubix ortholog ct220 with fmn	0.975	7	197
7km3-assembly1.cif.gz_L	dodecameric structure of the chlamydia trachomatis flavin prenyltransferase ubix ortholog ct220 with fmn and dmap	0.9737	8	192
7km3-assembly1.cif.gz_I	dodecameric structure of the chlamydia trachomatis flavin prenyltransferase ubix ortholog ct220 with fmn and dmap	0.9733	7	197
7km3-assembly1.cif.gz_H	dodecameric structure of the chlamydia trachomatis flavin prenyltransferase ubix ortholog ct220 with fmn and dmap	0.971	7	195

ID	Description	Score	Start	End	Superfamily
af_P33751_55_242_3.40.50.1950	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like	0.9542	8	203	3.40.50.1950
1sbzC00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like	0.9534	9	190	3.40.50.1950
af_P33751_55_242_3.40.50.1950	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like	0.9443	8	203	3.40.50.1950
1sbzC00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like	0.9422	9	190	3.40.50.1950
2ejbA00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like	0.9356	7	193	3.40.50.1950

ID	Description	Score	Start	End	GO Terms
AF-A0A2N1W560-F1-model_v4	Aromatic acid decarboxylase	0.9899	6	160	GO:0004659
AF-A0A0S8FHB3-F1-model_v4	Flavin prenyltransferase UbiX (EC 2.5.1.129)	0.9824	6	200	GO:0016831 GO:0106141
AF-A0A2V7FWT6-F1-model_v4	Flavin prenyltransferase UbiX (EC 2.5.1.129)	0.9814	7	200	GO:0016831 GO:0106141
AF-A0A2N1W560-F1-model_v4	Aromatic acid decarboxylase	0.9772	6	160	GO:0004659
AF-L0IMV2-F1-model_v4	Flavin prenyltransferase UbiX (EC 2.5.1.129)	0.9746	7	197	GO:0016831 GO:0106141

Feature Viewer

pLDDT	pTM	Quality
92.38	0.9	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F447009

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF02441

Flavoprotein

Flavoprotein

35

215

0.9

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map